BLASTP 7.6.0


Query=fugu4_573365 |jgi|Takru4|573365|e_gw2.8182.2.1
        (117 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001jaf |10|NM_006955|Q06732|ZN11B_HUMAN|ZNF33B|NM_006955...     28   2.031
hg18||uc001jag |10|BC065181|Q06731|ZN33B_HUMAN|ZNF33B|NA|NA|Zinc...     28   2.031
hg18||uc003eso |3|AK125477|Q9NVQ4-2|Q9NVQ4-2|FAIM|NM_001033030|N...     28   2.031
hg18||uc003esp |3|NM_001033030|NA|NA|FAIM|NM_001033030|NP_001028...     28   2.031
hg18||uc003esq |3|NM_001033031|NA|NA|FAIM|NM_001033031|NP_001028...     28   2.031
hg18||uc003esr |3|NM_001033032|Q9NVQ4|FAIM1_HUMAN|FAIM|NM_001033...     28   2.031
hg18||uc003ess |3|NM_018147|Q9NVQ4|FAIM1_HUMAN|FAIM|NM_018147|NP...     28   2.031
hg18||uc001izg |10|NM_006954|A0AUX1|A0AUX1_HUMAN|ZNF33A|NM_00695...     26   5.909
hg18||uc001izh |10|NM_006974|Q06730|ZN33A_HUMAN|ZNF33A|NM_006974...     26   5.909

>hg18||uc001jaf |10|NM_006955|Q06732|ZN11B_HUMAN|ZNF33B|NM_006955|NP_008886|zinc
        finger protein 33B

          Length = 778

 Score =  28 bits (60), Expect = 2.031
 Identities = 12/48 (25%), Positives = 20/48 (41%), Gaps = 3/48 (6%)

Query:  57 CMQEDCNLVMYNDED---KPRWHTNTSKGSCNTCVLSLTDEGKLVLEK 101
           |   .|  . |   |     | ||      ||||  . . .  |.. .
Sbjct: 721 CQCNECGKIFYRKSDLAKHQRSHTGEKPYECNTCRKTFSQKSNLIVHQ 768

>hg18||uc001jag |10|BC065181|Q06731|ZN33B_HUMAN|ZNF33B|NA|NA|Zinc finger protein
        33B

          Length = 666

 Score =  28 bits (60), Expect = 2.031
 Identities = 12/48 (25%), Positives = 20/48 (41%), Gaps = 3/48 (6%)

Query:  57 CMQEDCNLVMYNDED---KPRWHTNTSKGSCNTCVLSLTDEGKLVLEK 101
           |   .|  . |   |     | ||      ||||  . . .  |.. .
Sbjct: 609 CQCNECGKIFYRKSDLAKHQRSHTGEKPYECNTCRKTFSQKSNLIVHQ 656

>hg18||uc003eso |3|AK125477|Q9NVQ4-2|Q9NVQ4-2|FAIM|NM_001033030|NP_001028202|Fas
        apoptotic inhibitory molecule isoform a

          Length = 166

 Score =  28 bits (60), Expect = 2.031
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query:  68 NDEDKPRWHTNTSKGSCNTCVLSLTDEG-KLVLEKDGQEIWNSGR 111
           | .   ..  . || . || || .  |  ..|||||  ..| .|.
Sbjct: 116 NGKSLKKYMEDRSK-TTNTWVLHMDGENFRIVLEKDAMDVWCNGK 159

>hg18||uc003esp |3|NM_001033030|NA|NA|FAIM|NM_001033030|NP_001028202|Fas
        apoptotic inhibitory molecule isoform a

          Length = 213

 Score =  28 bits (60), Expect = 2.031
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query:  68 NDEDKPRWHTNTSKGSCNTCVLSLTDEG-KLVLEKDGQEIWNSGR 111
           | .   ..  . || . || || .  |  ..|||||  ..| .|.
Sbjct: 116 NGKSLKKYMEDRSK-TTNTWVLHMDGENFRIVLEKDAMDVWCNGK 159

>hg18||uc003esq |3|NM_001033031|NA|NA|FAIM|NM_001033031|NP_001028203|Fas
        apoptotic inhibitory molecule isoform b

          Length = 201

 Score =  28 bits (60), Expect = 2.031
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query:  68 NDEDKPRWHTNTSKGSCNTCVLSLTDEG-KLVLEKDGQEIWNSGR 111
           | .   ..  . || . || || .  |  ..|||||  ..| .|.
Sbjct: 104 NGKSLKKYMEDRSK-TTNTWVLHMDGENFRIVLEKDAMDVWCNGK 147

>hg18||uc003esr
        |3|NM_001033032|Q9NVQ4|FAIM1_HUMAN|FAIM|NM_001033032|NP_001028204|Fas
        apoptotic inhibitory molecule isoform c

          Length = 179

 Score =  28 bits (60), Expect = 2.031
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query:  68 NDEDKPRWHTNTSKGSCNTCVLSLTDEG-KLVLEKDGQEIWNSGR 111
           | .   ..  . || . || || .  |  ..|||||  ..| .|.
Sbjct:  82 NGKSLKKYMEDRSK-TTNTWVLHMDGENFRIVLEKDAMDVWCNGK 125

>hg18||uc003ess |3|NM_018147|Q9NVQ4|FAIM1_HUMAN|FAIM|NM_018147|NP_060617|Fas
        apoptotic inhibitory molecule isoform c

          Length = 179

 Score =  28 bits (60), Expect = 2.031
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query:  68 NDEDKPRWHTNTSKGSCNTCVLSLTDEG-KLVLEKDGQEIWNSGR 111
           | .   ..  . || . || || .  |  ..|||||  ..| .|.
Sbjct:  82 NGKSLKKYMEDRSK-TTNTWVLHMDGENFRIVLEKDAMDVWCNGK 125

>hg18||uc001izg
        |10|NM_006954|A0AUX1|A0AUX1_HUMAN|ZNF33A|NM_006954|NP_008885|zinc
        finger protein 33A isoform a

          Length = 811

 Score =  26 bits (56), Expect = 5.909
 Identities = 11/48 (22%), Positives = 20/48 (41%), Gaps = 3/48 (6%)

Query:  57 CMQEDCNLVMYNDED---KPRWHTNTSKGSCNTCVLSLTDEGKLVLEK 101
           |   .|  . |   .     | ||      ||||  . . .  |.. .
Sbjct: 721 CQCNECGKIFYRKSELAQHQRSHTGEKPYECNTCRKTFSQKSNLIVHQ 768

>hg18||uc001izh |10|NM_006974|Q06730|ZN33A_HUMAN|ZNF33A|NM_006974|NP_008905|zinc
        finger protein 33A isoform b

          Length = 810

 Score =  26 bits (56), Expect = 5.909
 Identities = 11/48 (22%), Positives = 20/48 (41%), Gaps = 3/48 (6%)

Query:  57 CMQEDCNLVMYNDED---KPRWHTNTSKGSCNTCVLSLTDEGKLVLEK 101
           |   .|  . |   .     | ||      ||||  . . .  |.. .
Sbjct: 720 CQCNECGKIFYRKSELAQHQRSHTGEKPYECNTCRKTFSQKSNLIVHQ 767

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0