BLASTP 7.6.0


Query=fugu4_573126 |jgi|Takru4|573126|e_gw2.19.292.1
        (522 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003gva |4|NM_017581|Q14CY7|Q14CY7_HUMAN|CHRNA9|NM_017581...    522   6e-148
hg18||uc001lyf |11|NM_020402|Q9GZZ6|ACH10_HUMAN|CHRNA10|NM_02040...    470   3e-132
hg18||uc001zft |15|NM_000746|P36544|ACHA7_HUMAN|CHRNA7|NM_000746...    314   2e-085
hg18||uc002beb |15|BT006646|Q9BRR4|Q9BRR4_HUMAN|CHRNA3|NM_000743...    300   4e-081
hg18||uc002bec |15|NM_000743|Q86U77|Q86U77_HUMAN|CHRNA3|NM_00074...    300   4e-081
hg18||uc003xpj |8|NM_004198|Q15825|ACHA6_HUMAN|CHRNA6|NM_004198|...    293   6e-079
hg18||uc002yes |20|NM_000744|P43681|ACHA4_HUMAN|CHRNA4|NM_000744...    291   2e-078
hg18||uc003xpi |8|NM_000749|Q05901|ACHB3_HUMAN|CHRNB3|NM_000749|...    283   6e-076
hg18||uc003xft |8|NM_000742|Q15822|ACHA2_HUMAN|CHRNA2|NM_000742|...    279   6e-075
hg18||uc002bdy |15|NM_000745|P30532|ACHA5_HUMAN|CHRNA5|NM_000745...    277   3e-074
hg18||uc002uje |2|NM_000079|Q53SH4|Q53SH4_HUMAN|CHRNA1|NM_000079...    277   3e-074
hg18||uc002bed |15|NM_000750|P30926|ACHB4_HUMAN|CHRNB4|NM_000750...    270   5e-072
hg18||uc001ffg |1|NM_000748|P17787|ACHB2_HUMAN|CHRNB2|NM_000748|...    264   3e-070
hg18||uc002ujd |2|NM_001039523|P02708|ACHA_HUMAN|CHRNA1|NM_00103...    237   3e-062
hg18||uc002ujf |2|BC006314|Q9BRE6|Q9BRE6_HUMAN|CHRNA1|NM_000079|...    223   7e-058
hg18||uc001zdt |15|NM_139320|Q494W8|CRFM7_HUMAN|CHRFAM7A|NM_1393...    221   2e-057
hg18||uc001pom |11|NM_000869|P46098|5HT3R_HUMAN|HTR3A|NM_000869|...    193   5e-049
hg18||uc001pon |11|NM_213621|P46098-2|P46098-2|HTR3A|NM_213621|N...    176   8e-044
hg18||uc001zdu |15|NM_148911|Q8IUZ4|Q8IUZ4_HUMAN|CHRFAM7A|NM_148...    164   3e-040
hg18||uc003fmm |3|NM_182589|Q7Z6B2|Q7Z6B2_HUMAN|HTR3E|NM_182589|...    163   9e-040
hg18||uc003fmk |3|NM_130770|Q8WXA8|Q8WXA8_HUMAN|HTR3C|NM_130770|...    156   6e-038
hg18||uc002vsx |2|NM_005199|P07510|ACHG_HUMAN|CHRNG|NM_005199|NP...    151   3e-036
hg18||uc002yet |20|AB209359|Q4VAQ3|Q4VAQ3_HUMAN|CHRNA4|NM_000744...    151   3e-036
hg18||uc002yev |20|BC096292|Q4VAQ3|Q4VAQ3_HUMAN|CHRNA4|NM_000744...    151   3e-036
hg18||uc003fml |3|AY349352|Q6V707|Q6V707_HUMAN|HTR3E|NM_182589|N...    138   2e-032
hg18||uc003fmn |3|AY349353|Q6V706|Q6V706_HUMAN|HTR3E|NM_182589|N...    138   2e-032
hg18||uc002fzk |17|NM_000080|Q04844|ACHE_HUMAN|CHRNE|NM_000080|N...    136   7e-032
hg18||uc002ghb |17|NM_000747|P11230|ACHB_HUMAN|CHRNB1|NM_000747|...    129   8e-030
hg18||uc001pok |11|NM_006028|O95264|O95264_HUMAN|HTR3B|NM_006028...    129   1e-029
hg18||uc001pol |11|AM293589|Q0VJC3|Q0VJC3_HUMAN|HTR3B|NM_006028|...    129   1e-029
hg18||uc002vsw |2|NM_000751|Q07001|ACHD_HUMAN|CHRND|NM_000751|NP...    124   4e-028
hg18||uc002bdz |15|CR619227|NA|NA|CHRNA5|NA|NA|Homo sapiens nico...    115   2e-025
hg18||uc002vsw |2|NM_000751|Q07001|ACHD_HUMAN|CHRND|NM_000751|NP...    107   4e-023
hg18||uc002ghb |17|NM_000747|P11230|ACHB_HUMAN|CHRNB1|NM_000747|...     97   6e-020
hg18||uc003fmo |3|BC101185|NA|NA|HTR3E|NM_182589|NP_872395|5-hyd...     94   5e-019
hg18||uc002bee |15|BC096083|NA|NA|CHRNB4|NA|NA|Homo sapiens chol...     92   2e-018
hg18||uc003lyr |5|BC105639|P47870|GBRB2_HUMAN|GABRB2|NM_000813|N...     79   1e-014
hg18||uc003lys |5|NM_021911|P47870-2|P47870-2|GABRB2|NM_021911|N...     79   1e-014
hg18||uc003lyt |5|NM_000813|P47870|GBRB2_HUMAN|GABRB2|NM_000813|...     79   1e-014
hg18||uc001aip |1|NM_000815|O14764|GBRD_HUMAN|GABRD|NM_000815|NP...     72   1e-012
hg18||uc003gva |4|NM_017581|Q14CY7|Q14CY7_HUMAN|CHRNA9|NM_017581...     53   1e-006
hg18||uc002ujd |2|NM_001039523|P02708|ACHA_HUMAN|CHRNA1|NM_00103...     49   1e-005
hg18||uc003fmj |3|NM_182537|Q7Z6B3|Q7Z6B3_HUMAN|HTR3D|NM_182537|...     45   3e-004
hg18||uc001zdt |15|NM_139320|Q494W8|CRFM7_HUMAN|CHRFAM7A|NM_1393...     32   2.326
hg18||uc001zdu |15|NM_148911|Q8IUZ4|Q8IUZ4_HUMAN|CHRFAM7A|NM_148...     32   2.326
hg18||uc001zft |15|NM_000746|P36544|ACHA7_HUMAN|CHRNA7|NM_000746...     32   2.326
hg18||uc002bdy |15|NM_000745|P30532|ACHA5_HUMAN|CHRNA5|NM_000745...     31   3.968
hg18||uc002nhr |19|NM_000453|Q92911|SC5A5_HUMAN|SLC5A5|NM_000453...     31   3.968

>hg18||uc003gva
        |4|NM_017581|Q14CY7|Q14CY7_HUMAN|CHRNA9|NM_017581|NP_060051|cholinergic
        receptor, nicotinic, alpha 9

          Length = 479

 Score =  522 bits (1343), Expect = 6e-148
 Identities = 240/350 (68%), Positives = 289/350 (82%)

Query:   2 WVSKIPLSVVACWTAHGKYAQKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMD 61
           |.      . |  || |||||||  |||  |..||||||||. .||||||.||||| |||
Sbjct:  12 WIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMD 71

Query:  62 ERNQILTAYLWIRQVWVDAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPM 121
           ||||||||||||||.| |||| |..|.|||||.|||||  |||||||||| |||  . |.
Sbjct:  72 ERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPV 131

Query: 122 DTNVVIRHDGQITWDSPAITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALES 181
           .||||.|.|| ||||.|||||||| |||..|||| |||  |.|||||||||.|| |||.|
Sbjct: 132 NTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDS 191

Query: 182 ADLADLVENVEWEILGMPAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMI 241
            ||.| .|.||||. |||| ||.| ||||..||||||.|| ||||.|||. |||||||.|
Sbjct: 192 GDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLI 251

Query: 242 SFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPPSENVPLIGKYYXXXXXXXX 301
           |||||| ||||| ||||||||||..||.|||||.|||||| |||||||||||        
Sbjct: 252 SFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPASENVPLIGKYYIATMALIT 311

Query: 302 XXXXXXXFIMNIHHCGPDAKPVPKWAKTVILQYMARMCFVYEVGDNCMSP 351
                   .|||| || .|.||| ||. |||.||.|. |||.||..|.||
Sbjct: 312 ASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLSP 361

>hg18||uc001lyf
        |11|NM_020402|Q9GZZ6|ACH10_HUMAN|CHRNA10|NM_020402|NP_065135|cholinergi
        c receptor, nicotinic, alpha

          Length = 450

 Score =  470 bits (1207), Expect = 3e-132
 Identities = 231/384 (60%), Positives = 278/384 (72%), Gaps = 24/384 (6%)

Query:  13 CWTAHGKYAQKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLW 72
           |  | |. | ||  ||||.|||||||| ||.  |||||.||||||||||||||.|| |||
Sbjct:  22 CLGAEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLW 81

Query:  73 IRQVWVDAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQ 132
           ||| | ||||.|. . | ||| |||||| |||||||||| ||    |   ||||.|||| 
Sbjct:  82 IRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGA 141

Query: 133 ITWDSPAITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVE 192
           . ||.||||.|||||||. |||||| |  |.||||. |.|||.     .| ||| |||||
Sbjct: 142 VRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVE 201

Query: 193 WEILGMPAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLP 252
           | .|||||.. .. ||||..||||||.|| |.|||. || |||.|||.|| |||| |.||
Sbjct: 202 WRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYVCNLLLPCVLISLLAPLAFHLP 261

Query: 253 ADSGEKVSLGVTVMLALTVFQLLVAEIMPPSENVPLIGKYYXXXXXXXXXXXXXXXFIMN 312
           |||||||||||||.|||||||||.|| |||.|.||||||||                |||
Sbjct: 262 ADSGEKVSLGVTVLLALTVFQLLLAESMPPAESVPLIGKYYMATMTMVTFSTALTILIMN 321

Query: 313 IHHCGPDAKPVPKWAKTVILQYMARMCFVYEVGDNC-------MSPQPEKPE----PPYV 361
           .|.|||  .||| ||. ..| ..||   | | |. |       .|| |. ||    ||  
Sbjct: 322 LHYCGPSVRPVPAWARALLLGHLARGLCVRERGEPCGQSRPPELSPSPQSPEGGAGPP-- 379

Query: 362 KNSNCTMNGRAGPCRED-CVFRVE 384
                     |||| |  |. | |
Sbjct: 380 ----------AGPCHEPRCLCRQE 393

>hg18||uc001zft
        |15|NM_000746|P36544|ACHA7_HUMAN|CHRNA7|NM_000746|NP_000737|cholinergic
        receptor, nicotinic, alpha 7

          Length = 502

 Score =  314 bits (804), Expect = 2e-085
 Identities = 145/335 (43%), Positives = 215/335 (64%), Gaps = 3/335 (0%)

Query:  18 GKYAQKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVW 77
           |.. .||  .|  .|    ||| . .  | |   ..| ||.|.||.||.||  .|..  |
Sbjct:  23 GEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSW 82

Query:  78 VDAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDS 137
            | ||.||  || |. |.| |   .|.|||.|||.||. |     |||..   |   .  
Sbjct:  83 TDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLP 142

Query: 138 PAITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVEWEILG 197
           | | |||| .|| .|||| | |.  .|||.| |  ||.   .. ||..  . | ||...|
Sbjct: 143 PGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL--QMQEADISGYIPNGEWDLVG 200

Query: 198 MPAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGE 257
           .| |..   | || .||||||.|. ..||  .|  |||||||.|| || | | |||||||
Sbjct: 201 IPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGE 260

Query: 258 KVSLGVTVMLALTVFQLLVAEIMP-PSENVPLIGKYYXXXXXXXXXXXXXXXFIMNIHHC 316
           |.|||.||.|.|||| ||||||||  |..|||| .|.                ..  || 
Sbjct: 261 KISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHH 320

Query: 317 GPDAKPVPKWAKTVILQYMARMCFVYEVGDNCMSP 351
            ||   .||| . ..| . |    .   |.. . |
Sbjct: 321 DPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRP 355

>hg18||uc002beb
        |15|BT006646|Q9BRR4|Q9BRR4_HUMAN|CHRNA3|NM_000743|NP_000734|cholinergic
        receptor, nicotinic, alpha

          Length = 489

 Score =  300 bits (767), Expect = 4e-081
 Identities = 142/359 (39%), Positives = 219/359 (61%), Gaps = 6/359 (1%)

Query:  23 KLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYL 82
           .|   ||  |   .||| . .. . .  .|..||.. .|| |||.   ||..|.| |  |
Sbjct:  37 RLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKL 96

Query:  83 KWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAITK 142
           |||  .| | . .|.|.  .|.|||||||||   |     |  .... |..||  ||| |
Sbjct:  97 KWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFK 156

Query: 143 SSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVEWEILGMPAKK 202
           |||..||..|||| | |   .|||.|.  ..|..    | .| |  |. || |.  |  |
Sbjct: 157 SSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYK 216

Query: 203 NIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLG 262
           . |.| || . |||.||.| ..|   ||  ||.|||..||||  | ||||.| ||||.| 
Sbjct: 217 HDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLC 276

Query: 263 VTVMLALTVFQLLVAEIMPPSENV-PLIGKYYXXXXXXXXXXXXXXXFIMNIHHCGPDAK 321
           ..|.|.|||| |.. | .| .  | ||||.|                |..|.|.  |   
Sbjct: 277 ISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTH 336

Query: 322 PVPKWAKTVILQYMARMCFVYEVGDNCMSPQPEKPEPPY---VKNSNCTMNGRAGPCRE 377
            .| | ||| |  . |. |.     |      .|| | |   . | ||     .  |.|
Sbjct: 337 TMPSWVKTVFLNLLPRVMFMTRPTSN--EGNAQKPRPLYGAELSNLNCFSRAESKGCKE 393

>hg18||uc002bec
        |15|NM_000743|Q86U77|Q86U77_HUMAN|CHRNA3|NM_000743|NP_000734|cholinergi
        c receptor, nicotinic, alpha

          Length = 505

 Score =  300 bits (767), Expect = 4e-081
 Identities = 142/359 (39%), Positives = 219/359 (61%), Gaps = 6/359 (1%)

Query:  23 KLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYL 82
           .|   ||  |   .||| . .. . .  .|..||.. .|| |||.   ||..|.| |  |
Sbjct:  37 RLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKL 96

Query:  83 KWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAITK 142
           |||  .| | . .|.|.  .|.|||||||||   |     |  .... |..||  ||| |
Sbjct:  97 KWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFK 156

Query: 143 SSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVEWEILGMPAKK 202
           |||..||..|||| | |   .|||.|.  ..|..    | .| |  |. || |.  |  |
Sbjct: 157 SSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYK 216

Query: 203 NIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLG 262
           . |.| || . |||.||.| ..|   ||  ||.|||..||||  | ||||.| ||||.| 
Sbjct: 217 HDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLC 276

Query: 263 VTVMLALTVFQLLVAEIMPPSENV-PLIGKYYXXXXXXXXXXXXXXXFIMNIHHCGPDAK 321
           ..|.|.|||| |.. | .| .  | ||||.|                |..|.|.  |   
Sbjct: 277 ISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTH 336

Query: 322 PVPKWAKTVILQYMARMCFVYEVGDNCMSPQPEKPEPPY---VKNSNCTMNGRAGPCRE 377
            .| | ||| |  . |. |.     |      .|| | |   . | ||     .  |.|
Sbjct: 337 TMPSWVKTVFLNLLPRVMFMTRPTSN--EGNAQKPRPLYGAELSNLNCFSRAESKGCKE 393

>hg18||uc003xpj
        |8|NM_004198|Q15825|ACHA6_HUMAN|CHRNA6|NM_004198|NP_004189|cholinergic
        receptor, nicotinic, alpha

          Length = 494

 Score =  293 bits (748), Expect = 6e-079
 Identities = 134/318 (42%), Positives = 204/318 (64%), Gaps = 1/318 (0%)

Query:  22 QKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAY 81
           ..|   ||. |   .||||. .. . |  .| ..|. ..|| |||.   ||.| .| |  
Sbjct:  35 ERLFHKLFSHYNQFIRPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYK 94

Query:  82 LKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAIT 141
           |.|.  ||||..|.|.|.  .|.|||||||||   |     |  .....| |||  ||| 
Sbjct:  95 LRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIF 154

Query: 142 KSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVEWEILGMPAK 201
           |||| .|..||||| | |   .|||||.  ..|.|      |. |  || ||||.     
Sbjct: 155 KSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGY 214

Query: 202 KNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSL 261
           |. |.| || . | |.||.  ..|   ||  ||.|||. ||||  | ||||.| ||||.|
Sbjct: 215 KHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTL 274

Query: 262 GVTVMLALTVFQLLVAEIMP-PSENVPLIGKYYXXXXXXXXXXXXXXXFIMNIHHCGPDA 320
            ..|.|.|||| |.. | .|  |  |||.|.|                |..|||.  |  
Sbjct: 275 CISVLLSLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTT 334

Query: 321 KPVPKWAKTVILQYMARM 338
             .|.| ||| |. . ..
Sbjct: 335 HTMPRWVKTVFLKLLPQV 352

>hg18||uc002yes
        |20|NM_000744|P43681|ACHA4_HUMAN|CHRNA4|NM_000744|NP_000735|cholinergic
        receptor, nicotinic, alpha 4 subunit

          Length = 627

 Score =  291 bits (744), Expect = 2e-078
 Identities = 137/331 (41%), Positives = 205/331 (61%), Gaps = 4/331 (1%)

Query:  22 QKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAY 81
           ..||  ||. |    ||| . .... |   ....|.||.||.||..|  .|..| | |  
Sbjct:  38 ERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYK 97

Query:  82 LKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAIT 141
           |.|.  .|. . .|||||  .||||||||||||  |     |   . |||.. |  ||| 
Sbjct:  98 LRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIY 157

Query: 142 KSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVEWEILGMPAK 201
           |||| .||.||||| | |   .|||||.  ..|..|     |  |  |. || |.     
Sbjct: 158 KSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGT 217

Query: 202 KNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSL 261
            |  .| |||. |||.||   ..|   ||  ||.|||..|| |  | ||||.. |||..|
Sbjct: 218 YNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITL 277

Query: 262 GVTVMLALTVFQLLVAEIMPPSENV-PLIGKYYXXXXXXXXXXXXXXXFIMNIHHCGPDA 320
            ..|.|.|||| ||. ||.| .  | ||||.|                |..|.||  |  
Sbjct: 278 CISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRT 337

Query: 321 KPVPKWAKTVILQYMARMCFVYE---VGDNC 348
             .| | . | |  . |.  .     | |||
Sbjct: 338 HTMPTWVRRVFLDIVPRLLLMKRPSVVKDNC 368

>hg18||uc003xpi
        |8|NM_000749|Q05901|ACHB3_HUMAN|CHRNB3|NM_000749|NP_000740|cholinergic
        receptor, nicotinic, beta

          Length = 458

 Score =  283 bits (722), Expect = 6e-076
 Identities = 138/355 (38%), Positives = 210/355 (59%), Gaps = 4/355 (1%)

Query:   6 IPLSVVACWTAHGKYAQKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQ 65
           || |    . .  .    ||  ||  |   .|||  .|. . |   . .||..|.||.||
Sbjct:  14 IPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQ 73

Query:  66 ILTAYLWIRQVWVDAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNV 125
           ..|  .|..| | |  |.|| |.| |. .|..||  .| |||||. |||  | | . | |
Sbjct:  74 LMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKV 133

Query: 126 VIRHDGQITWDSPAITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLA 185
           ... .| . |  ||  |||| .||.||||| | |   .|||||.|  .|..   |. |  
Sbjct: 134 IVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRK 193

Query: 186 DLVENVEWEILGMPAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLA 245
           |  .| |||||     |   . |  .  || .||.  |.|   ||   |.|||. .||| 
Sbjct: 194 DFFDNGEWEILNAKGMKGNRRDGVYS--YPFITYSFVLRRLPLFYTLFLIIPCLGLSFLT 251

Query: 246 PLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPPSENV-PLIGKYYXXXXXXXXXXX 304
            | ||||.| |||.||  .|...|||| |.. ||.| |  | ||||.|            
Sbjct: 252 VLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSI 311

Query: 305 XXXXFIMNIHHCGPDA-KPVPKWAKTVILQYMARMCFVYEVGDNCMSPQPEKPEP 358
               |..|.||       |.  | | . || . ..  . .  |   ||. |. .|
Sbjct: 312 IVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPEKEESQP 366

>hg18||uc003xft
        |8|NM_000742|Q15822|ACHA2_HUMAN|CHRNA2|NM_000742|NP_000733|cholinergic
        receptor, nicotinic, alpha

          Length = 529

 Score =  279 bits (713), Expect = 6e-075
 Identities = 130/323 (40%), Positives = 197/323 (60%), Gaps = 1/323 (0%)

Query:  16 AHGKYAQKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQ 75
           .| .   .|   ||  |    ||| .|.... |   ....|.||.||.||..|  .|..|
Sbjct:  54 SHTETEDRLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQ 113

Query:  76 VWVDAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITW 135
            | |  |.||  ..  . ..|.||  .| ||||||||||  |     |   .   | . |
Sbjct: 114 EWSDYKLRWNPADFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHW 173

Query: 136 DSPAITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVEWEI 195
             ||| |||| .||.||||| | |.  .|||||.  ..|.    .. || |  |. || |
Sbjct: 174 VPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAI 233

Query: 196 LGMPAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADS 255
           .      |  .| |||. ||||||   ..|   ||  ||.|||..|| |  | ||||.| 
Sbjct: 234 VNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDC 293

Query: 256 GEKVSLGVTVMLALTVFQLLVAEIMPPSENV-PLIGKYYXXXXXXXXXXXXXXXFIMNIH 314
           |||..| ..|.|.|||| ||. ||.| .  | ||||.|                |..|.|
Sbjct: 294 GEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVH 353

Query: 315 HCGPDAKPVPKWAKTVILQYMAR 337
           |  |    .| | .  .|  . |
Sbjct: 354 HRSPSTHTMPHWVRGALLGCVPR 376

>hg18||uc002bdy
        |15|NM_000745|P30532|ACHA5_HUMAN|CHRNA5|NM_000745|NP_000736|cholinergic
        receptor, nicotinic, alpha

          Length = 468

 Score =  277 bits (707), Expect = 3e-074
 Identities = 133/298 (44%), Positives = 186/298 (62%), Gaps = 4/298 (1%)

Query:  19 KYAQKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWV 78
           |.   || |||  |   .||||  |. . .   . .||..|.||.||..|  .|..| |.
Sbjct:  45 KHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWI 104

Query:  79 DAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSP 138
           |  |.|| |.| |.  ||.||  || |||||..|||  | |   |  |||..| .||  |
Sbjct: 105 DVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEG-TSTKTVIRYNGTVTWTPP 163

Query: 139 AITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVEWEILGM 198
           |  |||| .||.||||| | |   .|||||.|.|.||.   .  |  |  .| ||||.  
Sbjct: 164 ANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSA 223

Query: 199 PAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEK 258
              |      ||   || |||.  .||   ||   |.|||. .|||  | ||||.. |||
Sbjct: 224 TGSKGNRTDSCCW--YPYVTYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEK 281

Query: 259 VSLGVTVMLALTVFQLLVAEIMPPSENV-PLIGKYYXXXXXXXXXXXXXXXFIMNIHH 315
           . |  .|...|||| |.. ||.| |  | ||||.|                | .||||
Sbjct: 282 ICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHH 339

>hg18||uc002uje
        |2|NM_000079|Q53SH4|Q53SH4_HUMAN|CHRNA1|NM_000079|NP_000070|cholinergic
        receptor, nicotinic, alpha 1

          Length = 457

 Score =  277 bits (707), Expect = 3e-074
 Identities = 133/324 (41%), Positives = 198/324 (61%), Gaps = 2/324 (0%)

Query:  19 KYAQKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWV 78
           ..  .|.  ||  |.| .|||||   .. ||. . | |.|..|| |||.|  . ..| ||
Sbjct:  22 EHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQQWV 81

Query:  79 DAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSP 138
           |  |||| |.| |.  | |||  .||||.|||||||  |     | |.... | |||  |
Sbjct:  82 DYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPP 141

Query: 139 AITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVEWEILGM 198
           || || | . |. |||| | |    |.|||.|. . |    .  ||.. .|. || |   
Sbjct: 142 AIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKES 201

Query: 199 PAKKNIIQYGCCAD-PYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGE 257
              |. . | || | || |.||   ..|   ... |..|||.. |||  | |||| ||||
Sbjct: 202 RGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGE 261

Query: 258 KVSLGVTVMLALTVFQLLVAEIMP-PSENVPLIGKYYXXXXXXXXXXXXXXXFIMNIHHC 316
           |..| ..|.|.|||| |.. |..|  |  |||||||                 ..| || 
Sbjct: 262 KMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHR 321

Query: 317 GPDAKPVPKWAKTVILQYMARMCF 340
            |    .| | . | .  .  . |
Sbjct: 322 SPSTHVMPNWVRKVFIDTIPNIMF 345

>hg18||uc002bed
        |15|NM_000750|P30926|ACHB4_HUMAN|CHRNB4|NM_000750|NP_000741|cholinergic
        receptor, nicotinic, beta

          Length = 498

 Score =  270 bits (688), Expect = 5e-072
 Identities = 129/342 (37%), Positives = 206/342 (60%), Gaps = 11/342 (3%)

Query:  22 QKLLTDLF--ASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVD 79
           .||. ||     | . .||   .. .... ||..|.|.| ..|| ||.|  .|..| | |
Sbjct:  28 EKLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNEREQIMTTNVWLKQEWTD 87

Query:  80 AYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPA 139
             | ||   |.|.. .|||.  .| ||||||||||  .   . ||...| .| . |  ||
Sbjct:  88 YRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPA 147

Query: 140 ITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVEWEILGMP 199
           | ||.|...| .|||| | |   . ||||.  ..|..    .| . |   . ||.|. .|
Sbjct: 148 IYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTEIDMVLMTPTASMDDFTPSGEWDIVALP 207

Query: 200 AKKNIIQYGCCADP-YPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEK 258
            .. .       || | ||||   .||.  ||  ||.||||. . || | ||||.| |||
Sbjct: 208 GRRTVNP----QDPSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILVFYLPSDCGEK 263

Query: 259 VSLGVTVMLALTVFQLLVAEIMPP-SENVPLIGKYYXXXXXXXXXXXXXXXFIMNIHHCG 317
           ..| ..|.|||| | ||...|.|| | .|||||||                 ..|.||  
Sbjct: 264 MTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRS 323

Query: 318 PDAKPVPKWAKTVILQYMARMCFVYEVGDNCMSPQPEKPEPP 359
           |    .  | |   |  .    |.   | .     | .  ||
Sbjct: 324 PSTHTMAPWVKRCFLHKLPTFLFMKRPGPD---SSPARAFPP 362

>hg18||uc001ffg
        |1|NM_000748|P17787|ACHB2_HUMAN|CHRNB2|NM_000748|NP_000739|neuronal
        nicotinic acetylcholine receptor beta 2

          Length = 502

 Score =  264 bits (673), Expect = 3e-070
 Identities = 123/318 (38%), Positives = 192/318 (60%), Gaps = 4/318 (1%)

Query:  32 YTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYLKWNKDEYDG 91
           |   .||  . . .. | | |.|.|.| . || ||.|  .|. | | |  | |  .|.| 
Sbjct:  42 YNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDN 101

Query:  92 LDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAITKSSCRVDVSF 151
           .  .|.|| ..| ||.|||||||  .     .| |. .|| | |  ||| ||.|...|  
Sbjct: 102 MKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKH 161

Query: 152 FPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVEWEILGMPAKKNIIQYGCCA 211
           |||| | |   . ||||.  ..|..   | | | |   . ||.|. .| ..|        
Sbjct: 162 FPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRN---ENPDD 218

Query: 212 DPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTV 271
             | |.||   ..|.  ||  ||.||||.|. || | ||||.| |||..| ..|.|||||
Sbjct: 219 STYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTV 278

Query: 272 FQLLVAEIMPP-SENVPLIGKYYXXXXXXXXXXXXXXXFIMNIHHCGPDAKPVPKWAKTV 330
           | ||...|.|| | .|||.|||                 ..|.||  |    .  | | |
Sbjct: 279 FLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVV 338

Query: 331 ILQYMARMCFVYEVGDNC 348
            |. .  . |. .   .|
Sbjct: 339 FLEKLPALLFMQQPRHHC 356

>hg18||uc002ujd
        |2|NM_001039523|P02708|ACHA_HUMAN|CHRNA1|NM_001039523|NP_001034612|chol
        inergic receptor, nicotinic, alpha 1

          Length = 482

 Score =  237 bits (604), Expect = 3e-062
 Identities = 118/309 (38%), Positives = 179/309 (57%), Gaps = 8/309 (2%)

Query:  39 VEDTNNILNVTLQVTLSQIIDMDERNQI-----LTAYLWIRQVWVDAYLKWNKDEYDGLD 93
           |.. | |.   ...    ..|.   . .     | ..|   | |||  |||| |.| |. 
Sbjct:  63 VDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQ-WVDYNLKWNPDDYGGVK 121

Query:  94 TIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAITKSSCRVDVSFFP 153
            | |||  .||||.|||||||  |     | |.... | |||  ||| || | . |. ||
Sbjct: 122 KIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFP 181

Query: 154 FDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVEWEILGMPAKKNIIQYGCCAD- 212
           || | |    |.|||.|. . |    .  ||.. .|. || |      |. . | || | 
Sbjct: 182 FDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDT 241

Query: 213 PYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVF 272
           || |.||   ..|   ... |..|||.. |||  | |||| |||||..| ..|.|.||||
Sbjct: 242 PYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVF 301

Query: 273 QLLVAEIMP-PSENVPLIGKYYXXXXXXXXXXXXXXXFIMNIHHCGPDAKPVPKWAKTVI 331
            |.. |..|  |  |||||||                 ..| ||  |    .| | . | 
Sbjct: 302 LLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKVF 361

Query: 332 LQYMARMCF 340
           .  .  . |
Sbjct: 362 IDTIPNIMF 370

>hg18||uc002ujf
        |2|BC006314|Q9BRE6|Q9BRE6_HUMAN|CHRNA1|NM_000079|NP_000070|cholinergic
        receptor, nicotinic, alpha 1

          Length = 269

 Score =  223 bits (566), Expect = 7e-058
 Identities = 105/239 (43%), Positives = 153/239 (64%), Gaps = 1/239 (0%)

Query:  19 KYAQKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWV 78
           ..  .|.  ||  |.| .|||||   .. ||. . | |.|..|| |||.|  . ..| ||
Sbjct:  22 EHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQQWV 81

Query:  79 DAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSP 138
           |  |||| |.| |.  | |||  .||||.|||||||  |     | |.... | |||  |
Sbjct:  82 DYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPP 141

Query: 139 AITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENVEWEILGM 198
           || || | . |. |||| | |    |.|||.|. . |    .  ||.. .|. || |   
Sbjct: 142 AIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKES 201

Query: 199 PAKKNIIQYGCCAD-PYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSG 256
              |. . | || | || |.||   ..|   ... |..|||.. |||  | |||| |||
Sbjct: 202 RGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSG 260

>hg18||uc001zdt
        |15|NM_139320|Q494W8|CRFM7_HUMAN|CHRFAM7A|NM_139320|NP_647536|CHRNA7-FA
        M7A fusion isoform 1

          Length = 412

 Score =  221 bits (562), Expect = 2e-057
 Identities = 105/240 (43%), Positives = 152/240 (63%), Gaps = 3/240 (1%)

Query: 113 ADDHFTGPMDTNVVIRHDGQITWDSPAITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQ 172
           ||. |     |||..   |   .  | | |||| .|| .|||| | |.  .|||.| |  
Sbjct:  28 ADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWS 87

Query: 173 LDILNALESADLADLVENVEWEILGMPAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVF 232
           ||.   .. ||..  . | ||...|.| |..   | || .||||||.|. ..||  .|  
Sbjct:  88 LDL--QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGL 145

Query: 233 NLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMP-PSENVPLIGK 291
           |||||||.|| || | | ||||||||.|||.||.|.|||| ||||||||  |..|||| .
Sbjct: 146 NLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQ 205

Query: 292 YYXXXXXXXXXXXXXXXFIMNIHHCGPDAKPVPKWAKTVILQYMARMCFVYEVGDNCMSP 351
           |.                ..  ||  ||   .||| . ..| . |    .   |.. . |
Sbjct: 206 YFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRP 265

>hg18||uc001pom
        |11|NM_000869|P46098|5HT3R_HUMAN|HTR3A|NM_000869|NP_000860|5-hydroxytry
        ptamine (serotonin) receptor 3A

          Length = 478

 Score =  193 bits (490), Expect = 5e-049
 Identities = 107/353 (30%), Positives = 182/353 (51%), Gaps = 21/353 (5%)

Query:  28 LFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYLKWNKD 87
           |  .|   .||| |      |.. | .  |...||.||.|| |.| || | | .|.|| .
Sbjct:  41 LLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPE 100

Query:  88 EYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAITKSSCRV 147
           ..| .  . ||.  .| ||| | |   |    |    | ||| |..    |    ..| .
Sbjct: 101 DFDNITKLSIPTDSIWVPDI-LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSL 159

Query: 148 DVSFFPFDAQQCRFTYGSWTYNGNQLDI----LNALESADLADLVENVEWEILG-MPAKK 202
           |.  |||| | |  |. || .    ..|    |     .| .  .   |||.|| .|  .
Sbjct: 160 DIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFR 219

Query: 203 NIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLG 262
                   .. | .. . . ..||  ||| .||.| . .  .  .||||| .|||.||  
Sbjct: 220 EFSMES--SNYYAEMKFYVVIRRRPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFK 277

Query: 263 VTVMLALTVFQLLVAEIMPPSE-NVPLIGKYYXXXXXXXXXXXXXXXFIMNIHHCGPDAK 321
           .|..|  .|| ..|.. .| .    |||| |.               ||. . |     .
Sbjct: 278 ITLLLGYSVFLIIVSDTLPATAIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQ 337

Query: 322 PVPKWAKTVILQYMARMCFVYEVGDNCMSPQPEKPEPP----YVKNSNCTMNG 370
           ||| | . ..|. .| .         |.  |     ||      |  .|.  |
Sbjct: 338 PVPAWLRHLVLERIAWLL--------CLREQSTSQRPPATSQATKTDDCSAMG 382

>hg18||uc001pon
        |11|NM_213621|P46098-2|P46098-2|HTR3A|NM_213621|NP_998786|5-hydroxytryp
        tamine (serotonin) receptor 3A

          Length = 510

 Score =  176 bits (445), Expect = 8e-044
 Identities = 91/270 (33%), Positives = 153/270 (56%), Gaps = 9/270 (3%)

Query:  28 LFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYLKWNKD 87
           |  .|   .||| |      |.. | .  |...||.||.|| |.| || | | .|.|| .
Sbjct:  41 LLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPE 100

Query:  88 EYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAITKSSCRV 147
           ..| .  . ||.  .| ||| | |   |    |    | ||| |..    |    ..| .
Sbjct: 101 DFDNITKLSIPTDSIWVPDI-LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSL 159

Query: 148 DVSFFPFDAQQCRFTYGSWTYNGNQLDI----LNALESADLADLVENVEWEILG-MPAKK 202
           |.  |||| | |  |. || .    ..|    |     .| .  .   |||.|| .|  .
Sbjct: 160 DIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFR 219

Query: 203 NIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLG 262
                   .. | .. . . ..||  ||| .||.| . .  .  .||||| .|||.||  
Sbjct: 220 EFSMES--SNYYAEMKFYVVIRRRPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFK 277

Query: 263 VTVMLALTVFQLLVAEIMPPSE-NVPLIGK 291
           .|..|  .|| ..|.. .| .    |||||
Sbjct: 278 ITLLLGYSVFLIIVSDTLPATAIGTPLIGK 307

>hg18||uc001zdu
        |15|NM_148911|Q8IUZ4|Q8IUZ4_HUMAN|CHRFAM7A|NM_148911|NP_683709|CHRNA7-F
        AM7A fusion isoform 2

          Length = 321

 Score =  164 bits (414), Expect = 3e-040
 Identities = 77/174 (44%), Positives = 114/174 (65%), Gaps = 1/174 (0%)

Query: 179 LESADLADLVENVEWEILGMPAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPC 238
           .. ||..  . | ||...|.| |..   | || .||||||.|. ..||  .|  ||||||
Sbjct:   1 MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPC 60

Query: 239 VMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMP-PSENVPLIGKYYXXXX 297
           |.|| || | | ||||||||.|||.||.|.|||| ||||||||  |..|||| .|.    
Sbjct:  61 VLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTM 120

Query: 298 XXXXXXXXXXXFIMNIHHCGPDAKPVPKWAKTVILQYMARMCFVYEVGDNCMSP 351
                       ..  ||  ||   .||| . ..| . |    .   |.. . |
Sbjct: 121 IIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRP 174

>hg18||uc003fmm
        |3|NM_182589|Q7Z6B2|Q7Z6B2_HUMAN|HTR3E|NM_182589|NP_872395|5-hydroxytry
        ptamine receptor 3 subunit E

          Length = 471

 Score =  163 bits (410), Expect = 9e-040
 Identities = 85/302 (28%), Positives = 155/302 (51%), Gaps = 10/302 (3%)

Query:  37 RPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYLKWNKDEYDGLDTIR 96
           ||| . .    | .   .| |.|..|.  .|...||.  || . .. || .| .|.  . 
Sbjct:  70 RPVTNISVPTQVNISFAMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMS 129

Query:  97 IPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAITKSSCRVDVSFFPFDA 156
           . .  .| ||| .    |   | |      . ..|.| .  |    | | .|. .|||| 
Sbjct: 130 MAAKNLWLPDIFIIELMDVDKT-PKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQ 188

Query: 157 QQCRFTYGSWTYNGNQLDILNALESADLADLVENV-----EWEILGMPAKKNIIQYGCCA 211
           | |  |. |. |  . . .    |  .. |   |.     |||.||.      .  |   
Sbjct: 189 QNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRG--G 246

Query: 212 DPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTV 271
           . |  . . . ..|| | || |||.|   .  .  | ||||  || .|   .|..|   |
Sbjct: 247 NLYDQIVFYVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNV 306

Query: 272 FQLLVAEIMPPSENVPLIGKYYXXXXXXXXXXXXXXXFIMNIHHCG-PDAKPVPKWAKTV 330
           | |......| |   |||| |.               || .. |       |.|.|  ..
Sbjct: 307 FLLMMSDLLPTS-GTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSL 365

Query: 331 IL 332
           .|
Sbjct: 366 LL 367

>hg18||uc003fmk
        |3|NM_130770|Q8WXA8|Q8WXA8_HUMAN|HTR3C|NM_130770|NP_570126|5-hydroxytry
        ptamine receptor 3 subunit C

          Length = 447

 Score =  156 bits (394), Expect = 6e-038
 Identities = 88/304 (28%), Positives = 152/304 (50%), Gaps = 10/304 (3%)

Query:  35 ALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYLKWNKDEYDGLDT 94
           | ||  . .    | .  ||| |. .| . |.||..||.  || . .. ||  |  |.. 
Sbjct:  53 AFRPFTNYSIPTRVNISFTLSAILGVDAQLQLLTSFLWMDLVWDNPFINWNPKECVGINK 112

Query:  95 IRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAITKSSCRVDVSFFPF 154
           . . .  .| ||| .  . |   | |      |  .|.| .| |    | | .|. .|||
Sbjct: 113 LTVLAENLWLPDIFIVESMDVDQT-PSGLTAYISSEGRIKYDKPMRVTSICNLDIFYFPF 171

Query: 155 DAQQCRFTYGSWTYNGNQLDILNALESADLADLVENV-----EWEILGMPAKKNIIQYGC 209
           | | | ||. |. |  . . .    |  .. |    |     |||.||.      .  | 
Sbjct: 172 DQQNCTFTFSSFLYTVDSMLLGMDKEVWEITDTSRKVIQTQGEWELLGINKATPKMSMG- 230

Query: 210 CADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLAL 269
             . |  . . . ..|| | |. |||.|   .  .  | |||||.|  .    .|..|  
Sbjct: 231 -NNLYDQIMFYVAIRRRPSLYIINLLVPSSFLVAIDALSFYLPAESENRAPFKITLLLGY 289

Query: 270 TVFQLLVAEIMPPSENVPLIGKYYXXXXXXXXXXXXXXXFIMNIHHCG-PDAKPVPKWAK 328
            || |.. ...| |   |||  |.               ||  . |       |.|.|  
Sbjct: 290 NVFLLMMNDLLPAS-GTPLISVYFALCLSLMVVSLLETVFITYLLHVATTQPPPMPRWLH 348

Query: 329 TVIL 332
           ...|
Sbjct: 349 SLLL 352

>hg18||uc002vsx
        |2|NM_005199|P07510|ACHG_HUMAN|CHRNG|NM_005199|NP_005190|cholinergic
        receptor, nicotinic, gamma

          Length = 517

 Score =  151 bits (380), Expect = 3e-036
 Identities = 73/187 (39%), Positives = 114/187 (60%), Gaps = 7/187 (3%)

Query:   8 LSVVACWTAHGK-YAQKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQI 66
           | .  |  | |.   ..|| ||  .|   ||| |  ....||.|..||. .| ..|| . 
Sbjct:  12 LLLAVCLGAQGRNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEA 71

Query:  67 LTAYLWIRQVWVDAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVV 126
           ||  .||   | |  |.|.  .|.||  .|.||. |||||||| || |  |   .  ||.
Sbjct:  72 LTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVL 131

Query: 127 IRHDGQITWDSPAITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLAD 186
           .  || | |  ||| .|.| . |..|||| | |   . | ||. |..|.  . |      
Sbjct: 132 VSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDG---- 187

Query: 187 LVENVEW 193
             . .||
Sbjct: 188 --QTIEW 192

>hg18||uc002yet
        |20|AB209359|Q4VAQ3|Q4VAQ3_HUMAN|CHRNA4|NM_000744|NP_000735|cholinergic
        receptor, nicotinic, alpha 4 subunit

          Length = 451

 Score =  151 bits (379), Expect = 3e-036
 Identities = 74/190 (38%), Positives = 110/190 (57%), Gaps = 4/190 (2%)

Query: 163 YGSWTYNGNQLDILNALESADLADLVENVEWEILGMPAKKNIIQYGCCADPYPDVTYTLK 222
           .|||||.  ..|..|     |  |  |. || |.      |  .| |||. |||.||   
Sbjct:   3 FGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFV 62

Query: 223 LKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPP 282
           ..|   ||  ||.|||..|| |  | ||||.. |||..| ..|.|.|||| ||. ||.| 
Sbjct:  63 IRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPS 122

Query: 283 SENV-PLIGKYYXXXXXXXXXXXXXXXFIMNIHHCGPDAKPVPKWAKTVILQYMARMCFV 341
           .  | ||||.|                |..|.||  |    .| | . | |  . |.  .
Sbjct: 123 TSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLM 182

Query: 342 YE---VGDNC 348
                | |||
Sbjct: 183 KRPSVVKDNC 192

>hg18||uc002yev
        |20|BC096292|Q4VAQ3|Q4VAQ3_HUMAN|CHRNA4|NM_000744|NP_000735|cholinergic
        receptor, nicotinic, alpha 4 subunit

          Length = 451

 Score =  151 bits (379), Expect = 3e-036
 Identities = 74/190 (38%), Positives = 110/190 (57%), Gaps = 4/190 (2%)

Query: 163 YGSWTYNGNQLDILNALESADLADLVENVEWEILGMPAKKNIIQYGCCADPYPDVTYTLK 222
           .|||||.  ..|..|     |  |  |. || |.      |  .| |||. |||.||   
Sbjct:   3 FGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFV 62

Query: 223 LKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPP 282
           ..|   ||  ||.|||..|| |  | ||||.. |||..| ..|.|.|||| ||. ||.| 
Sbjct:  63 IRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPS 122

Query: 283 SENV-PLIGKYYXXXXXXXXXXXXXXXFIMNIHHCGPDAKPVPKWAKTVILQYMARMCFV 341
           .  | ||||.|                |..|.||  |    .| | . | |  . |.  .
Sbjct: 123 TSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLM 182

Query: 342 YE---VGDNC 348
                | |||
Sbjct: 183 KRPSVVKDNC 192

>hg18||uc003fml
        |3|AY349352|Q6V707|Q6V707_HUMAN|HTR3E|NM_182589|NP_872395|5-hydroxytryp
        tamine receptor 3 subunit E

          Length = 441

 Score =  138 bits (346), Expect = 2e-032
 Identities = 74/263 (28%), Positives = 131/263 (49%), Gaps = 10/263 (3%)

Query:  76 VWVDAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITW 135
           || . .. || .| .|.  . . .  .| ||| .    |   | |      . ..|.| .
Sbjct:  79 VWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKT-PKGLTAYVSNEGRIRY 137

Query: 136 DSPAITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENV---- 191
             |    | | .|. .|||| | |  |. |. |  . . .    |  .. |   |.    
Sbjct: 138 KKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTH 197

Query: 192 -EWEILGMPAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFY 250
            |||.||.      .  |   . |  . . . ..|| | || |||.|   .  .  | ||
Sbjct: 198 GEWELLGLSKATAKLSRG--GNLYDQIVFYVAIRRRPSLYVINLLVPSGFLVAIDALSFY 255

Query: 251 LPADSGEKVSLGVTVMLALTVFQLLVAEIMPPSENVPLIGKYYXXXXXXXXXXXXXXXFI 310
           ||  || .|   .|..|   || |......| |   |||| |.               ||
Sbjct: 256 LPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTS-GTPLIGVYFALCLSLMVGSLLETIFI 314

Query: 311 MNIHHCG-PDAKPVPKWAKTVIL 332
            .. |       |.|.|  ...|
Sbjct: 315 THLLHVATTQPPPLPRWLHSLLL 337

>hg18||uc003fmn
        |3|AY349353|Q6V706|Q6V706_HUMAN|HTR3E|NM_182589|NP_872395|5-hydroxytryp
        tamine receptor 3 subunit E

          Length = 456

 Score =  138 bits (346), Expect = 2e-032
 Identities = 74/263 (28%), Positives = 131/263 (49%), Gaps = 10/263 (3%)

Query:  76 VWVDAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITW 135
           || . .. || .| .|.  . . .  .| ||| .    |   | |      . ..|.| .
Sbjct:  94 VWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKT-PKGLTAYVSNEGRIRY 152

Query: 136 DSPAITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLADLVENV---- 191
             |    | | .|. .|||| | |  |. |. |  . . .    |  .. |   |.    
Sbjct: 153 KKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTH 212

Query: 192 -EWEILGMPAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFY 250
            |||.||.      .  |   . |  . . . ..|| | || |||.|   .  .  | ||
Sbjct: 213 GEWELLGLSKATAKLSRG--GNLYDQIVFYVAIRRRPSLYVINLLVPSGFLVAIDALSFY 270

Query: 251 LPADSGEKVSLGVTVMLALTVFQLLVAEIMPPSENVPLIGKYYXXXXXXXXXXXXXXXFI 310
           ||  || .|   .|..|   || |......| |   |||| |.               ||
Sbjct: 271 LPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTS-GTPLIGVYFALCLSLMVGSLLETIFI 329

Query: 311 MNIHHCG-PDAKPVPKWAKTVIL 332
            .. |       |.|.|  ...|
Sbjct: 330 THLLHVATTQPPPLPRWLHSLLL 352

>hg18||uc002fzk
        |17|NM_000080|Q04844|ACHE_HUMAN|CHRNE|NM_000080|NP_000071|nicotinic
        acetylcholine receptor epsilon

          Length = 493

 Score =  136 bits (342), Expect = 7e-032
 Identities = 61/159 (38%), Positives = 99/159 (62%)

Query:  23 KLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYL 82
           .|   || .|    ||| .  . . ..|.|||. .| ..|. . ||  .||   | |  |
Sbjct:  26 RLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRL 85

Query:  83 KWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAITK 142
            ..||.. |..|.|.||  || |.||| || |  |    | ||..   | .||  ||| .
Sbjct:  86 NYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLPPAIYR 145

Query: 143 SSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALES 181
           | | |.|..|||| | |   . | |||  ...   |...
Sbjct: 146 SVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDN 184

>hg18||uc002ghb
        |17|NM_000747|P11230|ACHB_HUMAN|CHRNB1|NM_000747|NP_000738|nicotinic
        acetylcholine receptor beta 1 subunit

          Length = 501

 Score =  129 bits (324), Expect = 8e-030
 Identities = 53/157 (33%), Positives = 99/157 (63%)

Query:  23 KLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYL 82
           .|   ||. | |..||  .  . . |.. . |.|.| ..|... ..  ...   | |  |
Sbjct:  29 RLREKLFSGYDSSVRPAREVGDRVRVSVGLILAQLISLNEKDEEMSTKVYLDLEWTDYRL 88

Query:  83 KWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAITK 142
            |.  |.||.|..|| .  || ||.|| || | .|   .| .||.  || . |  | | .
Sbjct:  89 SWDPAEHDGIDSLRITAESVWLPDVVLLNNNDGNFDVALDISVVVSSDGSVRWQPPGIYR 148

Query: 143 SSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNAL 179
           ||| . |..|||| | |   . |..|. ... .   |
Sbjct: 149 SSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLQTGL 185

>hg18||uc001pok
        |11|NM_006028|O95264|O95264_HUMAN|HTR3B|NM_006028|NP_006019|5-hydroxytr
        yptamine (serotonin) receptor 3B

          Length = 441

 Score =  129 bits (322), Expect = 1e-029
 Identities = 77/275 (28%), Positives = 133/275 (48%), Gaps = 8/275 (2%)

Query:  24 LLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYLK 83
           |   |   |   .||| .      | | . .  |.|.|  ||||   .| ..|| | .| 
Sbjct:  35 LSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLS 94

Query:  84 WNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAITKS 143
           ||   .| .  | .| | .| |||.. |   |    |    | .   | |    |    |
Sbjct:  95 WNSSMFDEIREISLPLSAIWAPDIII-NEFVDIERYPDLPYVYVNSSGTIENYKPIQVVS 153

Query: 144 SCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLAD----LVENVEWEILGMP 199
           .| ..   |||| | |  |. |  .    .|.       |.       . . |||.| . 
Sbjct: 154 ACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVS 213

Query: 200 AKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKV 259
           .  .|.|    |  .  . . . ..|    || .|||| . .  .    |||| .   ..
Sbjct: 214 STYSILQ--SSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARI 271

Query: 260 SLGVTVMLALTVFQLLVAEIMPPS-ENVPLIGKYY 293
               .|..  |||.. ..  .| |  . |||| ..
Sbjct: 272 VFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFF 306

>hg18||uc001pol
        |11|AM293589|Q0VJC3|Q0VJC3_HUMAN|HTR3B|NM_006028|NP_006019|5-hydroxytry
        ptamine (serotonin) receptor 3B

          Length = 430

 Score =  129 bits (322), Expect = 1e-029
 Identities = 77/275 (28%), Positives = 133/275 (48%), Gaps = 8/275 (2%)

Query:  24 LLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYLK 83
           |   |   |   .||| .      | | . .  |.|.|  ||||   .| ..|| | .| 
Sbjct:  24 LSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLS 83

Query:  84 WNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIRHDGQITWDSPAITKS 143
           ||   .| .  | .| | .| |||.. |   |    |    | .   | |    |    |
Sbjct:  84 WNSSMFDEIREISLPLSAIWAPDIII-NEFVDIERYPDLPYVYVNSSGTIENYKPIQVVS 142

Query: 144 SCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLAD----LVENVEWEILGMP 199
           .| ..   |||| | |  |. |  .    .|.       |.       . . |||.| . 
Sbjct: 143 ACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVS 202

Query: 200 AKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKV 259
           .  .|.|    |  .  . . . ..|    || .|||| . .  .    |||| .   ..
Sbjct: 203 STYSILQ--SSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARI 260

Query: 260 SLGVTVMLALTVFQLLVAEIMPPS-ENVPLIGKYY 293
               .|..  |||.. ..  .| |  . |||| ..
Sbjct: 261 VFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFF 295

>hg18||uc002vsw
        |2|NM_000751|Q07001|ACHD_HUMAN|CHRND|NM_000751|NP_000742|nicotinic
        acetylcholine receptor delta

          Length = 517

 Score =  124 bits (309), Expect = 4e-028
 Identities = 66/191 (34%), Positives = 100/191 (52%), Gaps = 6/191 (3%)

Query:   8 LSVVACWTAHGKYAQKLLTDLF--ASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQ 65
           |.|   |  . .  ..|.  ||    |   ||||      ..| | .||| .| . |  .
Sbjct:  14 LAVCGSWGLNEE--ERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEE 71

Query:  66 ILTAYLWIRQVWVDAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNV 125
            ||  .||   | |  |||| .|.  .  .|.|   || |.||| || |  |      ||
Sbjct:  72 TLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCNV 131

Query: 126 VIRHDGQITWDSPAITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDILNALESADLA 185
           .. | | . |  ||| .||| . |..|||| | |   . |  |   .. .  .|.     
Sbjct: 132 LVYHYGFVYWLPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEITL--SLKQDAKE 189

Query: 186 DLVENVEWEIL 196
           .    ||| |.
Sbjct: 190 NRTYPVEWIII 200

>hg18||uc002bdz |15|CR619227|NA|NA|CHRNA5|NA|NA|Homo sapiens nicotinic
        cholinergic receptor alpha 5-like mRNA, partial sequence

          Length = 160

 Score =  115 bits (286), Expect = 2e-025
 Identities = 50/110 (45%), Positives = 73/110 (66%), Gaps = 1/110 (0%)

Query:  19 KYAQKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWV 78
           |.   || |||  |   .||||  |. . .   . .||..|.||.||..|  .|..| |.
Sbjct:  45 KHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWI 104

Query:  79 DAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIR 128
           |  |.|| |.| |.  ||.||  || |||||..|||  | |   |  |||
Sbjct: 105 DVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEG-TSTKTVIR 153

>hg18||uc002vsw
        |2|NM_000751|Q07001|ACHD_HUMAN|CHRND|NM_000751|NP_000742|nicotinic
        acetylcholine receptor delta

          Length = 517

 Score =  107 bits (266), Expect = 4e-023
 Identities = 59/171 (34%), Positives = 94/171 (54%), Gaps = 2/171 (1%)

Query: 183 DLADLVENVEWEILGMPAKKNIIQYGCCADP-YPDVTYTLKLKRRASFYVFNLLIPCVMI 241
           |     || ||||.  ||. |.        |   |.|. | ..|.  ||. |.|.|||.|
Sbjct: 201 DPEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYLIIRRKPLFYIINILVPCVLI 260

Query: 242 SFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMP-PSENVPLIGKYYXXXXXXX 300
           ||.  | |||||||||| |. ..|.|| .|| ||... .|  |  .|||||.        
Sbjct: 261 SFMVNLVFYLPADSGEKTSVAISVLLAQSVFLLLISKRLPATSMAIPLIGKFLLFGMVLV 320

Query: 301 XXXXXXXXFIMNIHHCGPDAKPVPKWAKTVILQYMARMCFVYEVGDNCMSP 351
                    ..|||   |    . .  | . |. .  .  .    ..  ||
Sbjct: 321 TMVVVICVIVLNIHFRTPSTHVLSEGVKKLFLETLPELLHMSRPAEDGPSP 371

>hg18||uc002ghb
        |17|NM_000747|P11230|ACHB_HUMAN|CHRNB1|NM_000747|NP_000738|nicotinic
        acetylcholine receptor beta 1 subunit

          Length = 501

 Score =  97 bits (239), Expect = 6e-020
 Identities = 57/182 (31%), Positives = 94/182 (51%), Gaps = 18/182 (9%)

Query: 188 VENVEWEILGMPAKKNIIQ-----YGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMIS 242
           .|| .|||.  |..  .||      |       .| . | ..|.  ||. |.. ||..|.
Sbjct: 203 IENGQWEIIHKPSR--LIQPPGDPRGGREGQRQEVIFYLIIRRKPLFYLVNVIAPCILIT 260

Query: 243 FLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMP-PSENVPLIGKYYXXXXXXXX 301
            ||   |||| |.|||. | .  .| |||| ||.|. .|  | .||.| ||         
Sbjct: 261 LLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLSVPIIIKYLMFTMVLVT 320

Query: 302 XXXXXXXFIMNIHHCGPDAKPVPKWAKTVILQYMARMCFVYEVGDNCMSPQPEK---PEP 358
                   ..|.||  |    .| | . . .  .               |.||.   |||
Sbjct: 321 FSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYL-------RLKRPKPERDLMPEP 373

Query: 359 PY 360
           |.
Sbjct: 374 PH 375

>hg18||uc003fmo |3|BC101185|NA|NA|HTR3E|NM_182589|NP_872395|5-hydroxytryptamine
        receptor 3 subunit E

          Length = 169

 Score =  94 bits (231), Expect = 5e-019
 Identities = 43/149 (28%), Positives = 81/149 (54%), Gaps = 6/149 (4%)

Query:  55 SQIIDMDERNQILTAYLWIRQVWVDAYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNAD 114
           | |.|..|.  .|...||.  || . .. || .| .|.  . . .  .| ||| .    |
Sbjct:   2 SAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMD 61

Query: 115 DHFTGPMDTNVVIRHDGQITWDSPAITKSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLD 174
              | |      . ..|.| .  |    | | .|. .|||| | |  |. |. |  . . 
Sbjct:  62 VDKT-PKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSML 120

Query: 175 ILNALESADLADLVENV-----EWEILGM 198
           .    |  .. |   |.     |||.||.
Sbjct: 121 LDMEKEVWEITDASRNILQTHGEWELLGL 149

>hg18||uc002bee |15|BC096083|NA|NA|CHRNB4|NA|NA|Homo sapiens cholinergic
        receptor, nicotinic, beta 4, mRNA (cDNA clone MGC:116718
        IMAGE:40000733), complete cds

          Length = 231

 Score =  92 bits (226), Expect = 2e-018
 Identities = 37/94 (39%), Positives = 64/94 (68%), Gaps = 2/94 (2%)

Query:  22 QKLLTDLF--ASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVD 79
           .||. ||     | . .||   .. .... ||..|.|.| ..|| ||.|  .|..| | |
Sbjct:  28 EKLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNEREQIMTTNVWLKQEWTD 87

Query:  80 AYLKWNKDEYDGLDTIRIPSSYVWRPDIVLYNNA 113
             | ||   |.|.. .|||.  .| ||||||| .
Sbjct:  88 YRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNKS 121

>hg18||uc003lyr
        |5|BC105639|P47870|GBRB2_HUMAN|GABRB2|NM_000813|NP_000804|gamma-aminobu
        tyric acid (GABA) A receptor, beta

          Length = 474

 Score =  79 bits (194), Expect = 1e-014
 Identities = 65/275 (23%), Positives = 123/275 (44%), Gaps = 19/275 (6%)

Query:  28 LFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYLKWNKD 87
           |   |   ||| .     . | . . .. |  . | |   |  .. .| | |  | .|  
Sbjct:  43 LLKGYDIRLRP-DFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVI 101

Query:  88 EYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIR--HDGQITWDSPAITKSSC 145
             .     |. .  .| ||    |.      |    | .||   || . .     | ..|
Sbjct: 102 PLNLTLDNRV-ADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAAC 160

Query: 146 RVDVSFFPFDAQQCRFTYGSWTYNGNQLDIL-----NALESADLADLVE--NVEWEILGM 198
            .|.  .| | | |     |. |  . ..       ||.      .| .   |.....  
Sbjct: 161 MMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLI-- 218

Query: 199 PAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPAD-SGE 257
             || .   |     || .. . ||||   ...    .| ..|. |. . |..  | |  
Sbjct: 219 -TKKVVFSTG----SYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAA 273

Query: 258 KVSLGVTVMLALTVFQLLVAEIMPPSENVPLIGKY 292
           .|.||.| .| .|     . | .|    |  |  |
Sbjct: 274 RVALGITTVLTMTTINTHLRETLPKIPYVKAIDMY 308

>hg18||uc003lys
        |5|NM_021911|P47870-2|P47870-2|GABRB2|NM_021911|NP_068711|gamma-aminobu
        tyric acid (GABA) A receptor, beta

          Length = 512

 Score =  79 bits (194), Expect = 1e-014
 Identities = 65/275 (23%), Positives = 123/275 (44%), Gaps = 19/275 (6%)

Query:  28 LFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYLKWNKD 87
           |   |   ||| .     . | . . .. |  . | |   |  .. .| | |  | .|  
Sbjct:  43 LLKGYDIRLRP-DFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVI 101

Query:  88 EYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIR--HDGQITWDSPAITKSSC 145
             .     |. .  .| ||    |.      |    | .||   || . .     | ..|
Sbjct: 102 PLNLTLDNRV-ADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAAC 160

Query: 146 RVDVSFFPFDAQQCRFTYGSWTYNGNQLDIL-----NALESADLADLVE--NVEWEILGM 198
            .|.  .| | | |     |. |  . ..       ||.      .| .   |.....  
Sbjct: 161 MMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLI-- 218

Query: 199 PAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPAD-SGE 257
             || .   |     || .. . ||||   ...    .| ..|. |. . |..  | |  
Sbjct: 219 -TKKVVFSTG----SYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAA 273

Query: 258 KVSLGVTVMLALTVFQLLVAEIMPPSENVPLIGKY 292
           .|.||.| .| .|     . | .|    |  |  |
Sbjct: 274 RVALGITTVLTMTTINTHLRETLPKIPYVKAIDMY 308

>hg18||uc003lyt
        |5|NM_000813|P47870|GBRB2_HUMAN|GABRB2|NM_000813|NP_000804|gamma-aminob
        utyric acid (GABA) A receptor, beta

          Length = 474

 Score =  79 bits (194), Expect = 1e-014
 Identities = 65/275 (23%), Positives = 123/275 (44%), Gaps = 19/275 (6%)

Query:  28 LFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYLKWNKD 87
           |   |   ||| .     . | . . .. |  . | |   |  .. .| | |  | .|  
Sbjct:  43 LLKGYDIRLRP-DFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVI 101

Query:  88 EYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIR--HDGQITWDSPAITKSSC 145
             .     |. .  .| ||    |.      |    | .||   || . .     | ..|
Sbjct: 102 PLNLTLDNRV-ADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAAC 160

Query: 146 RVDVSFFPFDAQQCRFTYGSWTYNGNQLDIL-----NALESADLADLVE--NVEWEILGM 198
            .|.  .| | | |     |. |  . ..       ||.      .| .   |.....  
Sbjct: 161 MMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLI-- 218

Query: 199 PAKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPAD-SGE 257
             || .   |     || .. . ||||   ...    .| ..|. |. . |..  | |  
Sbjct: 219 -TKKVVFSTG----SYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAA 273

Query: 258 KVSLGVTVMLALTVFQLLVAEIMPPSENVPLIGKY 292
           .|.||.| .| .|     . | .|    |  |  |
Sbjct: 274 RVALGITTVLTMTTINTHLRETLPKIPYVKAIDMY 308

>hg18||uc001aip
        |1|NM_000815|O14764|GBRD_HUMAN|GABRD|NM_000815|NP_000806|gamma-aminobut
        yric acid (GABA) A receptor,

          Length = 452

 Score =  72 bits (176), Expect = 1e-012
 Identities = 62/275 (22%), Positives = 120/275 (43%), Gaps = 10/275 (3%)

Query:  25 LTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWVDAYLKW 84
           |  | | |    ||      . || | . .. |  . | |   |  ... | | |. | .
Sbjct:  44 LDGLIAGYARNFRPGIGGPPV-NVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSY 102

Query:  85 N-KDEYDGLDTIRIPSSYVWRPDIVLYNNADDHFTGPMDTNVVIR--HDGQITWDSPAIT 141
           |  .|  |||.  .    .| ||  . |     |      | .||   || | .     .
Sbjct: 103 NHTNETLGLDSRFVDK--LWLPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITS 160

Query: 142 KSSCRVDVSFFPFDAQQCRFTYGSWTYNGNQLDIL--NALESADLADLVENVEWEILGMP 199
             .| .|.. .| | |.|     |. |.   .      . |     | ..  .. |    
Sbjct: 161 TVACDMDLAKYPMDEQECMLDLESYGYSSEDIVYYWSESQEHIHGLDKLQLAQFTITSYR 220

Query: 200 AKKNIIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYL-PADSGEK 258
               .. .   |  .| ..    |.|    |.    .| |..  .. . |..  |    .
Sbjct: 221 FTTELMNFK-SAGQFPRLSLHFHLRRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPAR 279

Query: 259 VSLGVTVMLALTVFQLLVAEIMPPSENVPLIGKYY 293
           ||||.| .| .|   .     .| .  .  .  |.
Sbjct: 280 VSLGITTVLTMTTLMVSARSSLPRASAIKALDVYF 314

>hg18||uc003gva
        |4|NM_017581|Q14CY7|Q14CY7_HUMAN|CHRNA9|NM_017581|NP_060051|cholinergic
        receptor, nicotinic, alpha 9

          Length = 479

 Score =  53 bits (125), Expect = 1e-006
 Identities = 25/55 (45%), Positives = 33/55 (60%)

Query: 466 LLRNIEYIANCYRDQRATQKRTGEWKKVAKVLDRXXXXXXXXXXXXXSLLIMGKA 520
           | ||||||| | .| .||  .  ||||||||.||             ..||. .|
Sbjct: 424 LTRNIEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARA 478

>hg18||uc002ujd
        |2|NM_001039523|P02708|ACHA_HUMAN|CHRNA1|NM_001039523|NP_001034612|chol
        inergic receptor, nicotinic, alpha 1

          Length = 482

 Score =  49 bits (115), Expect = 1e-005
 Identities = 22/57 (38%), Positives = 39/57 (68%)

Query: 19 KYAQKLLTDLFASYTSALRPVEDTNNILNVTLQVTLSQIIDMDERNQILTAYLWIRQ 75
          ..  .|.  ||  |.| .|||||   .. ||. . | |.|..|| |||.|  . ..|
Sbjct: 22 EHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQ 78

>hg18||uc003fmj
        |3|NM_182537|Q7Z6B3|Q7Z6B3_HUMAN|HTR3D|NM_182537|NP_872343|5-hydroxytry
        ptamine receptor 3 subunit D

          Length = 279

 Score =  45 bits (104), Expect = 3e-004
 Identities = 21/61 (34%), Positives = 37/61 (60%)

Query: 221 LKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIM 280
           .. . | | || | |.|  ..  .  | |||| .||      .||.|  .|| |.. ...
Sbjct:  50 IRRRCRPSPYVVNFLVPSGILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLL 109

Query: 281 P 281
           |
Sbjct: 110 P 110

>hg18||uc001zdt
        |15|NM_139320|Q494W8|CRFM7_HUMAN|CHRFAM7A|NM_139320|NP_647536|CHRNA7-FA
        M7A fusion isoform 1

          Length = 412

 Score =  32 bits (70), Expect = 2.326
 Identities = 16/47 (34%), Positives = 23/47 (48%)

Query: 453 GQAPCSSQSSERQLLRNIEYIANCYRDQRATQKRTGEWKKVAKVLDR 499
           |  |        ..|  . |||| .| |  ..    |||  | |.||
Sbjct: 333 GGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDR 379

>hg18||uc001zdu
        |15|NM_148911|Q8IUZ4|Q8IUZ4_HUMAN|CHRFAM7A|NM_148911|NP_683709|CHRNA7-F
        AM7A fusion isoform 2

          Length = 321

 Score =  32 bits (70), Expect = 2.326
 Identities = 16/47 (34%), Positives = 23/47 (48%)

Query: 453 GQAPCSSQSSERQLLRNIEYIANCYRDQRATQKRTGEWKKVAKVLDR 499
           |  |        ..|  . |||| .| |  ..    |||  | |.||
Sbjct: 242 GGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDR 288

>hg18||uc001zft
        |15|NM_000746|P36544|ACHA7_HUMAN|CHRNA7|NM_000746|NP_000737|cholinergic
        receptor, nicotinic, alpha 7

          Length = 502

 Score =  32 bits (70), Expect = 2.326
 Identities = 16/47 (34%), Positives = 23/47 (48%)

Query: 453 GQAPCSSQSSERQLLRNIEYIANCYRDQRATQKRTGEWKKVAKVLDR 499
           |  |        ..|  . |||| .| |  ..    |||  | |.||
Sbjct: 423 GGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDR 469

>hg18||uc002bdy
        |15|NM_000745|P30532|ACHA5_HUMAN|CHRNA5|NM_000745|NP_000736|cholinergic
        receptor, nicotinic, alpha

          Length = 468

 Score =  31 bits (68), Expect = 3.968
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 452 TGQAPCSSQSSERQLLRNIEYIANCYRDQRATQKRTGEWKKVAKVLDR 499
           .|  | ||...    | .| ||      .   ..   .|| .|.||||
Sbjct: 382 SGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDWKFIAQVLDR 429

>hg18||uc002nhr
        |19|NM_000453|Q92911|SC5A5_HUMAN|SLC5A5|NM_000453|NP_000444|solute
        carrier family 5 (sodium iodide

          Length = 643

 Score =  31 bits (68), Expect = 3.968
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 226 RASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPPSE 284
           . || |  ..   .. .|.  || .||| .   |  |.   |||...  | | . ||||
Sbjct: 414 QGSFTVMGVISGPLLGAFI--LGMFLPACNTPGVLAGLGAGLALSLWVALGATLYPPSE 470

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0