BLASTP 7.6.0


Query=fugu4_573286 |jgi|Takru4|573286|e_gw2.19.283.1
        (596 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001uwr |13|AY140646|Q15063-3|Q15063-3|POSTN|NM_006475|NP...    360   3e-099
hg18||uc001uwo |13|NM_006475|Q15063|POSTN_HUMAN|POSTN|NM_006475|...    357   2e-098
hg18||uc001uwp |13|BC106710|Q5VSY8|Q5VSY8_HUMAN|POSTN|NM_006475|...    353   4e-097
hg18||uc001uwq |13|AY918092|Q29XZ0|Q29XZ0_HUMAN|POSTN|NM_006475|...    353   4e-097
hg18||uc001uwo |13|NM_006475|Q15063|POSTN_HUMAN|POSTN|NM_006475|...    309   1e-083
hg18||uc001uwp |13|BC106710|Q5VSY8|Q5VSY8_HUMAN|POSTN|NM_006475|...    309   1e-083
hg18||uc001uwq |13|AY918092|Q29XZ0|Q29XZ0_HUMAN|POSTN|NM_006475|...    309   1e-083
hg18||uc001uwr |13|AY140646|Q15063-3|Q15063-3|POSTN|NM_006475|NP...    309   1e-083
hg18||uc003lbf |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP...    237   3e-062
hg18||uc003lbf |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP...    184   3e-046
hg18||uc003lbg |5|BC026352|Q49AT7|Q49AT7_HUMAN|TGFBI|NA|NA|TGFBI...    184   3e-046
hg18||uc003lbh |5|AK094055|NA|NA|TGFBI|NA|NA|Homo sapiens mRNA f...    184   3e-046
hg18||uc003lbh |5|AK094055|NA|NA|TGFBI|NA|NA|Homo sapiens mRNA f...    120   6e-027
hg18||uc001uwp |13|BC106710|Q5VSY8|Q5VSY8_HUMAN|POSTN|NM_006475|...     82   2e-015
hg18||uc001uwq |13|AY918092|Q29XZ0|Q29XZ0_HUMAN|POSTN|NM_006475|...     82   2e-015
hg18||uc001uwr |13|AY140646|Q15063-3|Q15063-3|POSTN|NM_006475|NP...     82   2e-015
hg18||uc001uwo |13|NM_006475|Q15063|POSTN_HUMAN|POSTN|NM_006475|...     81   4e-015
hg18||uc003lbf |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP...     78   3e-014
hg18||uc003lbh |5|AK094055|NA|NA|TGFBI|NA|NA|Homo sapiens mRNA f...     78   3e-014
hg18||uc003lbf |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP...     76   1e-013
hg18||uc003lbh |5|AK094055|NA|NA|TGFBI|NA|NA|Homo sapiens mRNA f...     72   2e-012
hg18||uc003lbf |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP...     65   2e-010
hg18||uc003lbg |5|BC026352|Q49AT7|Q49AT7_HUMAN|TGFBI|NA|NA|TGFBI...     65   2e-010
hg18||uc003lbh |5|AK094055|NA|NA|TGFBI|NA|NA|Homo sapiens mRNA f...     65   2e-010
hg18||uc003lbf |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP...     58   3e-008
hg18||uc003lbg |5|BC026352|Q49AT7|Q49AT7_HUMAN|TGFBI|NA|NA|TGFBI...     58   3e-008
hg18||uc003lbh |5|AK094055|NA|NA|TGFBI|NA|NA|Homo sapiens mRNA f...     58   3e-008
hg18||uc003lbg |5|BC026352|Q49AT7|Q49AT7_HUMAN|TGFBI|NA|NA|TGFBI...     57   5e-008
hg18||uc003lbg |5|BC026352|Q49AT7|Q49AT7_HUMAN|TGFBI|NA|NA|TGFBI...     55   2e-007
hg18||uc003dei |3|AB052957|Q9NY15-2|Q9NY15-2|STAB1|NA|NA|Stabili...     52   2e-006
hg18||uc003dej |3|NM_015136|Q9NY15|STAB1_HUMAN|STAB1|NM_015136|N...     52   2e-006
hg18||uc003lbf |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP...     50   6e-006
hg18||uc001uwo |13|NM_006475|Q15063|POSTN_HUMAN|POSTN|NM_006475|...     47   6e-005
hg18||uc001uwp |13|BC106710|Q5VSY8|Q5VSY8_HUMAN|POSTN|NM_006475|...     47   6e-005
hg18||uc001uwq |13|AY918092|Q29XZ0|Q29XZ0_HUMAN|POSTN|NM_006475|...     47   6e-005
hg18||uc001uwr |13|AY140646|Q15063-3|Q15063-3|POSTN|NM_006475|NP...     47   6e-005
hg18||uc001tjw |12|NM_017564|Q8WWQ8|STAB2_HUMAN|STAB2|NM_017564|...     45   2e-004
hg18||uc003dei |3|AB052957|Q9NY15-2|Q9NY15-2|STAB1|NA|NA|Stabili...     45   3e-004
hg18||uc003dej |3|NM_015136|Q9NY15|STAB1_HUMAN|STAB1|NM_015136|N...     45   3e-004
hg18||uc001tjw |12|NM_017564|Q8WWQ8|STAB2_HUMAN|STAB2|NM_017564|...     35   0.189

>hg18||uc001uwr
        |13|AY140646|Q15063-3|Q15063-3|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 755

 Score =  360 bits (923), Expect = 3e-099
 Identities = 186/351 (52%), Positives = 256/351 (72%), Gaps = 8/351 (2%)

Query: 219 SAKQVMELVGDSQSTFRDMVAQLGLSSAMRPKAEYTLLAPHNDAFSDEVMSKDQRLLRIL 278
           |||||.|| |  |.|| |.||||||.||.||  ||||||| |.||||. .| |||||...
Sbjct: 369 SAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSMDQRLLKLI 428

Query: 279 LENHILKNKVVLGELYNGQHLETIGGKLLRVFIYRTAVCIENSCLIRGSKEGINGALHIT 338
           |.||||| || | |||||| ||||||| ||||.|||||||||||. .|||.| |||.|| 
Sbjct: 429 LQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIF 488

Query: 339 KTLLKPSEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQSD 398
           . ..||.||...| | .. ||  ||||.|||.. .|| | ||.||| |...|| |.|  .
Sbjct: 489 REIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEE 548

Query: 399 LTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQVNSLQ 458
             .|  |  ||. |.|||   |.||| | | ||||. |. ||. | .   | |. || |.
Sbjct: 549 KEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELK 608

Query: 459 IPESDIMGKNGVIHFVNHILYPGDIPVGSQSLLSLLRKMITNIQIKYISGYKYQEIPLTF 518
             |||||  ||||| |. .||| | |||.  || .| |.|  ||||.. |  ..|||.| 
Sbjct: 609 SKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTV 668

Query: 519 LSKTVTRF-VQEVPDVTKFTRVVQSKPTFTKLTIEGIEEPSITEITRLVQG 568
              |.|.  ..  |.     |...   | |.. | |  || | . |... |
Sbjct: 669 YRPTLTKVKIEGEPEF----RLIKEGETITEV-IHG--EPIIKKYTKIIDG 712

>hg18||uc001uwo
        |13|NM_006475|Q15063|POSTN_HUMAN|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 836

 Score =  357 bits (916), Expect = 2e-098
 Identities = 187/358 (52%), Positives = 259/358 (72%), Gaps = 8/358 (2%)

Query: 219 SAKQVMELVGDSQSTFRDMVAQLGLSSAMRPKAEYTLLAPHNDAFSDEVMSKDQRLLRIL 278
           |||||.|| |  |.|| |.||||||.||.||  ||||||| |.||||. .|  ||||...
Sbjct: 369 SAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSMVQRLLKLI 428

Query: 279 LENHILKNKVVLGELYNGQHLETIGGKLLRVFIYRTAVCIENSCLIRGSKEGINGALHIT 338
           |.||||| || | |||||| ||||||| ||||.|||||||||||. .|||.| |||.|| 
Sbjct: 429 LQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIF 488

Query: 339 KTLLKPSEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQSD 398
           . ..||.||...| | .. ||  ||||.|||.. .|| | ||.||| |...|| |.|  .
Sbjct: 489 REIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEE 548

Query: 399 LTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQVNSLQ 458
             .|  |  ||. |.|||   |.||| | | ||||. |. ||. | .   | |. || |.
Sbjct: 549 KEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELK 608

Query: 459 IPESDIMGKNGVIHFVNHILYPGDIPVGSQSLLSLLRKMITNIQIKYISGYKYQEIPLT- 517
             |||||  ||||| |. .||| | |||.  || .| |.|  ||||.. |  ..|||.| 
Sbjct: 609 SKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTV 668

Query: 518 FLSKTVTRFVQEVPDVTK--FTRVVQSK-PTFTKLTIEGIEEPSITE----ITRLVQG 568
           . .| .|. |.    | .     ..... || ||. |||  |  . .    || .. |
Sbjct: 669 YTTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHG 726

>hg18||uc001uwp
        |13|BC106710|Q5VSY8|Q5VSY8_HUMAN|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 779

 Score =  353 bits (905), Expect = 4e-097
 Identities = 177/316 (56%), Positives = 236/316 (74%), Gaps = 3/316 (0%)

Query: 219 SAKQVMELVGDSQSTFRDMVAQLGLSSAMRPKAEYTLLAPHNDAFSDEVMSKDQRLLRIL 278
           |||||.|| |  |.|| |.||||||.||.||  ||||||| |.||||. .| |||||...
Sbjct: 369 SAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSMDQRLLKLI 428

Query: 279 LENHILKNKVVLGELYNGQHLETIGGKLLRVFIYRTAVCIENSCLIRGSKEGINGALHIT 338
           |.||||| || | |||||| ||||||| ||||.|||||||||||. .|||.| |||.|| 
Sbjct: 429 LQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIF 488

Query: 339 KTLLKPSEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQSD 398
           . ..||.||...| | .. ||  ||||.|||.. .|| | ||.||| |...|| |.|  .
Sbjct: 489 REIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEE 548

Query: 399 LTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQVNSLQ 458
             .|  |  ||. |.|||   |.||| | | ||||. |. ||. | .   | |. || |.
Sbjct: 549 KEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELK 608

Query: 459 IPESDIMGKNGVIHFVNHILYPGDIPVGSQSLLSLLRKMITNIQIKYISGYKYQEIPLTF 518
             |||||  ||||| |. .||| | |||.  || .| |.|  ||||.. |  ..|||.| 
Sbjct: 609 SKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTV 668

Query: 519 ---LSKTVTRFVQEVP 531
              . |  |. .  ||
Sbjct: 669 YKPIIKKYTKIIDGVP 684

>hg18||uc001uwq
        |13|AY918092|Q29XZ0|Q29XZ0_HUMAN|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 739

 Score =  353 bits (905), Expect = 4e-097
 Identities = 177/316 (56%), Positives = 236/316 (74%), Gaps = 3/316 (0%)

Query: 219 SAKQVMELVGDSQSTFRDMVAQLGLSSAMRPKAEYTLLAPHNDAFSDEVMSKDQRLLRIL 278
           |||||.|| |  |.|| |.||||||.||.||  ||||||| |.||||. .| |||||...
Sbjct: 369 SAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSMDQRLLKLI 428

Query: 279 LENHILKNKVVLGELYNGQHLETIGGKLLRVFIYRTAVCIENSCLIRGSKEGINGALHIT 338
           |.||||| || | |||||| ||||||| ||||.|||||||||||. .|||.| |||.|| 
Sbjct: 429 LQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIF 488

Query: 339 KTLLKPSEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQSD 398
           . ..||.||...| | .. ||  ||||.|||.. .|| | ||.||| |...|| |.|  .
Sbjct: 489 REIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEE 548

Query: 399 LTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQVNSLQ 458
             .|  |  ||. |.|||   |.||| | | ||||. |. ||. | .   | |. || |.
Sbjct: 549 KEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELK 608

Query: 459 IPESDIMGKNGVIHFVNHILYPGDIPVGSQSLLSLLRKMITNIQIKYISGYKYQEIPLTF 518
             |||||  ||||| |. .||| | |||.  || .| |.|  ||||.. |  ..|||.| 
Sbjct: 609 SKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTV 668

Query: 519 ---LSKTVTRFVQEVP 531
              . |  |. .  ||
Sbjct: 669 YKPIIKKYTKIIDGVP 684

>hg18||uc001uwo
        |13|NM_006475|Q15063|POSTN_HUMAN|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 836

 Score =  309 bits (789), Expect = 1e-083
 Identities = 145/207 (70%), Positives = 174/207 (84%)

Query:   1 TVLYECCPGYMKLEGMHGCPAVAPIDDVYGTLGVVKATSTQRYSEISKLRPEIEGSGSYT 60
           |||||||||||..||| ||||| ||| ||||||.| ||.|||||. |||| |||| ||.|
Sbjct:  74 TVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFT 133

Query:  61 FFAPSNEAWDSLDDTMKNALVSNVNVELYNALHYHMSKRRLLTKDLKNGMTVPSMNLDLD 120
           .|||||||||.||  ..  | ||||||| |||| ||  .|.||||||||| .|||  .| 
Sbjct: 134 YFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLG 193

Query: 121 LYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDRVISAVGNTIQDVIENDDELSTLSDV 180
           |.|||||||||||||||||||||.||||||||||||.. .| .||| || .|.||.    
Sbjct: 194 LFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAA 253

Query: 181 AQSAGVLEKLGQPGQYTLFAPTNKAFE 207
           | .. .|| ||. | .|||||||.|||
Sbjct: 254 AITSDILEALGRDGHFTLFAPTNEAFE 280

>hg18||uc001uwp
        |13|BC106710|Q5VSY8|Q5VSY8_HUMAN|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 779

 Score =  309 bits (789), Expect = 1e-083
 Identities = 145/207 (70%), Positives = 174/207 (84%)

Query:   1 TVLYECCPGYMKLEGMHGCPAVAPIDDVYGTLGVVKATSTQRYSEISKLRPEIEGSGSYT 60
           |||||||||||..||| ||||| ||| ||||||.| ||.|||||. |||| |||| ||.|
Sbjct:  74 TVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFT 133

Query:  61 FFAPSNEAWDSLDDTMKNALVSNVNVELYNALHYHMSKRRLLTKDLKNGMTVPSMNLDLD 120
           .|||||||||.||  ..  | ||||||| |||| ||  .|.||||||||| .|||  .| 
Sbjct: 134 YFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLG 193

Query: 121 LYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDRVISAVGNTIQDVIENDDELSTLSDV 180
           |.|||||||||||||||||||||.||||||||||||.. .| .||| || .|.||.    
Sbjct: 194 LFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAA 253

Query: 181 AQSAGVLEKLGQPGQYTLFAPTNKAFE 207
           | .. .|| ||. | .|||||||.|||
Sbjct: 254 AITSDILEALGRDGHFTLFAPTNEAFE 280

>hg18||uc001uwq
        |13|AY918092|Q29XZ0|Q29XZ0_HUMAN|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 739

 Score =  309 bits (789), Expect = 1e-083
 Identities = 145/207 (70%), Positives = 174/207 (84%)

Query:   1 TVLYECCPGYMKLEGMHGCPAVAPIDDVYGTLGVVKATSTQRYSEISKLRPEIEGSGSYT 60
           |||||||||||..||| ||||| ||| ||||||.| ||.|||||. |||| |||| ||.|
Sbjct:  74 TVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFT 133

Query:  61 FFAPSNEAWDSLDDTMKNALVSNVNVELYNALHYHMSKRRLLTKDLKNGMTVPSMNLDLD 120
           .|||||||||.||  ..  | ||||||| |||| ||  .|.||||||||| .|||  .| 
Sbjct: 134 YFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLG 193

Query: 121 LYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDRVISAVGNTIQDVIENDDELSTLSDV 180
           |.|||||||||||||||||||||.||||||||||||.. .| .||| || .|.||.    
Sbjct: 194 LFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAA 253

Query: 181 AQSAGVLEKLGQPGQYTLFAPTNKAFE 207
           | .. .|| ||. | .|||||||.|||
Sbjct: 254 AITSDILEALGRDGHFTLFAPTNEAFE 280

>hg18||uc001uwr
        |13|AY140646|Q15063-3|Q15063-3|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 755

 Score =  309 bits (789), Expect = 1e-083
 Identities = 145/207 (70%), Positives = 174/207 (84%)

Query:   1 TVLYECCPGYMKLEGMHGCPAVAPIDDVYGTLGVVKATSTQRYSEISKLRPEIEGSGSYT 60
           |||||||||||..||| ||||| ||| ||||||.| ||.|||||. |||| |||| ||.|
Sbjct:  74 TVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFT 133

Query:  61 FFAPSNEAWDSLDDTMKNALVSNVNVELYNALHYHMSKRRLLTKDLKNGMTVPSMNLDLD 120
           .|||||||||.||  ..  | ||||||| |||| ||  .|.||||||||| .|||  .| 
Sbjct: 134 YFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLG 193

Query: 121 LYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDRVISAVGNTIQDVIENDDELSTLSDV 180
           |.|||||||||||||||||||||.||||||||||||.. .| .||| || .|.||.    
Sbjct: 194 LFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAA 253

Query: 181 AQSAGVLEKLGQPGQYTLFAPTNKAFE 207
           | .. .|| ||. | .|||||||.|||
Sbjct: 254 AITSDILEALGRDGHFTLFAPTNEAFE 280

>hg18||uc003lbf
        |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP_000349|transforming
        growth factor, beta-induced, 68kDa

          Length = 683

 Score =  237 bits (604), Expect = 3e-062
 Identities = 116/207 (56%), Positives = 152/207 (73%), Gaps = 1/207 (0%)

Query:   2 VLYECCPGYMKLEGMHGCPAVAPIDDVYGTLGVVKATSTQRYSE-ISKLRPEIEGSGSYT 60
           . ||||||| |. |  ||||  |. ..| ||||| .|.|| |..   |||||.|| ||.|
Sbjct:  80 ISYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGSTTTQLYTDRTEKLRPEMEGPGSFT 139

Query:  61 FFAPSNEAWDSLDDTMKNALVSNVNVELYNALHYHMSKRRLLTKDLKNGMTVPSMNLDLD 120
            |||||||| ||   . ..||||||.|| ||| |||  ||.|| .||.|||. ||  . .
Sbjct: 140 IFAPSNEAWASLPAEVLDSLVSNVNIELLNALRYHMVGRRVLTDELKHGMTLTSMYQNSN 199

Query: 121 LYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDRVISAVGNTIQDVIENDDELSTLSDV 180
           . |.|||||.|||||||..  .  |||||||.||.||| . | || .|| .|   ||   
Sbjct: 200 IQIHHYPNGIVTVNCARLLKADHHATNGVVHLIDKVISTITNNIQQIIEIEDTFETLRAA 259

Query: 181 AQSAGVLEKLGQPGQYTLFAPTNKAFE 207
             ..|.   |   ||||| ||||.|||
Sbjct: 260 VAASGLNTMLEGNGQYTLLAPTNEAFE 286

>hg18||uc003lbf
        |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP_000349|transforming
        growth factor, beta-induced, 68kDa

          Length = 683

 Score =  184 bits (466), Expect = 3e-046
 Identities = 103/263 (39%), Positives = 149/263 (56%), Gaps = 4/263 (1%)

Query: 219 SAKQVMELVGDSQ-STFRDMVAQLGLSSAMRPKAEYTLLAPHNDAFSDEVMSKDQRLLRI 277
           ||| . ||  .|  ||  |.  | || . .      ||||| |  | |     |    | 
Sbjct: 375 SAKTLFELAAESDVSTAIDLFRQAGLGNHLSGSERLTLLAPLNSVFKDGTPPIDAH-TRN 433

Query: 278 LLENHILKNKVVLGELYNGQHLETIGGKLLRVFIYRTAVCIENSCLIRGSKEGINGALHI 337
           || |||.|...    ||.|| |||.||| ||||.|| ..||||||.    | |  | |  
Sbjct: 434 LLRNHIIKDQLASKYLYHGQTLETLGGKKLRVFVYRNSLCIENSCIAAHDKRGRYGTLFT 493

Query: 338 TKTLLKPSEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQS 397
              .| |   |. ..|  . || . .. ...| .|. | .|| .|.|||..|||  |   
Sbjct: 494 MDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPR 553

Query: 398 DLTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQVNSL 457
           . . |  |   |  || ||    | . ||.  |     |||||. ..|   |  . ||  
Sbjct: 554 ERSRLLGDAKELANILKYHIGDEILVSGGI--GALVRLKSLQGDKLEVSLKNNVVSVNKE 611

Query: 458 QIPESDIMGKNGVIHFVNHILYP 480
            . | |||  |||.| . ..| |
Sbjct: 612 PVAEPDIMATNGVVHVITNVLQP 634

>hg18||uc003lbg |5|BC026352|Q49AT7|Q49AT7_HUMAN|TGFBI|NA|NA|TGFBI protein

          Length = 416

 Score =  184 bits (466), Expect = 3e-046
 Identities = 103/263 (39%), Positives = 149/263 (56%), Gaps = 4/263 (1%)

Query: 219 SAKQVMELVGDSQ-STFRDMVAQLGLSSAMRPKAEYTLLAPHNDAFSDEVMSKDQRLLRI 277
           ||| . ||  .|  ||  |.  | || . .      ||||| |  | |     |    | 
Sbjct: 108 SAKTLFELAAESDVSTAIDLFRQAGLGNHLSGSERLTLLAPLNSVFKDGTPPIDAH-TRN 166

Query: 278 LLENHILKNKVVLGELYNGQHLETIGGKLLRVFIYRTAVCIENSCLIRGSKEGINGALHI 337
           || |||.|...    ||.|| |||.||| ||||.|| ..||||||.    | |  | |  
Sbjct: 167 LLRNHIIKDQLASKYLYHGQTLETLGGKKLRVFVYRNSLCIENSCIAAHDKRGRYGTLFT 226

Query: 338 TKTLLKPSEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQS 397
              .| |   |. ..|  . || . .. ...| .|. | .|| .|.|||..|||  |   
Sbjct: 227 MDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPR 286

Query: 398 DLTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQVNSL 457
           . . |  |   |  || ||    | . ||.  |     |||||. ..|   |  . ||  
Sbjct: 287 ERSRLLGDAKELANILKYHIGDEILVSGGI--GALVRLKSLQGDKLEVSLKNNVVSVNKE 344

Query: 458 QIPESDIMGKNGVIHFVNHILYP 480
            . | |||  |||.| . ..| |
Sbjct: 345 PVAEPDIMATNGVVHVITNVLQP 367

>hg18||uc003lbh |5|AK094055|NA|NA|TGFBI|NA|NA|Homo sapiens mRNA for transforming
        growth factor, beta-induced, 68kDa variant protein

          Length = 509

 Score =  184 bits (466), Expect = 3e-046
 Identities = 103/263 (39%), Positives = 149/263 (56%), Gaps = 4/263 (1%)

Query: 219 SAKQVMELVGDSQ-STFRDMVAQLGLSSAMRPKAEYTLLAPHNDAFSDEVMSKDQRLLRI 277
           ||| . ||  .|  ||  |.  | || . .      ||||| |  | |     |    | 
Sbjct: 201 SAKTLFELAAESDVSTAIDLFRQAGLGNHLSGSERLTLLAPLNSVFKDGTPPIDAH-TRN 259

Query: 278 LLENHILKNKVVLGELYNGQHLETIGGKLLRVFIYRTAVCIENSCLIRGSKEGINGALHI 337
           || |||.|...    ||.|| |||.||| ||||.|| ..||||||.    | |  | |  
Sbjct: 260 LLRNHIIKDQLASKYLYHGQTLETLGGKKLRVFVYRNSLCIENSCIAAHDKRGRYGTLFT 319

Query: 338 TKTLLKPSEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQS 397
              .| |   |. ..|  . || . .. ...| .|. | .|| .|.|||..|||  |   
Sbjct: 320 MDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPR 379

Query: 398 DLTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQVNSL 457
           . . |  |   |  || ||    | . ||.  |     |||||. ..|   |  . ||  
Sbjct: 380 ERSRLLGDAKELANILKYHIGDEILVSGGI--GALVRLKSLQGDKLEVSLKNNVVSVNKE 437

Query: 458 QIPESDIMGKNGVIHFVNHILYP 480
            . | |||  |||.| . ..| |
Sbjct: 438 PVAEPDIMATNGVVHVITNVLQP 460

>hg18||uc003lbh |5|AK094055|NA|NA|TGFBI|NA|NA|Homo sapiens mRNA for transforming
        growth factor, beta-induced, 68kDa variant protein

          Length = 509

 Score =  120 bits (300), Expect = 6e-027
 Identities = 59/112 (52%), Positives = 80/112 (71%)

Query:  96 MSKRRLLTKDLKNGMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDR 155
           |  ||.|| .||.|||. ||  . .. |.|||||.|||||||..  .  |||||||.||.
Sbjct:   1 MVGRRVLTDELKHGMTLTSMYQNSNIQIHHYPNGIVTVNCARLLKADHHATNGVVHLIDK 60

Query: 156 VISAVGNTIQDVIENDDELSTLSDVAQSAGVLEKLGQPGQYTLFAPTNKAFE 207
           ||| . | || .|| .|   ||     ..|.   |   ||||| ||||.|||
Sbjct:  61 VISTITNNIQQIIEIEDTFETLRAAVAASGLNTMLEGNGQYTLLAPTNEAFE 112

>hg18||uc001uwp
        |13|BC106710|Q5VSY8|Q5VSY8_HUMAN|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 779

 Score =  82 bits (200), Expect = 2e-015
 Identities = 52/205 (25%), Positives = 103/205 (50%), Gaps = 5/205 (2%)

Query: 279 LENHILKNKVVLGELYNGQHLETIGGKL-LRVFIYRTAVCIENSC-LIRGSKEGINGALH 336
           | .|..  ...  .| ||  . ..   | | .  |   |   |   .| |..   || .|
Sbjct: 165 LHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVH 224

Query: 337 ITKTLLKPSEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQ 396
           .   .|     .| . .        | .    ... . | ..| ||||||..|||  | .
Sbjct: 225 VIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPR 284

Query: 397 SDLTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQVNS 456
             |  .  |  |   .. ||    .     .  |   .|..|.|| |..     .. || 
Sbjct: 285 GVLERIMGDKVASEALMKYHILNTLQCSESIMGGA--VFETLEGNTIEIGCDGDSITVNG 342

Query: 457 LQ-IPESDIMGKNGVIHFVNHILYP 480
           .. . . ||.  ||||| .. .| |
Sbjct: 343 IKMVNKKDIVTNNGVIHLIDQVLIP 367

>hg18||uc001uwq
        |13|AY918092|Q29XZ0|Q29XZ0_HUMAN|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 739

 Score =  82 bits (200), Expect = 2e-015
 Identities = 52/205 (25%), Positives = 103/205 (50%), Gaps = 5/205 (2%)

Query: 279 LENHILKNKVVLGELYNGQHLETIGGKL-LRVFIYRTAVCIENSC-LIRGSKEGINGALH 336
           | .|..  ...  .| ||  . ..   | | .  |   |   |   .| |..   || .|
Sbjct: 165 LHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVH 224

Query: 337 ITKTLLKPSEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQ 396
           .   .|     .| . .        | .    ... . | ..| ||||||..|||  | .
Sbjct: 225 VIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPR 284

Query: 397 SDLTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQVNS 456
             |  .  |  |   .. ||    .     .  |   .|..|.|| |..     .. || 
Sbjct: 285 GVLERIMGDKVASEALMKYHILNTLQCSESIMGGA--VFETLEGNTIEIGCDGDSITVNG 342

Query: 457 LQ-IPESDIMGKNGVIHFVNHILYP 480
           .. . . ||.  ||||| .. .| |
Sbjct: 343 IKMVNKKDIVTNNGVIHLIDQVLIP 367

>hg18||uc001uwr
        |13|AY140646|Q15063-3|Q15063-3|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 755

 Score =  82 bits (200), Expect = 2e-015
 Identities = 52/205 (25%), Positives = 103/205 (50%), Gaps = 5/205 (2%)

Query: 279 LENHILKNKVVLGELYNGQHLETIGGKL-LRVFIYRTAVCIENSC-LIRGSKEGINGALH 336
           | .|..  ...  .| ||  . ..   | | .  |   |   |   .| |..   || .|
Sbjct: 165 LHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVH 224

Query: 337 ITKTLLKPSEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQ 396
           .   .|     .| . .        | .    ... . | ..| ||||||..|||  | .
Sbjct: 225 VIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPR 284

Query: 397 SDLTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQVNS 456
             |  .  |  |   .. ||    .     .  |   .|..|.|| |..     .. || 
Sbjct: 285 GVLERIMGDKVASEALMKYHILNTLQCSESIMGGA--VFETLEGNTIEIGCDGDSITVNG 342

Query: 457 LQ-IPESDIMGKNGVIHFVNHILYP 480
           .. . . ||.  ||||| .. .| |
Sbjct: 343 IKMVNKKDIVTNNGVIHLIDQVLIP 367

>hg18||uc001uwo
        |13|NM_006475|Q15063|POSTN_HUMAN|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 836

 Score =  81 bits (198), Expect = 4e-015
 Identities = 52/205 (25%), Positives = 102/205 (49%), Gaps = 5/205 (2%)

Query: 279 LENHILKNKVVLGELYNGQHLETIGGKL-LRVFIYRTAVCIENSC-LIRGSKEGINGALH 336
           | .|..  ...  .| ||  . ..   | | .  |   |   |   .| |..   || .|
Sbjct: 165 LHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVH 224

Query: 337 ITKTLLKPSEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQ 396
           .   .|     .| . .        | .    ... . | ..| ||||||..|||  | .
Sbjct: 225 VIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPR 284

Query: 397 SDLTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQVNS 456
             |     |  |   .. ||    .     .  |   .|..|.|| |..     .. || 
Sbjct: 285 GVLERFMGDKVASEALMKYHILNTLQCSESIMGGA--VFETLEGNTIEIGCDGDSITVNG 342

Query: 457 LQ-IPESDIMGKNGVIHFVNHILYP 480
           .. . . ||.  ||||| .. .| |
Sbjct: 343 IKMVNKKDIVTNNGVIHLIDQVLIP 367

>hg18||uc003lbf
        |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP_000349|transforming
        growth factor, beta-induced, 68kDa

          Length = 683

 Score =  78 bits (191), Expect = 3e-014
 Identities = 77/280 (27%), Positives = 124/280 (44%), Gaps = 24/280 (8%)

Query: 217 TISAKQVMELVGDSQSTFRDMVAQLGLSSAMRPKAEYTLLAPHNDAFS---DEVMSK--- 270
           | . .|..| . |.  | |  ||  ||.. .    .|||||| |.||     | ...   
Sbjct: 240 TNNIQQIIE-IEDTFETLRAAVAASGLNTMLEGNGQYTLLAPTNEAFEKIPSETLNRILG 298

Query: 271 DQRLLRILLENHILKNKVVLGELYNGQHLETIGGKLLRVFIYRTAVCIENSCLIRGSK-E 329
           |   || || |||||. .    .  |  .||. |  | |      . |    .|      
Sbjct: 299 DPEALRDLLNNHILKSAMCAEAIVAGLSVETLEGTTLEVGCSGDMLTINGKAIISNKDIL 358

Query: 330 GINGALHITKTLLKP-SEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSD 388
             || .|    || | | ||..|.  |.      . |   | . . |      || || .
Sbjct: 359 ATNGVIHYIDELLIPDSAKTLFELAAESD-VSTAIDLFRQAGLGNHLSGSERLTLLAPLN 417

Query: 389 EAFA-GLTQSDLTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIF 447
             |  |    |           | .|  |  |       | .| |   ..| |  ..|  
Sbjct: 418 SVFKDGTPPID--------AHTRNLLRNHIIKDQLASKYLYHGQT--LETLGGKKLRVFV 467

Query: 448 ANKTMQVNSLQIPESDIMGKNGVIHFVNHILYPGDIPVGS 487
              .. . .  |   |  |. | .  .. .| |   |.|.
Sbjct: 468 YRNSLCIENSCIAAHDKRGRYGTLFTMDRVLTP---PMGT 504

>hg18||uc003lbh |5|AK094055|NA|NA|TGFBI|NA|NA|Homo sapiens mRNA for transforming
        growth factor, beta-induced, 68kDa variant protein

          Length = 509

 Score =  78 bits (191), Expect = 3e-014
 Identities = 77/280 (27%), Positives = 124/280 (44%), Gaps = 24/280 (8%)

Query: 217 TISAKQVMELVGDSQSTFRDMVAQLGLSSAMRPKAEYTLLAPHNDAFS---DEVMSK--- 270
           | . .|..| . |.  | |  ||  ||.. .    .|||||| |.||     | ...   
Sbjct:  66 TNNIQQIIE-IEDTFETLRAAVAASGLNTMLEGNGQYTLLAPTNEAFEKIPSETLNRILG 124

Query: 271 DQRLLRILLENHILKNKVVLGELYNGQHLETIGGKLLRVFIYRTAVCIENSCLIRGSK-E 329
           |   || || |||||. .    .  |  .||. |  | |      . |    .|      
Sbjct: 125 DPEALRDLLNNHILKSAMCAEAIVAGLSVETLEGTTLEVGCSGDMLTINGKAIISNKDIL 184

Query: 330 GINGALHITKTLLKP-SEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSD 388
             || .|    || | | ||..|.  |.      . |   | . . |      || || .
Sbjct: 185 ATNGVIHYIDELLIPDSAKTLFELAAESD-VSTAIDLFRQAGLGNHLSGSERLTLLAPLN 243

Query: 389 EAFA-GLTQSDLTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIF 447
             |  |    |           | .|  |  |       | .| |   ..| |  ..|  
Sbjct: 244 SVFKDGTPPID--------AHTRNLLRNHIIKDQLASKYLYHGQT--LETLGGKKLRVFV 293

Query: 448 ANKTMQVNSLQIPESDIMGKNGVIHFVNHILYPGDIPVGS 487
              .. . .  |   |  |. | .  .. .| |   |.|.
Sbjct: 294 YRNSLCIENSCIAAHDKRGRYGTLFTMDRVLTP---PMGT 330

>hg18||uc003lbf
        |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP_000349|transforming
        growth factor, beta-induced, 68kDa

          Length = 683

 Score =  76 bits (185), Expect = 1e-013
 Identities = 52/219 (23%), Positives = 102/219 (46%), Gaps = 5/219 (2%)

Query: 265 DEVMSKDQRLLRILLENHILKNKVVLGELYNGQHLETI-GGKLLRVFIYRTAVCIENSC- 322
           | ..|     |   |  |..  .|.  || .|  | ..     ...  |   .   |   
Sbjct: 157 DSLVSNVNIELLNALRYHMVGRRVLTDELKHGMTLTSMYQNSNIQIHHYPNGIVTVNCAR 216

Query: 323 LIRGSKEGINGALHITKTLLKPSEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFT 382
           |..      || .|.   ..      | .|.     |.   . . |. .  .|.  | .|
Sbjct: 217 LLKADHHATNGVVHLIDKVISTITNNIQQIIEIEDTFETLRAAVAASGLNTMLEGNGQYT 276

Query: 383 LFAPSDEAFAGLTQSDLTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNN 442
           | ||..|||  .    |  .  |  ||| .|  |  |       .  |..   ..|.|  
Sbjct: 277 LLAPTNEAFEKIPSETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGLS--VETLEGTT 334

Query: 443 IKVIFANKTMQVNSLQ-IPESDIMGKNGVIHFVNHILYP 480
           ..|  .   . .|    |   ||.  |||||... .| |
Sbjct: 335 LEVGCSGDMLTINGKAIISNKDILATNGVIHYIDELLIP 373

>hg18||uc003lbh |5|AK094055|NA|NA|TGFBI|NA|NA|Homo sapiens mRNA for transforming
        growth factor, beta-induced, 68kDa variant protein

          Length = 509

 Score =  72 bits (174), Expect = 2e-012
 Identities = 47/197 (23%), Positives = 93/197 (47%), Gaps = 5/197 (2%)

Query: 287 KVVLGELYNGQHLETI-GGKLLRVFIYRTAVCIENSC-LIRGSKEGINGALHITKTLLKP 344
           .|.  || .|  | ..     ...  |   .   |   |..      || .|.   ..  
Sbjct:   5 RVLTDELKHGMTLTSMYQNSNIQIHHYPNGIVTVNCARLLKADHHATNGVVHLIDKVIST 64

Query: 345 SEKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQSDLTLLKS 404
               | .|.     |.   . . |. .  .|.  | .|| ||..|||  .    |  .  
Sbjct:  65 ITNNIQQIIEIEDTFETLRAAVAASGLNTMLEGNGQYTLLAPTNEAFEKIPSETLNRILG 124

Query: 405 DITALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQVNSLQ-IPESD 463
           |  ||| .|  |  |       .  |..   ..|.|  ..|  .   . .|    |   |
Sbjct: 125 DPEALRDLLNNHILKSAMCAEAIVAGLS--VETLEGTTLEVGCSGDMLTINGKAIISNKD 182

Query: 464 IMGKNGVIHFVNHILYP 480
           |.  |||||... .| |
Sbjct: 183 ILATNGVIHYIDELLIP 199

>hg18||uc003lbf
        |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP_000349|transforming
        growth factor, beta-induced, 68kDa

          Length = 683

 Score =  65 bits (158), Expect = 2e-010
 Identities = 40/123 (32%), Positives = 64/123 (52%), Gaps = 2/123 (1%)

Query:  84 VNVELYNALHYHMSKRRLLTKDLKNGMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGNQ 143
           ..    | |  |. | .| .| | .| |. ..     | .  | | .   |     |  .
Sbjct: 427 IDAHTRNLLRNHIIKDQLASKYLYHGQTLETLG-GKKLRVFVYRNSLCIENSCIAAHDKR 485

Query: 144 VATNGVVHVIDRVISAVGNTIQDVIENDDELSTLSDVAQSAGVLEKLGQPGQYTLFAPTN 203
               | .  .|||..    |. ||.. |.  | |    ||||. | | . | ||.|||||
Sbjct: 486 -GRYGTLFTMDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTN 544

Query: 204 KAF 206
           .||
Sbjct: 545 EAF 547

>hg18||uc003lbg |5|BC026352|Q49AT7|Q49AT7_HUMAN|TGFBI|NA|NA|TGFBI protein

          Length = 416

 Score =  65 bits (158), Expect = 2e-010
 Identities = 40/123 (32%), Positives = 64/123 (52%), Gaps = 2/123 (1%)

Query:  84 VNVELYNALHYHMSKRRLLTKDLKNGMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGNQ 143
           ..    | |  |. | .| .| | .| |. ..     | .  | | .   |     |  .
Sbjct: 160 IDAHTRNLLRNHIIKDQLASKYLYHGQTLETLG-GKKLRVFVYRNSLCIENSCIAAHDKR 218

Query: 144 VATNGVVHVIDRVISAVGNTIQDVIENDDELSTLSDVAQSAGVLEKLGQPGQYTLFAPTN 203
               | .  .|||..    |. ||.. |.  | |    ||||. | | . | ||.|||||
Sbjct: 219 -GRYGTLFTMDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTN 277

Query: 204 KAF 206
           .||
Sbjct: 278 EAF 280

>hg18||uc003lbh |5|AK094055|NA|NA|TGFBI|NA|NA|Homo sapiens mRNA for transforming
        growth factor, beta-induced, 68kDa variant protein

          Length = 509

 Score =  65 bits (158), Expect = 2e-010
 Identities = 40/123 (32%), Positives = 64/123 (52%), Gaps = 2/123 (1%)

Query:  84 VNVELYNALHYHMSKRRLLTKDLKNGMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGNQ 143
           ..    | |  |. | .| .| | .| |. ..     | .  | | .   |     |  .
Sbjct: 253 IDAHTRNLLRNHIIKDQLASKYLYHGQTLETLG-GKKLRVFVYRNSLCIENSCIAAHDKR 311

Query: 144 VATNGVVHVIDRVISAVGNTIQDVIENDDELSTLSDVAQSAGVLEKLGQPGQYTLFAPTN 203
               | .  .|||..    |. ||.. |.  | |    ||||. | | . | ||.|||||
Sbjct: 312 -GRYGTLFTMDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTN 370

Query: 204 KAF 206
           .||
Sbjct: 371 EAF 373

>hg18||uc003lbf
        |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP_000349|transforming
        growth factor, beta-induced, 68kDa

          Length = 683

 Score =  58 bits (139), Expect = 3e-008
 Identities = 44/127 (34%), Positives = 63/127 (49%), Gaps = 6/127 (4%)

Query:  49 LRPEIEGSGSYTFFAPSNEAWDSLDDTMKNALVSNVNVELYNALHYHMSKRRLLTKDLKN 108
           |   .   | || |||.|||. .|    .. |. .   || | | ||.    |..  .  
Sbjct: 527 LTETLNREGVYTVFAPTNEAFRALPPRERSRLLGDAK-ELANILKYHIGDEILVSGGI-- 583

Query: 109 GMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDRVISAVGNTIQDVI 168
           |  |   .|  |       | ||.||   .   . .|||||||||  |.    |  |   
Sbjct: 584 GALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQ--- 640

Query: 169 ENDDELS 175
           |  |||.
Sbjct: 641 ERGDELA 647

>hg18||uc003lbg |5|BC026352|Q49AT7|Q49AT7_HUMAN|TGFBI|NA|NA|TGFBI protein

          Length = 416

 Score =  58 bits (139), Expect = 3e-008
 Identities = 44/127 (34%), Positives = 63/127 (49%), Gaps = 6/127 (4%)

Query:  49 LRPEIEGSGSYTFFAPSNEAWDSLDDTMKNALVSNVNVELYNALHYHMSKRRLLTKDLKN 108
           |   .   | || |||.|||. .|    .. |. .   || | | ||.    |..  .  
Sbjct: 260 LTETLNREGVYTVFAPTNEAFRALPPRERSRLLGDAK-ELANILKYHIGDEILVSGGI-- 316

Query: 109 GMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDRVISAVGNTIQDVI 168
           |  |   .|  |       | ||.||   .   . .|||||||||  |.    |  |   
Sbjct: 317 GALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQ--- 373

Query: 169 ENDDELS 175
           |  |||.
Sbjct: 374 ERGDELA 380

>hg18||uc003lbh |5|AK094055|NA|NA|TGFBI|NA|NA|Homo sapiens mRNA for transforming
        growth factor, beta-induced, 68kDa variant protein

          Length = 509

 Score =  58 bits (139), Expect = 3e-008
 Identities = 44/127 (34%), Positives = 63/127 (49%), Gaps = 6/127 (4%)

Query:  49 LRPEIEGSGSYTFFAPSNEAWDSLDDTMKNALVSNVNVELYNALHYHMSKRRLLTKDLKN 108
           |   .   | || |||.|||. .|    .. |. .   || | | ||.    |..  .  
Sbjct: 353 LTETLNREGVYTVFAPTNEAFRALPPRERSRLLGDAK-ELANILKYHIGDEILVSGGI-- 409

Query: 109 GMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDRVISAVGNTIQDVI 168
           |  |   .|  |       | ||.||   .   . .|||||||||  |.    |  |   
Sbjct: 410 GALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQ--- 466

Query: 169 ENDDELS 175
           |  |||.
Sbjct: 467 ERGDELA 473

>hg18||uc003lbg |5|BC026352|Q49AT7|Q49AT7_HUMAN|TGFBI|NA|NA|TGFBI protein

          Length = 416

 Score =  57 bits (137), Expect = 5e-008
 Identities = 47/148 (31%), Positives = 68/148 (45%), Gaps = 9/148 (6%)

Query: 252 EYTLLAPHNDAFS---DEVMSK---DQRLLRILLENHILKNKVVLGELYNGQHLETIGGK 305
           .|||||| |.||     | ...   |   || || |||||. .    .  |  .||. | 
Sbjct:   7 QYTLLAPTNEAFEKIPSETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGLSVETLEGT 66

Query: 306 LLRVFIYRTAVCIENSCLIRGSK-EGINGALHITKTLLKP-SEKTIYEILMENGRFKIFL 363
            | |      . |    .|        || .|    || | | ||..|.  |.      .
Sbjct:  67 TLEVGCSGDMLTINGKAIISNKDILATNGVIHYIDELLIPDSAKTLFELAAESD-VSTAI 125

Query: 364 SLMEAAEMTDLLKQEGDFTLFAPSDEAF 391
            |   | . . |      || || .  |
Sbjct: 126 DLFRQAGLGNHLSGSERLTLLAPLNSVF 153

>hg18||uc003lbg |5|BC026352|Q49AT7|Q49AT7_HUMAN|TGFBI|NA|NA|TGFBI protein

          Length = 416

 Score =  55 bits (131), Expect = 2e-007
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 3/107 (2%)

Query: 375 LKQEGDFTLFAPSDEAFAGLTQSDLTLLKSDITALRTILLYHFNKGIFIGGGLENGVTNL 434
           |.  | .|| ||..|||  .    |  .  |  ||| .|  |  |       .  |..  
Sbjct:   2 LEGNGQYTLLAPTNEAFEKIPSETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGLS-- 59

Query: 435 FKSLQGNNIKVIFANKTMQVNSLQ-IPESDIMGKNGVIHFVNHILYP 480
            ..|.|  ..|  .   . .|    |   ||.  |||||... .| |
Sbjct:  60 VETLEGTTLEVGCSGDMLTINGKAIISNKDILATNGVIHYIDELLIP 106

>hg18||uc003dei |3|AB052957|Q9NY15-2|Q9NY15-2|STAB1|NA|NA|Stabilin-1 precursor
        (FEEL-1 protein) (MS-1 antigen)

          Length = 803

 Score =  52 bits (123), Expect = 2e-006
 Identities = 43/169 (25%), Positives = 80/169 (47%), Gaps = 16/169 (9%)

Query: 346 EKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQSDLT-LLKS 404
           ..|| .||     |  | ...|   .  .|   | ||.||||.||   |    |  |  .
Sbjct: 506 KRTIGQILASTEAFSRFETILENCGLPSILDGPGPFTVFAPSNEAVDSLRDGRLIYLFTA 565

Query: 405 DITALRTILLYH-FNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQV----NSLQI 459
            .. |. .. || .| |      .|  ..        | .  .  ..  ..      . .
Sbjct: 566 GLSKLQELVRYHIYNHGQLT---VEKLISKGRILTMANQVLAVNISEEGRILLGPEGVPL 622

Query: 460 PESDIMGKNGVIHFVNHILYPGDIPVGSQSLLSLLRKMITNIQIKYISG 508
              |.|  ||||| .. || |        ..| .| |  .  | | ..|
Sbjct: 623 QRVDVMAANGVIHMLDGILLP-------PTILPILPKHCSEEQHKIVAG 664

>hg18||uc003dej
        |3|NM_015136|Q9NY15|STAB1_HUMAN|STAB1|NM_015136|NP_055951|stabilin 1
        precursor

          Length = 2570

 Score =  52 bits (123), Expect = 2e-006
 Identities = 43/169 (25%), Positives = 80/169 (47%), Gaps = 16/169 (9%)

Query: 346 EKTIYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQSDLT-LLKS 404
           ..|| .||     |  | ...|   .  .|   | ||.||||.||   |    |  |  .
Sbjct: 506 KRTIGQILASTEAFSRFETILENCGLPSILDGPGPFTVFAPSNEAVDSLRDGRLIYLFTA 565

Query: 405 DITALRTILLYH-FNKGIFIGGGLENGVTNLFKSLQGNNIKVIFANKTMQV----NSLQI 459
            .. |. .. || .| |      .|  ..        | .  .  ..  ..      . .
Sbjct: 566 GLSKLQELVRYHIYNHGQLT---VEKLISKGRILTMANQVLAVNISEEGRILLGPEGVPL 622

Query: 460 PESDIMGKNGVIHFVNHILYPGDIPVGSQSLLSLLRKMITNIQIKYISG 508
              |.|  ||||| .. || |        ..| .| |  .  | | ..|
Sbjct: 623 QRVDVMAANGVIHMLDGILLP-------PTILPILPKHCSEEQHKIVAG 664

>hg18||uc003lbf
        |5|NM_000358|Q15582|BGH3_HUMAN|TGFBI|NM_000358|NP_000349|transforming
        growth factor, beta-induced, 68kDa

          Length = 683

 Score =  50 bits (119), Expect = 6e-006
 Identities = 38/132 (28%), Positives = 66/132 (50%), Gaps = 3/132 (2%)

Query: 349 IYEILMENGRFKIFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQSDLTLLKSDIT- 407
           .|| |   |     |      ..   ..  | ||.||||.||.| |    |  | |..  
Sbjct: 106 LYETLGVVGSTTTQLYTDRTEKLRPEMEGPGSFTIFAPSNEAWASLPAEVLDSLVSNVNI 165

Query: 408 ALRTILLYHFNKGIFIGGGLENGVTNLFKSLQGNNIKV-IFANKTMQVNSLQIPESDIMG 466
            |   | ||      .   |..|.| |    | .||..  . |  . ||  .. ..|   
Sbjct: 166 ELLNALRYHMVGRRVLTDELKHGMT-LTSMYQNSNIQIHHYPNGIVTVNCARLLKADHHA 224

Query: 467 KNGVIHFVNHIL 478
            |||.| .. ..
Sbjct: 225 TNGVVHLIDKVI 236

>hg18||uc001uwo
        |13|NM_006475|Q15063|POSTN_HUMAN|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 836

 Score =  47 bits (110), Expect = 6e-005
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query:  45 EISKLRPEIEGSGSYTFFAPSNEAWDSLDDTMKNALVSNVNVELYNALHYHMSKRRLLTK 104
           | . |.  .   | .| | |.|.|.  .    |  |. . |  | | . ||..    . |
Sbjct: 517 EAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNA-LQNIILYHLTPGVFIGK 575

Query: 105 DLKNGMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDRVI----SAV 160
             . |.|                |  . ||  .    . . ||||.||.|...    . |
Sbjct: 576 GFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPV 635

Query: 161 GN 162
           ||
Sbjct: 636 GN 637

>hg18||uc001uwp
        |13|BC106710|Q5VSY8|Q5VSY8_HUMAN|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 779

 Score =  47 bits (110), Expect = 6e-005
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query:  45 EISKLRPEIEGSGSYTFFAPSNEAWDSLDDTMKNALVSNVNVELYNALHYHMSKRRLLTK 104
           | . |.  .   | .| | |.|.|.  .    |  |. . |  | | . ||..    . |
Sbjct: 517 EAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNA-LQNIILYHLTPGVFIGK 575

Query: 105 DLKNGMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDRVI----SAV 160
             . |.|                |  . ||  .    . . ||||.||.|...    . |
Sbjct: 576 GFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPV 635

Query: 161 GN 162
           ||
Sbjct: 636 GN 637

>hg18||uc001uwq
        |13|AY918092|Q29XZ0|Q29XZ0_HUMAN|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 739

 Score =  47 bits (110), Expect = 6e-005
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query:  45 EISKLRPEIEGSGSYTFFAPSNEAWDSLDDTMKNALVSNVNVELYNALHYHMSKRRLLTK 104
           | . |.  .   | .| | |.|.|.  .    |  |. . |  | | . ||..    . |
Sbjct: 517 EAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNA-LQNIILYHLTPGVFIGK 575

Query: 105 DLKNGMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDRVI----SAV 160
             . |.|                |  . ||  .    . . ||||.||.|...    . |
Sbjct: 576 GFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPV 635

Query: 161 GN 162
           ||
Sbjct: 636 GN 637

>hg18||uc001uwr
        |13|AY140646|Q15063-3|Q15063-3|POSTN|NM_006475|NP_006466|periostin,
        osteoblast specific factor

          Length = 755

 Score =  47 bits (110), Expect = 6e-005
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query:  45 EISKLRPEIEGSGSYTFFAPSNEAWDSLDDTMKNALVSNVNVELYNALHYHMSKRRLLTK 104
           | . |.  .   | .| | |.|.|.  .    |  |. . |  | | . ||..    . |
Sbjct: 517 EAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNA-LQNIILYHLTPGVFIGK 575

Query: 105 DLKNGMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGNQVATNGVVHVIDRVI----SAV 160
             . |.|                |  . ||  .    . . ||||.||.|...    . |
Sbjct: 576 GFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPV 635

Query: 161 GN 162
           ||
Sbjct: 636 GN 637

>hg18||uc001tjw
        |12|NM_017564|Q8WWQ8|STAB2_HUMAN|STAB2|NM_017564|NP_060034|stabilin 2
        precursor

          Length = 2551

 Score =  45 bits (106), Expect = 2e-004
 Identities = 40/142 (28%), Positives = 64/142 (45%), Gaps = 8/142 (5%)

Query:  361 IFLSLMEAAEMTDLLKQEGDFTLFAPSDEAFAGLTQSDLT--LLKSDITALRTILLYHFN 418
            ||   .  | .   |    . |.  || .|   . | . .  | .|.| ||   . ||  
Sbjct: 1009 IFNRWINNASLQPTLSATSNLTVLVPSQQATEDMDQDEKSFWLSQSNIPAL---IKYHML 1065

Query:  419 KGIFIGGGLE--NGVTNLFKSLQGNNIKVIFANKTMQVNSLQIPESDIMGKNGVIHFVNH 476
             | .    |.  .    |  ||||| . .   .  . .    | . |    ||||| .| 
Sbjct: 1066 LGTYRVADLQTLSSSDMLATSLQGNFLHLAKVDGNITIEGASIVDGDNAATNGVIHIINK 1125

Query:  477 ILYPGDIPVGS-QSLLSLLRKM 497
            .| |     ||  .||  | .|
Sbjct: 1126 VLVPQRRLTGSLPNLLMRLEQM 1147

>hg18||uc003dei |3|AB052957|Q9NY15-2|Q9NY15-2|STAB1|NA|NA|Stabilin-1 precursor
        (FEEL-1 protein) (MS-1 antigen)

          Length = 803

 Score =  45 bits (104), Expect = 3e-004
 Identities = 37/135 (27%), Positives = 63/135 (46%), Gaps = 9/135 (6%)

Query:  31 TLGVVKATSTQRYSEISKLRPE------IEGSGSYTFFAPSNEAWDSLDDTMKNALVSNV 84
           |.| . | ||. .|    .         ..| | .| ||||||| ||| |     | .  
Sbjct: 508 TIGQILA-STEAFSRFETILENCGLPSILDGPGPFTVFAPSNEAVDSLRDGRLIYLFTAG 566

Query:  85 NVELYNALHYHMSKRRLLT--KDLKNGMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGN 142
             .|   . ||.     ||  | .  |  .   |  | . |.     ..      .   .
Sbjct: 567 LSKLQELVRYHIYNHGQLTVEKLISKGRILTMANQVLAVNISEEGRILLGPEGVPLQRVD 626

Query: 143 QVATNGVVHVIDRVI 157
            .| |||.|..| ..
Sbjct: 627 VMAANGVIHMLDGIL 641

>hg18||uc003dej
        |3|NM_015136|Q9NY15|STAB1_HUMAN|STAB1|NM_015136|NP_055951|stabilin 1
        precursor

          Length = 2570

 Score =  45 bits (104), Expect = 3e-004
 Identities = 37/135 (27%), Positives = 63/135 (46%), Gaps = 9/135 (6%)

Query:  31 TLGVVKATSTQRYSEISKLRPE------IEGSGSYTFFAPSNEAWDSLDDTMKNALVSNV 84
           |.| . | ||. .|    .         ..| | .| ||||||| ||| |     | .  
Sbjct: 508 TIGQILA-STEAFSRFETILENCGLPSILDGPGPFTVFAPSNEAVDSLRDGRLIYLFTAG 566

Query:  85 NVELYNALHYHMSKRRLLT--KDLKNGMTVPSMNLDLDLYINHYPNGVVTVNCARIIHGN 142
             .|   . ||.     ||  | .  |  .   |  | . |.     ..      .   .
Sbjct: 567 LSKLQELVRYHIYNHGQLTVEKLISKGRILTMANQVLAVNISEEGRILLGPEGVPLQRVD 626

Query: 143 QVATNGVVHVIDRVI 157
            .| |||.|..| ..
Sbjct: 627 VMAANGVIHMLDGIL 641

>hg18||uc001tjw
        |12|NM_017564|Q8WWQ8|STAB2_HUMAN|STAB2|NM_017564|NP_060034|stabilin 2
        precursor

          Length = 2551

 Score =  35 bits (80), Expect = 0.189
 Identities = 13/30 (43%), Positives = 23/30 (76%)

Query:  128 NGVVTVNCARIIHGNQVATNGVVHVIDRVI 157
            .| .|.  | |. |.  |||||.|.|..|.
Sbjct: 1098 DGNITIEGASIVDGDNAATNGVIHIINKVL 1127

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0