BLASTP 7.6.0


Query=fugu4_573054 |jgi|Takru4|573054|e_gw2.19.386.1
        (323 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001pue |11|NM_001716|P32302|CXCR5_HUMAN|BLR1|NM_001716|N...    181   1e-045
hg18||uc001puf |11|NM_032966|P32302-2|P32302-2|BLR1|NM_032966|NP...    181   1e-045
hg18||uc004eaf |X|NM_001504|P49682|CXCR3_HUMAN|CXCR3|NM_001504|N...    161   1e-039
hg18||uc002vgz |2|U11872|P25025|CXCR2_HUMAN|IL8RB|NM_001557|NP_0...    158   2e-038
hg18||uc002vha |2|NM_001557|P25025|CXCR2_HUMAN|IL8RB|NM_001557|N...    158   2e-038
hg18||uc002vhb |2|U11875|P25025|CXCR2_HUMAN|IL8RB|NM_001557|NP_0...    158   2e-038
hg18||uc002vhc |2|NM_000634|P25024|CXCR1_HUMAN|IL8RA|NM_000634|N...    153   3e-037
hg18||uc002huw |17|NM_001838|P32248|CCR7_HUMAN|CCR7|NM_001838|NP...    142   9e-034
hg18||uc003cme |3|NM_001296|O00590|CCBP2_HUMAN|CCBP2|NM_001296|N...    135   8e-032
hg18||uc003cmf |3|BC020558|O00590|CCBP2_HUMAN|CCBP2|NM_001296|NP...    135   8e-032
hg18||uc003qvl |6|BX647686|P51684|CCR6_HUMAN|CCR6|NM_031409|NP_1...    132   5e-031
hg18||uc003qvm |6|NM_004367|P51684|CCR6_HUMAN|CCR6|NM_004367|NP_...    132   5e-031
hg18||uc003qvn |6|NM_031409|P51684|CCR6_HUMAN|CCR6|NM_031409|NP_...    132   5e-031
hg18||uc003coz |3|NM_031200|P51686|CCR9_HUMAN|CCR9|NM_031200|NP_...    124   1e-028
hg18||uc003cpa |3|NM_006641|P51686-2|P51686-2|CCR9|NM_006641|NP_...    124   1e-028
hg18||uc003cpm |3|NM_000648|Q4VBL2|Q4VBL2_HUMAN|CCR2|NM_000648|N...    119   8e-027
hg18||uc003fzn |3_random|NM_000648|Q4VBL2|Q4VBL2_HUMAN|CCR2|NM_0...    119   8e-027
hg18||uc003cpo |3|NM_000579|P51681|CCR5_HUMAN|CCR5|NM_000579|NP_...    118   1e-026
hg18||uc003fzp |3_random|NM_000579|P51681|CCR5_HUMAN|CCR5|NM_000...    118   1e-026
hg18||uc002tuy |2|NM_001008540|P61073-2|P61073-2|CXCR4|NM_001008...    117   2e-026
hg18||uc002tuz |2|NM_003467|P61073|CXCR4_HUMAN|CXCR4|NM_003467|N...    117   2e-026
hg18||uc003cfg |3|NM_005508|P51679|CCR4_HUMAN|CCR4|NM_005508|NP_...    116   4e-026
hg18||uc002iax |17|NM_016602|Q4V749|Q4V749_HUMAN|CCR10|NM_016602...    115   9e-026
hg18||uc003cpn |3|NM_000647|P41597|CCR2_HUMAN|CCR2|NM_000647|NP_...    115   1e-025
hg18||uc003fzo |3_random|NM_000647|P41597|CCR2_HUMAN|CCR2|NM_000...    115   1e-025
hg18||uc003cpg |3|BC033514|P51677|CCR3_HUMAN|CCR3|NM_178329|NP_8...    114   1e-025
hg18||uc003cpi |3|NM_001837|P51677|CCR3_HUMAN|CCR3|NM_001837|NP_...    114   1e-025
hg18||uc003cpj |3|NM_178329|P51677|CCR3_HUMAN|CCR3|NM_178329|NP_...    114   1e-025
hg18||uc003cpk |3|AF262301|Q2YDB9|Q2YDB9_HUMAN|CCR3|NM_178329|NP...    114   1e-025
hg18||uc003cpl |3|AF262300|Q2YDB9|Q2YDB9_HUMAN|CCR3|NM_178329|NP...    114   1e-025
hg18||uc003eow |3|NM_016557|Q9NPB9|CCRL1_HUMAN|CCRL1|NM_016557|N...    114   2e-025
hg18||uc003eox |3|NM_178445|Q9NPB9|CCRL1_HUMAN|CCRL1|NM_178445|N...    114   2e-025
hg18||uc002vwc |2|NM_001047841|P25106|CXCR7_HUMAN|CXCR7|NM_00104...    110   4e-024
hg18||uc002vwd |2|NM_020311|P25106|CXCR7_HUMAN|CXCR7|NM_020311|N...    110   4e-024
hg18||uc003cjn |3|NM_005201|P51685|CCR8_HUMAN|CCR8|NM_005201|NP_...    107   2e-023
hg18||uc003cph |3|NM_001295|P32246|CCR1_HUMAN|CCR1|NM_001295|NP_...    105   1e-022
hg18||uc003cjl |3|NM_001337|P49238|CX3C1_HUMAN|CX3CR1|NM_001337|...    104   3e-022
hg18||uc003cjm |3|BC107152|Q3KNR3|Q3KNR3_HUMAN|CCR8|NA|NA|CCR8 p...    104   3e-022
hg18||uc004eqh |X|NM_000686|P50052|AGTR2_HUMAN|AGTR2|NM_000686|N...    100   4e-021
hg18||uc001vcd |13|NM_005767|P43657|P2RY5_HUMAN|P2RY5|NM_005767|...     99   5e-021
hg18||uc001vce |13|AK122856|P43657|P2RY5_HUMAN|P2RY5|NM_005767|N...     99   5e-021
hg18||uc001vcf |13|BC045651|P43657|P2RY5_HUMAN|P2RY5|NM_005767|N...     99   5e-021
hg18||uc003ewg |3|NM_031850|P30556|AGTR1_HUMAN|AGTR1|NM_031850|N...     97   3e-020
hg18||uc003ewh |3|NM_004835|P30556|AGTR1_HUMAN|AGTR1|NM_004835|N...     97   3e-020
hg18||uc003ewi |3|NM_000685|P30556|AGTR1_HUMAN|AGTR1|NM_000685|N...     97   3e-020
hg18||uc003ewj |3|NM_009585|P30556|AGTR1_HUMAN|AGTR1|NM_009585|N...     97   3e-020
hg18||uc003ewk |3|NM_032049|P30556|AGTR1_HUMAN|AGTR1|NM_032049|N...     97   3e-020
hg18||uc001yfg |14|NM_000623|P30411|BKRB2_HUMAN|BDKRB2|NM_000623...     95   9e-020
hg18||uc002ckq |16|NM_001053|P35346|SSR5_HUMAN|SSTR5|NM_001053|N...     92   8e-019
hg18||uc004edd |X|NM_005296|Q99677|P2RY9_HUMAN|GPR23|NM_005296|N...     92   8e-019
hg18||uc001smk |12|NM_007264|O15218|ADMR_HUMAN|ADMR|NM_007264|NP...     91   2e-018
hg18||uc003ezq |3|NM_002563|P47900|P2RY1_HUMAN|P2RY1|NM_002563|N...     91   2e-018
hg18||uc001vmx |13|NM_080818|Q96P68|OXGR1_HUMAN|OXGR1|NM_080818|...     86   6e-017
hg18||uc002jje |17|NM_001050|P30874|SSR2_HUMAN|SSTR2|NM_001050|N...     86   7e-017
hg18||uc001yfh |14|NM_000710|P46663|BKRB1_HUMAN|BDKRB1|NM_000710...     84   2e-016
hg18||uc002wsr |20|NM_001052|Q17RM3|Q17RM3_HUMAN|SSTR4|NM_001052...     84   2e-016
hg18||uc001vck |13|NM_020377|Q9NS75|CLTR2_HUMAN|CYSLTR2|NM_02037...     83   4e-016
hg18||uc003qpn |6|NM_001008504|Q9H573|Q9H573_HUMAN|OPRM1|NM_0010...     82   6e-016
hg18||uc003qpo |6|NM_001008505|Q8IWW4|Q8IWW4_HUMAN|OPRM1|NM_0010...     82   6e-016
hg18||uc003qpq |6|AY225404|Q9H573|Q9H573_HUMAN|OPRM1|NA|NA|Opioi...     82   6e-016
hg18||uc003qpr |6|NM_000914|P35372|OPRM_HUMAN|OPRM1|NM_000914|NP...     82   6e-016
hg18||uc003qpt |6|NM_001008503|Q8IWW3|Q8IWW3_HUMAN|OPRM1|NM_0010...     82   6e-016
hg18||uc003qpu |6|AY364890|Q6UPP1|Q6UPP1_HUMAN|OPRM1|NM_00100850...     82   6e-016
hg18||uc003cpe |3|NM_005283|P46094|XCR1_HUMAN|XCR1|NM_005283|NP_...     80   4e-015
hg18||uc003cpf |3|NM_001024644|P46094|XCR1_HUMAN|XCR1|NM_0010246...     80   4e-015
hg18||uc002tpc |2|NM_005291|Q13304|GPR17_HUMAN|GPR17|NM_005291|N...     79   7e-015
hg18||uc002tpd |2|BC031653|Q13304-2|Q13304-2|GPR17|NM_005291|NP_...     79   7e-015
hg18||uc001wul |14|NM_001049|P30872|SSR1_HUMAN|SSTR1|NM_001049|N...     79   9e-015
hg18||uc001otj |11|NM_002564|P41231|P2RY2_HUMAN|P2RY2|NM_002564|...     78   1e-014
hg18||uc001otk |11|NM_176072|P41231|P2RY2_HUMAN|P2RY2|NM_176072|...     78   1e-014
hg18||uc001otl |11|NM_176071|P41231|P2RY2_HUMAN|P2RY2|NM_176071|...     78   1e-014
hg18||uc001brf |1|NM_000911|P41143|OPRD_HUMAN|OPRD1|NM_000911|NP...     78   2e-014
hg18||uc003ara |22|CR456585|P32745|SSR3_HUMAN|SSTR3|NM_001051|NP...     76   4e-014
hg18||uc003arb |22|NM_001051|P32745|SSR3_HUMAN|SSTR3|NM_001051|N...     76   4e-014
hg18||uc004cpz |X|NM_178129|Q86VZ1|P2RY8_HUMAN|P2RY8|NM_178129|N...     75   1e-013
hg18||uc004fpm |Y|NM_178129|Q86VZ1|P2RY8_HUMAN|P2RY8|NM_178129|N...     75   1e-013
hg18||uc003aub |22|NM_003614|O60755|GALR3_HUMAN|GALR3|NM_003614|...     74   2e-013
hg18||uc004dxz |X|NM_002565|P51582|P2RY4_HUMAN|P2RY4|NM_002565|N...     73   4e-013
hg18||uc002yic |20|NM_182647|P41146|OPRX_HUMAN|OPRL1|NM_182647|N...     71   2e-012
hg18||uc002yid |20|NM_000913|P41146|OPRX_HUMAN|OPRL1|NM_000913|N...     71   2e-012
hg18||uc002yif |20|AF126470|P41146-2|P41146-2|OPRL1|NM_182647|NP...     71   2e-012
hg18||uc002lms |18|NM_001480|Q4VBL7|Q4VBL7_HUMAN|GALR1|NM_001480...     69   9e-012
hg18||uc002nfa |19|NM_003950|Q96RI0|PAR4_HUMAN|F2RL3|NM_003950|N...     67   3e-011
hg18||uc003dsw |3|NM_005290|P49685|GPR15_HUMAN|GPR15|NM_005290|N...     66   6e-011
hg18||uc001qps |12|NM_020400|Q9H1C0|GPR92_HUMAN|GPR92|NM_020400|...     64   2e-010
hg18||uc001njo |11|NM_005161|P35414|APJ_HUMAN|AGTRL1|NM_005161|N...     63   4e-010
hg18||uc002pxr |19|NM_001005738|P25090|FPRL1_HUMAN|FPRL1|NM_0010...     61   1e-009
hg18||uc002pxs |19|NM_001462|P25090|FPRL1_HUMAN|FPRL1|NM_001462|...     61   1e-009
hg18||uc002jqm |17|NM_003857|O43603|GALR2_HUMAN|GALR2|NM_003857|...     59   7e-009
hg18||uc001gvn |1|NM_005298|O00155|GPR25_HUMAN|GPR25|NM_005298|N...     59   1e-008
hg18||uc003kem |5|NM_004101|O00254|PAR3_HUMAN|F2RL2|NM_004101|NP...     58   1e-008
hg18||uc003xrh |8|L37362|P41145|OPRK_HUMAN|OPRK1|NM_000912|NP_00...     58   1e-008
hg18||uc003xri |8|NM_000912|P41145|OPRK_HUMAN|OPRK1|NM_000912|NP...     58   1e-008
hg18||uc002pxt |19|NM_002030|P25089|FPRL2_HUMAN|FPRL2|NM_002030|...     57   3e-008
hg18||uc002pcl |19|NM_005282|P46093|GPR4_HUMAN|GPR4|NM_005282|NP...     55   8e-008
hg18||uc002pcm |19|BC038450|P46093|GPR4_HUMAN|GPR4|NM_005282|NP_...     55   8e-008
hg18||uc002lqk |19|NM_032551|Q969F8|KISSR_HUMAN|KISS1R|NM_032551...     54   2e-007
hg18||uc003cpp |3|NM_003965|O00421|CCRL2_HUMAN|CCRL2|NM_003965|N...     54   3e-007
hg18||uc003fzq |3_random|NM_003965|O00421|CCRL2_HUMAN|CCRL2|NM_0...     54   3e-007
hg18||uc003cpe |3|NM_005283|P46094|XCR1_HUMAN|XCR1|NM_005283|NP_...     50   3e-006

>hg18||uc001pue
        |11|NM_001716|P32302|CXCR5_HUMAN|BLR1|NM_001716|NP_001707|Burkitt
        lymphoma receptor 1 isoform 1

          Length = 372

 Score =  181 bits (458), Expect = 1e-045
 Identities = 93/239 (38%), Positives = 133/239 (55%), Gaps = 3/239 (1%)

Query:  55 PFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRRR 114
           ||.. | . ||. | |||| |    ..|  | | |||||.||||||||||| . . .|  
Sbjct: 105 PFAVAEGSVGWVLGTFLCKTVIALHKVNFYCSSLLLACIAVDRYLAIVHAVHAYRHRRLL 164

Query: 115 TVHLTCTALWMVCLAISAPNLVFLTVT-GDANSSRLSCSFDDYGIHANNWALTMRVLEHV 173
           ..|.||  .|.|   .. | ..|  |. |  |.|   |.|        .   | | | ||
Sbjct: 165 SIHITCGTIWLVGFLLALPEILFAKVSQGHHNNSLPRCTFSQENQAETHAWFTSRFLYHV 224

Query: 174 C-FFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQTR 232
             | ||. .|| ||  ||  | .. |                .| .|| ||..   | | 
Sbjct: 225 AGFLLPMLVMGWCYVGVVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTL 284

Query: 233 DNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSKAGC 291
             |      .|.    |  |. . . || .|||||| || | ||.|| .| |||.| ||
Sbjct: 285 ARLKA-VDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGC 342

>hg18||uc001puf |11|NM_032966|P32302-2|P32302-2|BLR1|NM_032966|NP_116743|Burkitt
        lymphoma receptor 1 isoform 2

          Length = 327

 Score =  181 bits (458), Expect = 1e-045
 Identities = 93/239 (38%), Positives = 133/239 (55%), Gaps = 3/239 (1%)

Query:  55 PFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRRR 114
           ||.. | . ||. | |||| |    ..|  | | |||||.||||||||||| . . .|  
Sbjct:  60 PFAVAEGSVGWVLGTFLCKTVIALHKVNFYCSSLLLACIAVDRYLAIVHAVHAYRHRRLL 119

Query: 115 TVHLTCTALWMVCLAISAPNLVFLTVT-GDANSSRLSCSFDDYGIHANNWALTMRVLEHV 173
           ..|.||  .|.|   .. | ..|  |. |  |.|   |.|        .   | | | ||
Sbjct: 120 SIHITCGTIWLVGFLLALPEILFAKVSQGHHNNSLPRCTFSQENQAETHAWFTSRFLYHV 179

Query: 174 C-FFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQTR 232
             | ||. .|| ||  ||  | .. |                .| .|| ||..   | | 
Sbjct: 180 AGFLLPMLVMGWCYVGVVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTL 239

Query: 233 DNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSKAGC 291
             |      .|.    |  |. . . || .|||||| || | ||.|| .| |||.| ||
Sbjct: 240 ARLKA-VDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGC 297

>hg18||uc004eaf
        |X|NM_001504|P49682|CXCR3_HUMAN|CXCR3|NM_001504|NP_001495|chemokine
        (C-X-C motif) receptor 3

          Length = 368

 Score =  161 bits (406), Expect = 1e-039
 Identities = 95/262 (36%), Positives = 132/262 (50%), Gaps = 11/262 (4%)

Query:  53 TFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQR 112
           | |   .. |  |.||  |||. |    .|   |. |||||| |||| ||||    .|  
Sbjct: 105 TLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGP 164

Query: 113 RRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLEH 172
              | ||| |.| .||  . |. .||.   |   .   | ..   .        .|||. 
Sbjct: 165 PARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRT----ALRVLQL 220

Query: 173 VC-FFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQT 231
           |  | ||| .|  ||| ..  || | ||                | .|| ||..  ..  
Sbjct: 221 VAGFLLPLLVMAYCYAHILAVLLVS-RGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDI 279

Query: 232 RDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSKAGC 291
             .|    .|.|     .  |  ||  ||. |||||| |||||||.||  .  || . | 
Sbjct: 280 LMDLGA-LARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLG- 337

Query: 292 GRVCPPLSGVQNGTSCSEATST 313
              ||   |.|   | |   |.
Sbjct: 338 ---CPNQRGLQRQPSSSRRDSS 356

>hg18||uc002vgz
        |2|U11872|P25025|CXCR2_HUMAN|IL8RB|NM_001557|NP_001548|interleukin 8
        receptor beta

          Length = 360

 Score =  158 bits (397), Expect = 2e-038
 Identities = 92/255 (36%), Positives = 129/255 (50%), Gaps = 6/255 (2%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           .||             | |        ||||| ||||.| | ...|   |  ||||||||
Sbjct:  84 DVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVD 143

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           ||||||||  .|  |.|  |   | ..| . | .. | |.|      .| |     ..| 
Sbjct: 144 RYLAIVHATRTL-TQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVS--PACYEDM 200

Query: 157 GIHANNWALTMRVL-EHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXV 215
           | .  || . .|.| .   | .|| ||  ||   . || |.  |               .
Sbjct: 201 GNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMG-QKHRAMRVIFAVVLI 259

Query: 216 FCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVG 275
           | .||||||.  .  |          .||    .  ||  |. ||  | |||| .|||.|
Sbjct: 260 FLLCWLPYNLVLLADTLMRTQV-IQETCERRNHIDRALDATEILGILHSCLNPLIYAFIG 318

Query: 276 VRFRRELLRLLSKAG 290
            .||  ||..|.  |
Sbjct: 319 QKFRHGLLKILAIHG 333

>hg18||uc002vha
        |2|NM_001557|P25025|CXCR2_HUMAN|IL8RB|NM_001557|NP_001548|interleukin 8
        receptor beta

          Length = 360

 Score =  158 bits (397), Expect = 2e-038
 Identities = 92/255 (36%), Positives = 129/255 (50%), Gaps = 6/255 (2%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           .||             | |        ||||| ||||.| | ...|   |  ||||||||
Sbjct:  84 DVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVD 143

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           ||||||||  .|  |.|  |   | ..| . | .. | |.|      .| |     ..| 
Sbjct: 144 RYLAIVHATRTL-TQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVS--PACYEDM 200

Query: 157 GIHANNWALTMRVL-EHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXV 215
           | .  || . .|.| .   | .|| ||  ||   . || |.  |               .
Sbjct: 201 GNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMG-QKHRAMRVIFAVVLI 259

Query: 216 FCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVG 275
           | .||||||.  .  |          .||    .  ||  |. ||  | |||| .|||.|
Sbjct: 260 FLLCWLPYNLVLLADTLMRTQV-IQETCERRNHIDRALDATEILGILHSCLNPLIYAFIG 318

Query: 276 VRFRRELLRLLSKAG 290
            .||  ||..|.  |
Sbjct: 319 QKFRHGLLKILAIHG 333

>hg18||uc002vhb
        |2|U11875|P25025|CXCR2_HUMAN|IL8RB|NM_001557|NP_001548|interleukin 8
        receptor beta

          Length = 360

 Score =  158 bits (397), Expect = 2e-038
 Identities = 92/255 (36%), Positives = 129/255 (50%), Gaps = 6/255 (2%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           .||             | |        ||||| ||||.| | ...|   |  ||||||||
Sbjct:  84 DVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVD 143

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           ||||||||  .|  |.|  |   | ..| . | .. | |.|      .| |     ..| 
Sbjct: 144 RYLAIVHATRTL-TQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVS--PACYEDM 200

Query: 157 GIHANNWALTMRVL-EHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXV 215
           | .  || . .|.| .   | .|| ||  ||   . || |.  |               .
Sbjct: 201 GNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMG-QKHRAMRVIFAVVLI 259

Query: 216 FCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVG 275
           | .||||||.  .  |          .||    .  ||  |. ||  | |||| .|||.|
Sbjct: 260 FLLCWLPYNLVLLADTLMRTQV-IQETCERRNHIDRALDATEILGILHSCLNPLIYAFIG 318

Query: 276 VRFRRELLRLLSKAG 290
            .||  ||..|.  |
Sbjct: 319 QKFRHGLLKILAIHG 333

>hg18||uc002vhc
        |2|NM_000634|P25024|CXCR1_HUMAN|IL8RA|NM_000634|NP_000625|interleukin 8
        receptor alpha

          Length = 350

 Score =  153 bits (386), Expect = 3e-037
 Identities = 91/255 (35%), Positives = 123/255 (48%), Gaps = 6/255 (2%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           .||             | |        ||||| ||||.| | ...|   |  ||||||||
Sbjct:  75 DVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVD 134

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           ||||||||  .|  |.|  |   |   | . . .| |  .|       ||| .   ..  
Sbjct: 135 RYLAIVHATRTL-TQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPV--CYEVL 191

Query: 157 GIHANNWALTMRVLEHVC-FFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXV 215
           |     | . .|.| |   | .|| .|  ||   . || |.  |               .
Sbjct: 192 GNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMG-QKHRAMRVIFAVVLI 250

Query: 216 FCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVG 275
           | .||||||.  .  |          |||    .  ||  |. ||| | |||| .|||.|
Sbjct: 251 FLLCWLPYNLVLLADTLMRTQV-IQESCERRNNIGRALDATEILGFLHSCLNPIIYAFIG 309

Query: 276 VRFRRELLRLLSKAG 290
             ||   |..|.  |
Sbjct: 310 QNFRHGFLKILAMHG 324

>hg18||uc002huw
        |17|NM_001838|P32248|CCR7_HUMAN|CCR7|NM_001838|NP_001829|chemokine (C-C
        motif) receptor 7 precursor

          Length = 378

 Score =  142 bits (356), Expect = 9e-034
 Identities = 87/243 (35%), Positives = 123/243 (50%), Gaps = 10/243 (4%)

Query:  53 TFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQR 112
           | ||     |  |.||   |||.    ...   |  || |||.|||.||| || |  | |
Sbjct: 110 TLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAV-SAHRHR 168

Query: 113 RRTV---HLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRV 169
            | .    |.|  .|..   .| | |..  .   ..   . ||     . |    .|..|
Sbjct: 169 ARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEA---FITIQV 225

Query: 170 LEHVC-FFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASV 228
            . |  | .||  |  ||  .. |||. ||                || |  ||||   .
Sbjct: 226 AQMVIGFLVPLLAMSFCYLVIIRTLLQ-ARNFERNKAIKVIIAVVVVFIVFQLPYNGVVL 284

Query: 229 LQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSK 288
            ||  | .   | .||    |  |  || ||    ||.|||||||.||.|| .| .|   
Sbjct: 285 AQTVANFNI-TSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKD 343

Query: 289 AGC 291
            ||
Sbjct: 344 LGC 346

>hg18||uc003cme
        |3|NM_001296|O00590|CCBP2_HUMAN|CCBP2|NM_001296|NP_001287|chemokine
        binding protein 2

          Length = 384

 Score =  135 bits (339), Expect = 8e-032
 Identities = 92/276 (33%), Positives = 129/276 (46%), Gaps = 7/276 (2%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           |.|             | ||  .  |  |.|| ||||.|     .|   | | ..|.|.|
Sbjct:  82 EIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLCKMVSTLYTINFYSGIFFISCMSLD 141

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           .|| ||||    . . |    |  | .| | ||.| |..||  |    |   .     |.
Sbjct: 142 KYLEIVHAQPYHRLRTRAKSLLLATIVWAVSLAVSIPDMVF--VQTHENPKGVWNCHADF 199

Query: 157 GIHANNWALTMRVLEHVC-FFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXV 215
           | |   | | .|  ...  | |||  |   |.  .| .|   |                 
Sbjct: 200 GGHGTIWKLFLRFQQNLLGFLLPLLAMIFFYSR-IGCVLVRLRPAGQGRALKIAAALVVA 258

Query: 216 FCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVG 275
           | | | |||.   | |   |      .||    |  || ||.|. | ||| .| ||||  
Sbjct: 259 FFVLWFPYNLTLFLHTL--LDLQVFGNCEVSQHLDYALQVTESIAFLHCCFSPILYAFSS 316

Query: 276 VRFRRELLRLLSKAGCGRVCPPLSGVQNGTSCSEAT 311
            |||. |   |. |  |    | .   . .||||..
Sbjct: 317 HRFRQYLKAFLA-AVLGWHLAPGTAQASLSSCSESS 351

>hg18||uc003cmf
        |3|BC020558|O00590|CCBP2_HUMAN|CCBP2|NM_001296|NP_001287|chemokine
        binding protein 2

          Length = 384

 Score =  135 bits (339), Expect = 8e-032
 Identities = 92/276 (33%), Positives = 129/276 (46%), Gaps = 7/276 (2%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           |.|             | ||  .  |  |.|| ||||.|     .|   | | ..|.|.|
Sbjct:  82 EIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLCKMVSTLYTINFYSGIFFISCMSLD 141

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           .|| ||||    . . |    |  | .| | ||.| |..||  |    |   .     |.
Sbjct: 142 KYLEIVHAQPYHRLRTRAKSLLLATIVWAVSLAVSIPDMVF--VQTHENPKGVWNCHADF 199

Query: 157 GIHANNWALTMRVLEHVC-FFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXV 215
           | |   | | .|  ...  | |||  |   |.  .| .|   |                 
Sbjct: 200 GGHGTIWKLFLRFQQNLLGFLLPLLAMIFFYSR-IGCVLVRLRPAGQGRALKIAAALVVA 258

Query: 216 FCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVG 275
           | | | |||.   | |   |      .||    |  || ||.|. | ||| .| ||||  
Sbjct: 259 FFVLWFPYNLTLFLHTL--LDLQVFGNCEVSQHLDYALQVTESIAFLHCCFSPILYAFSS 316

Query: 276 VRFRRELLRLLSKAGCGRVCPPLSGVQNGTSCSEAT 311
            |||. |   |. |  |    | .   . .||||..
Sbjct: 317 HRFRQYLKAFLA-AVLGWHLAPGTAQASLSSCSESS 351

>hg18||uc003qvl |6|BX647686|P51684|CCR6_HUMAN|CCR6|NM_031409|NP_113597|chemokine
        (C-C motif) receptor 6

          Length = 374

 Score =  132 bits (332), Expect = 5e-031
 Identities = 97/284 (34%), Positives = 130/284 (45%), Gaps = 10/284 (3%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATG-WIFGEFLCKLVGLARQLNLLCGSFLLACISV 95
           .||             | ||  . .||| |.|    |||.     .|  ||  || |||.
Sbjct:  82 DVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISM 141

Query:  96 DRYLAIVHAVASLQRQRRRTV---HLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCS 152
           |||.||| |  |  | | ||.    . |  .| . . ||.   ||        |      
Sbjct: 142 DRYIAIVQATKSF-RLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPK 200

Query: 153 FDDYGIHANNWALTMRVLEHVC-FFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXX 211
           .         | | |  || .  ||.||  |  ||  .| ||.. |.             
Sbjct: 201 YQTVS-EPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQ-AQNSKRHKAIRVIIA 258

Query: 212 XXXVFCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLY 271
              ||  | .|.|.  .| |  ||    .|||.|  |.     ||. | | |||||| ||
Sbjct: 259 VVLVFLACQIPHNMV-LLVTAANLG-KMNRSCQSEKLIGYTKTVTEVLAFLHCCLNPVLY 316

Query: 272 AFVGVRFRRELLRLLSKAGCGRVCPPLSGVQNGTSCSEATSTST 315
           ||.| .||   |..|    | |     ||       ||  |  |
Sbjct: 317 AFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQT 360

>hg18||uc003qvm
        |6|NM_004367|P51684|CCR6_HUMAN|CCR6|NM_004367|NP_004358|chemokine (C-C
        motif) receptor 6

          Length = 374

 Score =  132 bits (332), Expect = 5e-031
 Identities = 97/284 (34%), Positives = 130/284 (45%), Gaps = 10/284 (3%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATG-WIFGEFLCKLVGLARQLNLLCGSFLLACISV 95
           .||             | ||  . .||| |.|    |||.     .|  ||  || |||.
Sbjct:  82 DVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISM 141

Query:  96 DRYLAIVHAVASLQRQRRRTV---HLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCS 152
           |||.||| |  |  | | ||.    . |  .| . . ||.   ||        |      
Sbjct: 142 DRYIAIVQATKSF-RLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPK 200

Query: 153 FDDYGIHANNWALTMRVLEHVC-FFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXX 211
           .         | | |  || .  ||.||  |  ||  .| ||.. |.             
Sbjct: 201 YQTVS-EPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQ-AQNSKRHKAIRVIIA 258

Query: 212 XXXVFCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLY 271
              ||  | .|.|.  .| |  ||    .|||.|  |.     ||. | | |||||| ||
Sbjct: 259 VVLVFLACQIPHNMV-LLVTAANLG-KMNRSCQSEKLIGYTKTVTEVLAFLHCCLNPVLY 316

Query: 272 AFVGVRFRRELLRLLSKAGCGRVCPPLSGVQNGTSCSEATSTST 315
           ||.| .||   |..|    | |     ||       ||  |  |
Sbjct: 317 AFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQT 360

>hg18||uc003qvn
        |6|NM_031409|P51684|CCR6_HUMAN|CCR6|NM_031409|NP_113597|chemokine (C-C
        motif) receptor 6

          Length = 374

 Score =  132 bits (332), Expect = 5e-031
 Identities = 97/284 (34%), Positives = 130/284 (45%), Gaps = 10/284 (3%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATG-WIFGEFLCKLVGLARQLNLLCGSFLLACISV 95
           .||             | ||  . .||| |.|    |||.     .|  ||  || |||.
Sbjct:  82 DVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISM 141

Query:  96 DRYLAIVHAVASLQRQRRRTV---HLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCS 152
           |||.||| |  |  | | ||.    . |  .| . . ||.   ||        |      
Sbjct: 142 DRYIAIVQATKSF-RLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPK 200

Query: 153 FDDYGIHANNWALTMRVLEHVC-FFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXX 211
           .         | | |  || .  ||.||  |  ||  .| ||.. |.             
Sbjct: 201 YQTVS-EPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQ-AQNSKRHKAIRVIIA 258

Query: 212 XXXVFCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLY 271
              ||  | .|.|.  .| |  ||    .|||.|  |.     ||. | | |||||| ||
Sbjct: 259 VVLVFLACQIPHNMV-LLVTAANLG-KMNRSCQSEKLIGYTKTVTEVLAFLHCCLNPVLY 316

Query: 272 AFVGVRFRRELLRLLSKAGCGRVCPPLSGVQNGTSCSEATSTST 315
           ||.| .||   |..|    | |     ||       ||  |  |
Sbjct: 317 AFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQT 360

>hg18||uc003coz
        |3|NM_031200|P51686|CCR9_HUMAN|CCR9|NM_031200|NP_112477|chemokine (C-C
        motif) receptor 9 isoform A

          Length = 369

 Score =  124 bits (311), Expect = 1e-028
 Identities = 72/242 (29%), Positives = 122/242 (50%), Gaps = 7/242 (2%)

Query:  53 TFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQR 112
           | ||  .  |  | |  |.||.|    ..|      |. |||||||.||  |. .   . 
Sbjct: 100 TLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWRE 159

Query: 113 RRTVH--LTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSF-DDYGIHANNWALTMRV 169
           .| ..  . |  .|..  |.  | ...  .  ..  .  .  .  |      .  ||..|
Sbjct: 160 KRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKV 219

Query: 170 LEHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVL 229
           .  . ||||  .|  ||  .. ||.. |.                || .   |||   ..
Sbjct: 220 I--LGFFLPFVVMACCYTIIIHTLIQ-AKKSSKHKALKVTITVLTVFVLSQFPYNCILLV 276

Query: 230 QTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSKA 289
           || |  .   | .|     .     ||... | | |||| || ||| ||||.|.. |   
Sbjct: 277 QTIDAYAMFIS-NCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNL 335

Query: 290 GC 291
           ||
Sbjct: 336 GC 337

>hg18||uc003cpa
        |3|NM_006641|P51686-2|P51686-2|CCR9|NM_006641|NP_006632|chemokine (C-C
        motif) receptor 9 isoform B

          Length = 357

 Score =  124 bits (311), Expect = 1e-028
 Identities = 72/242 (29%), Positives = 122/242 (50%), Gaps = 7/242 (2%)

Query:  53 TFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQR 112
           | ||  .  |  | |  |.||.|    ..|      |. |||||||.||  |. .   . 
Sbjct:  88 TLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWRE 147

Query: 113 RRTVH--LTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSF-DDYGIHANNWALTMRV 169
           .| ..  . |  .|..  |.  | ...  .  ..  .  .  .  |      .  ||..|
Sbjct: 148 KRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKV 207

Query: 170 LEHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVL 229
           .  . ||||  .|  ||  .. ||.. |.                || .   |||   ..
Sbjct: 208 I--LGFFLPFVVMACCYTIIIHTLIQ-AKKSSKHKALKVTITVLTVFVLSQFPYNCILLV 264

Query: 230 QTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSKA 289
           || |  .   | .|     .     ||... | | |||| || ||| ||||.|.. |   
Sbjct: 265 QTIDAYAMFIS-NCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNL 323

Query: 290 GC 291
           ||
Sbjct: 324 GC 325

>hg18||uc003cpm
        |3|NM_000648|Q4VBL2|Q4VBL2_HUMAN|CCR2|NM_000648|NP_000639|chemokine
        (C-C motif) receptor 2 isoform B

          Length = 360

 Score =  119 bits (296), Expect = 8e-027
 Identities = 79/259 (30%), Positives = 117/259 (45%), Gaps = 7/259 (2%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           ..|             | |      |  |.||  .|||      .    | | .  ...|
Sbjct:  78 DIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTID 137

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           ||||||||| .|. .      .|    |.| .  | | ..| |     .|  .   .   
Sbjct: 138 RYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIF-TKCQKEDSVYVCGPYFPR 196

Query: 157 GIHANNWALTMRVLEHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVF 216
           |   ||.   || .  .   ||| ||  ||. .. |||.                   |.
Sbjct: 197 G--WNNFHTIMRNI--LGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVY 252

Query: 217 CVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGV 276
            . | |||.  .| |          .|||   |  |  ||..|| .|||.|| .||||| 
Sbjct: 253 FLFWTPYNIVILLNTFQEFF--GLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGE 310

Query: 277 RFRRELLRLLSKAGCGRVC 295
           .||| |     |    | |
Sbjct: 311 KFRRYLSVFFRKHITKRFC 329

>hg18||uc003fzn
        |3_random|NM_000648|Q4VBL2|Q4VBL2_HUMAN|CCR2|NM_000648|NP_000639|chemok
        ine (C-C motif) receptor 2 isoform B

          Length = 360

 Score =  119 bits (296), Expect = 8e-027
 Identities = 79/259 (30%), Positives = 117/259 (45%), Gaps = 7/259 (2%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           ..|             | |      |  |.||  .|||      .    | | .  ...|
Sbjct:  78 DIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTID 137

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           ||||||||| .|. .      .|    |.| .  | | ..| |     .|  .   .   
Sbjct: 138 RYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIF-TKCQKEDSVYVCGPYFPR 196

Query: 157 GIHANNWALTMRVLEHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVF 216
           |   ||.   || .  .   ||| ||  ||. .. |||.                   |.
Sbjct: 197 G--WNNFHTIMRNI--LGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVY 252

Query: 217 CVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGV 276
            . | |||.  .| |          .|||   |  |  ||..|| .|||.|| .||||| 
Sbjct: 253 FLFWTPYNIVILLNTFQEFF--GLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGE 310

Query: 277 RFRRELLRLLSKAGCGRVC 295
           .||| |     |    | |
Sbjct: 311 KFRRYLSVFFRKHITKRFC 329

>hg18||uc003cpo
        |3|NM_000579|P51681|CCR5_HUMAN|CCR5|NM_000579|NP_000570|chemokine (C-C
        motif) receptor 5

          Length = 352

 Score =  118 bits (294), Expect = 1e-026
 Identities = 76/263 (28%), Positives = 116/263 (44%), Gaps = 11/263 (4%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           ..|             | ||     |  | ||  .|.|.     .    | | .  ...|
Sbjct:  66 DIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTID 125

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCS---- 152
           ||||.|||| .|. .      .|    |.| .  | | ..|            .||    
Sbjct: 126 RYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIF--TRSQKEGLHYTCSSHFP 183

Query: 153 FDDYGIHANNWALTMRVLEHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXX 212
           .  |    |   | . .|  |   ||| .|  ||. .. |||.                 
Sbjct: 184 YSQYQFWKNFQTLKIVILGLV---LPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI 240

Query: 213 XXVFCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYA 272
             |. . | |||.  .| |          .| |   |  |. ||..|| .|||.|| .||
Sbjct: 241 MIVYFLFWAPYNIVLLLNTFQEFF--GLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYA 298

Query: 273 FVGVRFRRELLRLLSKAGCGRVC 295
           ||| .||  ||    |    | |
Sbjct: 299 FVGEKFRNYLLVFFQKHIAKRFC 321

>hg18||uc003fzp
        |3_random|NM_000579|P51681|CCR5_HUMAN|CCR5|NM_000579|NP_000570|chemokin
        e (C-C motif) receptor 5

          Length = 352

 Score =  118 bits (294), Expect = 1e-026
 Identities = 76/263 (28%), Positives = 116/263 (44%), Gaps = 11/263 (4%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           ..|             | ||     |  | ||  .|.|.     .    | | .  ...|
Sbjct:  66 DIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTID 125

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCS---- 152
           ||||.|||| .|. .      .|    |.| .  | | ..|            .||    
Sbjct: 126 RYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIF--TRSQKEGLHYTCSSHFP 183

Query: 153 FDDYGIHANNWALTMRVLEHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXX 212
           .  |    |   | . .|  |   ||| .|  ||. .. |||.                 
Sbjct: 184 YSQYQFWKNFQTLKIVILGLV---LPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI 240

Query: 213 XXVFCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYA 272
             |. . | |||.  .| |          .| |   |  |. ||..|| .|||.|| .||
Sbjct: 241 MIVYFLFWAPYNIVLLLNTFQEFF--GLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYA 298

Query: 273 FVGVRFRRELLRLLSKAGCGRVC 295
           ||| .||  ||    |    | |
Sbjct: 299 FVGEKFRNYLLVFFQKHIAKRFC 321

>hg18||uc002tuy
        |2|NM_001008540|P61073-2|P61073-2|CXCR4|NM_001008540|NP_001008540|chemo
        kine (C-X-C motif) receptor 4 isoform a

          Length = 356

 Score =  117 bits (292), Expect = 2e-026
 Identities = 75/265 (28%), Positives = 123/265 (46%), Gaps = 10/265 (3%)

Query:  53 TFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQR 112
           | ||  ..    | || |||| | .   .||     .|| ||.|||||||||  | . ..
Sbjct:  94 TLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRK 153

Query: 113 RRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLEH 172
                .    .|.  | .. |. .|  |. .|.   .   |     . |.  . .   .|
Sbjct: 154 LLAEKVVYVGVWIPALLLTIPDFIFANVS-EADDRYICDRF-----YPNDLWVVVFQFQH 207

Query: 173 VC--FFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQ 230
           .     ||  .. |||  ..  |  | .|                |  ||||| .   . 
Sbjct: 208 IMVGLILPGIVILSCYCIIISKLSHS-KGHQKRKALKTTVILILAFFACWLPYYIGISID 266

Query: 231 TRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSKAG 290
           .   |     . ||    .   . .|..| | |||||| ||||.| .|.      |.   
Sbjct: 267 SFILLEI-IKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVS 325

Query: 291 CGRVCPPLSGVQNGTSCSEATSTST 315
            |     ||  . |   | .| . .
Sbjct: 326 RGSSLKILSKGKRGGHSSVSTESES 350

>hg18||uc002tuz
        |2|NM_003467|P61073|CXCR4_HUMAN|CXCR4|NM_003467|NP_003458|chemokine
        (C-X-C motif) receptor 4 isoform b

          Length = 352

 Score =  117 bits (292), Expect = 2e-026
 Identities = 75/265 (28%), Positives = 123/265 (46%), Gaps = 10/265 (3%)

Query:  53 TFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQR 112
           | ||  ..    | || |||| | .   .||     .|| ||.|||||||||  | . ..
Sbjct:  90 TLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRK 149

Query: 113 RRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLEH 172
                .    .|.  | .. |. .|  |. .|.   .   |     . |.  . .   .|
Sbjct: 150 LLAEKVVYVGVWIPALLLTIPDFIFANVS-EADDRYICDRF-----YPNDLWVVVFQFQH 203

Query: 173 VC--FFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQ 230
           .     ||  .. |||  ..  |  | .|                |  ||||| .   . 
Sbjct: 204 IMVGLILPGIVILSCYCIIISKLSHS-KGHQKRKALKTTVILILAFFACWLPYYIGISID 262

Query: 231 TRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSKAG 290
           .   |     . ||    .   . .|..| | |||||| ||||.| .|.      |.   
Sbjct: 263 SFILLEI-IKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVS 321

Query: 291 CGRVCPPLSGVQNGTSCSEATSTST 315
            |     ||  . |   | .| . .
Sbjct: 322 RGSSLKILSKGKRGGHSSVSTESES 346

>hg18||uc003cfg
        |3|NM_005508|P51679|CCR4_HUMAN|CCR4|NM_005508|NP_005499|chemokine (C-C
        motif) receptor 4

          Length = 360

 Score =  116 bits (290), Expect = 4e-026
 Identities = 81/289 (28%), Positives = 131/289 (45%), Gaps = 10/289 (3%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           .||             . ||     |  |.||  |||..     .    | | .  .|.|
Sbjct:  75 DVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSID 134

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           ||||||||| ||. .      .|  | | | .  | |  .| |   . | .        |
Sbjct: 135 RYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTK---Y 191

Query: 157 GIHANNW-ALTMRVLEHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXV 215
            ...  |  |.   .  .   .|| ||  ||. .. | |.  .                .
Sbjct: 192 SLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRT-LQHCKNEKKNKAVKMIFAVVVL 250

Query: 216 FCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVG 275
           |   | |||.   |.|   |  .  . |     |  |.  |..| | |||||| .| |.|
Sbjct: 251 FLGFWTPYNIVLFLETLVEL--EVLQDCTFERYLDYAIQATETLAFVHCCLNPIIYFFLG 308

Query: 276 VRFRRELLRLLSKA-GCGRVCP--PLSGVQNGTSCSEATSTSTVRHRLY 321
            .||. .|.|     |   .|    |  . .  . | . . ||. | |.
Sbjct: 309 EKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLH 357

>hg18||uc002iax |17|NM_016602|Q4V749|Q4V749_HUMAN|CCR10|NM_016602|NP_057686|CC
        chemokine receptor 10

          Length = 362

 Score =  115 bits (287), Expect = 9e-026
 Identities = 84/268 (31%), Positives = 120/268 (44%), Gaps = 7/268 (2%)

Query:  53 TFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAV-ASLQRQ 111
           | ||.      ||  |   |. .      .   |   ||||| |||.||  |. |  .  
Sbjct:  94 TLPFAAAGALQGWSLGSATCRTISGLYSASFHAGFLFLACISADRYVAIARALPAGPRPS 153

Query: 112 RRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLE 171
                ||    .|.. | .. | |.| .  |     |        |.       .     
Sbjct: 154 TPGRAHLVSVIVWLLSLLLALPALLF-SQDGQREGQRRCRLIFPEGLTQTVKGASAVAQV 212

Query: 172 HVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQT 231
            . | ||| .| .|| |..|  | .|||                | |  |||..| .| |
Sbjct: 213 ALGFALPLGVMVACY-ALLGRTLLAARGPERRRALRVVVALVAAFVVLQLPYSLALLLDT 271

Query: 232 RDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSKAGC 291
            | |.    ||| .      ||.||  |  . | ||| ||||.|.|||..| |||     
Sbjct: 272 ADLLAA-RERSCPASKRKDVALLVTSGLALARCGLNPVLYAFLGLRFRQDLRRLLRGGSS 330

Query: 292 GRVCPPLSGVQNG---TSCSEATSTSTV 316
                |  |       .|||  | | ..
Sbjct: 331 PSGPQPRRGCPRRPRLSSCSAPTETHSL 358

>hg18||uc003cpn
        |3|NM_000647|P41597|CCR2_HUMAN|CCR2|NM_000647|NP_000638|chemokine (C-C
        motif) receptor 2 isoform A

          Length = 374

 Score =  115 bits (286), Expect = 1e-025
 Identities = 74/243 (30%), Positives = 112/243 (46%), Gaps = 7/243 (2%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           ..|             | |      |  |.||  .|||      .    | | .  ...|
Sbjct:  78 DIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTID 137

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           ||||||||| .|. .      .|    |.| .  | | ..| |     .|  .   .   
Sbjct: 138 RYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIF-TKCQKEDSVYVCGPYFPR 196

Query: 157 GIHANNWALTMRVLEHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVF 216
           |   ||.   || .  .   ||| ||  ||. .. |||.                   |.
Sbjct: 197 G--WNNFHTIMRNI--LGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVY 252

Query: 217 CVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGV 276
            . | |||.  .| |          .|||   |  |  ||..|| .|||.|| .||||| 
Sbjct: 253 FLFWTPYNIVILLNTFQEFF--GLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGE 310

Query: 277 RFR 279
           .||
Sbjct: 311 KFR 313

>hg18||uc003fzo
        |3_random|NM_000647|P41597|CCR2_HUMAN|CCR2|NM_000647|NP_000638|chemokin
        e (C-C motif) receptor 2 isoform A

          Length = 374

 Score =  115 bits (286), Expect = 1e-025
 Identities = 74/243 (30%), Positives = 112/243 (46%), Gaps = 7/243 (2%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           ..|             | |      |  |.||  .|||      .    | | .  ...|
Sbjct:  78 DIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTID 137

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           ||||||||| .|. .      .|    |.| .  | | ..| |     .|  .   .   
Sbjct: 138 RYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIF-TKCQKEDSVYVCGPYFPR 196

Query: 157 GIHANNWALTMRVLEHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVF 216
           |   ||.   || .  .   ||| ||  ||. .. |||.                   |.
Sbjct: 197 G--WNNFHTIMRNI--LGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVY 252

Query: 217 CVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGV 276
            . | |||.  .| |          .|||   |  |  ||..|| .|||.|| .||||| 
Sbjct: 253 FLFWTPYNIVILLNTFQEFF--GLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGE 310

Query: 277 RFR 279
           .||
Sbjct: 311 KFR 313

>hg18||uc003cpg |3|BC033514|P51677|CCR3_HUMAN|CCR3|NM_178329|NP_847899|CC
        chemokine receptor 3

          Length = 355

 Score =  114 bits (285), Expect = 1e-025
 Identities = 76/266 (28%), Positives = 122/266 (45%), Gaps = 10/266 (3%)

Query:  53 TFPFSI-LENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQ 111
           | || |       |.||  .|||.       |    | .  ...|||||||||| .|. .
Sbjct:  86 TLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSEIFFIILLTIDRYLAIVHAVFALRAR 145

Query: 112 RRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLE 171
                 .|    | . .  . |  .|         .  |  . .  ...     |.| . 
Sbjct: 146 TVTFGVITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLR-MT 204

Query: 172 HVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQT 231
             |  ||| .|  ||  .. |||.                   || . | ||||| .| .
Sbjct: 205 IFCLVLPLLVMAICYTGIIKTLLR-CPSKKKYKAIRLIFVIMAVFFIFWTPYNVAILLSS 263

Query: 232 RDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSK--- 288
             ..       ||    |   ..||. . .||||.|| .||||| |||. |     .   
Sbjct: 264 YQSILF--GNDCERSKHLDLVMLVTEVIAYSHCCMNPVIYAFVGERFRKYLRHFFHRHLL 321

Query: 289 AGCGRVCP--PLSGVQNGTSCSEATS 312
              ||  |  |   ..  .| | .|.
Sbjct: 322 MHLGRYIPFLPSEKLERTSSVSPSTA 347

>hg18||uc003cpi |3|NM_001837|P51677|CCR3_HUMAN|CCR3|NM_001837|NP_001828|CC
        chemokine receptor 3

          Length = 355

 Score =  114 bits (285), Expect = 1e-025
 Identities = 76/266 (28%), Positives = 122/266 (45%), Gaps = 10/266 (3%)

Query:  53 TFPFSI-LENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQ 111
           | || |       |.||  .|||.       |    | .  ...|||||||||| .|. .
Sbjct:  86 TLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSEIFFIILLTIDRYLAIVHAVFALRAR 145

Query: 112 RRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLE 171
                 .|    | . .  . |  .|         .  |  . .  ...     |.| . 
Sbjct: 146 TVTFGVITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLR-MT 204

Query: 172 HVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQT 231
             |  ||| .|  ||  .. |||.                   || . | ||||| .| .
Sbjct: 205 IFCLVLPLLVMAICYTGIIKTLLR-CPSKKKYKAIRLIFVIMAVFFIFWTPYNVAILLSS 263

Query: 232 RDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSK--- 288
             ..       ||    |   ..||. . .||||.|| .||||| |||. |     .   
Sbjct: 264 YQSILF--GNDCERSKHLDLVMLVTEVIAYSHCCMNPVIYAFVGERFRKYLRHFFHRHLL 321

Query: 289 AGCGRVCP--PLSGVQNGTSCSEATS 312
              ||  |  |   ..  .| | .|.
Sbjct: 322 MHLGRYIPFLPSEKLERTSSVSPSTA 347

>hg18||uc003cpj |3|NM_178329|P51677|CCR3_HUMAN|CCR3|NM_178329|NP_847899|CC
        chemokine receptor 3

          Length = 355

 Score =  114 bits (285), Expect = 1e-025
 Identities = 76/266 (28%), Positives = 122/266 (45%), Gaps = 10/266 (3%)

Query:  53 TFPFSI-LENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQ 111
           | || |       |.||  .|||.       |    | .  ...|||||||||| .|. .
Sbjct:  86 TLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSEIFFIILLTIDRYLAIVHAVFALRAR 145

Query: 112 RRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLE 171
                 .|    | . .  . |  .|         .  |  . .  ...     |.| . 
Sbjct: 146 TVTFGVITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLR-MT 204

Query: 172 HVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQT 231
             |  ||| .|  ||  .. |||.                   || . | ||||| .| .
Sbjct: 205 IFCLVLPLLVMAICYTGIIKTLLR-CPSKKKYKAIRLIFVIMAVFFIFWTPYNVAILLSS 263

Query: 232 RDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSK--- 288
             ..       ||    |   ..||. . .||||.|| .||||| |||. |     .   
Sbjct: 264 YQSILF--GNDCERSKHLDLVMLVTEVIAYSHCCMNPVIYAFVGERFRKYLRHFFHRHLL 321

Query: 289 AGCGRVCP--PLSGVQNGTSCSEATS 312
              ||  |  |   ..  .| | .|.
Sbjct: 322 MHLGRYIPFLPSEKLERTSSVSPSTA 347

>hg18||uc003cpk |3|AF262301|Q2YDB9|Q2YDB9_HUMAN|CCR3|NM_178329|NP_847899|CC
        chemokine receptor 3

          Length = 376

 Score =  114 bits (285), Expect = 1e-025
 Identities = 76/266 (28%), Positives = 122/266 (45%), Gaps = 10/266 (3%)

Query:  53 TFPFSI-LENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQ 111
           | || |       |.||  .|||.       |    | .  ...|||||||||| .|. .
Sbjct: 107 TLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSEIFFIILLTIDRYLAIVHAVFALRAR 166

Query: 112 RRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLE 171
                 .|    | . .  . |  .|         .  |  . .  ...     |.| . 
Sbjct: 167 TVTFGVITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLR-MT 225

Query: 172 HVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQT 231
             |  ||| .|  ||  .. |||.                   || . | ||||| .| .
Sbjct: 226 IFCLVLPLLVMAICYTGIIKTLLR-CPSKKKYKAIRLIFVIMAVFFIFWTPYNVAILLSS 284

Query: 232 RDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSK--- 288
             ..       ||    |   ..||. . .||||.|| .||||| |||. |     .   
Sbjct: 285 YQSILF--GNDCERSKHLDLVMLVTEVIAYSHCCMNPVIYAFVGERFRKYLRHFFHRHLL 342

Query: 289 AGCGRVCP--PLSGVQNGTSCSEATS 312
              ||  |  |   ..  .| | .|.
Sbjct: 343 MHLGRYIPFLPSEKLERTSSVSPSTA 368

>hg18||uc003cpl |3|AF262300|Q2YDB9|Q2YDB9_HUMAN|CCR3|NM_178329|NP_847899|CC
        chemokine receptor 3

          Length = 388

 Score =  114 bits (285), Expect = 1e-025
 Identities = 76/266 (28%), Positives = 122/266 (45%), Gaps = 10/266 (3%)

Query:  53 TFPFSI-LENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQ 111
           | || |       |.||  .|||.       |    | .  ...|||||||||| .|. .
Sbjct: 119 TLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSEIFFIILLTIDRYLAIVHAVFALRAR 178

Query: 112 RRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLE 171
                 .|    | . .  . |  .|         .  |  . .  ...     |.| . 
Sbjct: 179 TVTFGVITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLR-MT 237

Query: 172 HVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQT 231
             |  ||| .|  ||  .. |||.                   || . | ||||| .| .
Sbjct: 238 IFCLVLPLLVMAICYTGIIKTLLR-CPSKKKYKAIRLIFVIMAVFFIFWTPYNVAILLSS 296

Query: 232 RDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSK--- 288
             ..       ||    |   ..||. . .||||.|| .||||| |||. |     .   
Sbjct: 297 YQSILF--GNDCERSKHLDLVMLVTEVIAYSHCCMNPVIYAFVGERFRKYLRHFFHRHLL 354

Query: 289 AGCGRVCP--PLSGVQNGTSCSEATS 312
              ||  |  |   ..  .| | .|.
Sbjct: 355 MHLGRYIPFLPSEKLERTSSVSPSTA 380

>hg18||uc003eow
        |3|NM_016557|Q9NPB9|CCRL1_HUMAN|CCRL1|NM_016557|NP_057641|chemokine
        (C-C motif) receptor-like 1

          Length = 350

 Score =  114 bits (283), Expect = 2e-025
 Identities = 76/257 (29%), Positives = 112/257 (43%), Gaps = 8/257 (3%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           .||             | ||  .    ||. |. .||.      || . |   |||||.|
Sbjct:  77 DVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKIMCKITSALYTLNFVSGMQFLACISID 136

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           ||.|.    .  |    .   . |  .||  . .| | ||| ||  .|   |    |  |
Sbjct: 137 RYVAVTKVPS--QSGVGKPCWIICFCVWMAAILLSIPQLVFYTVNDNA---RCIPIFPRY 191

Query: 157 GIHANNWALTMRVLEHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVF 216
            .  .  ||   .   . | .|  ||| ||     ||.|                   ||
Sbjct: 192 -LGTSMKALIQMLEICIGFVVPFLIMGVCYFITARTLMKMP-NIKISRPLKVLLTVVIVF 249

Query: 217 CVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGV 276
            |  ||||.    .  | .      ||     .  |. ||.|.   | |||| || |.| 
Sbjct: 250 IVTQLPYNIVKFCRAID-IIYSLITSCNMSKRMDIAIQVTESIALFHSCLNPILYVFMGA 308

Query: 277 RFRRELLRLLSKAGCGR 293
            |.  ....  | |  |
Sbjct: 309 SFKNYVMKVAKKYGSWR 325

>hg18||uc003eox
        |3|NM_178445|Q9NPB9|CCRL1_HUMAN|CCRL1|NM_178445|NP_848540|chemokine
        (C-C motif) receptor-like 1

          Length = 350

 Score =  114 bits (283), Expect = 2e-025
 Identities = 76/257 (29%), Positives = 112/257 (43%), Gaps = 8/257 (3%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           .||             | ||  .    ||. |. .||.      || . |   |||||.|
Sbjct:  77 DVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKIMCKITSALYTLNFVSGMQFLACISID 136

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           ||.|.    .  |    .   . |  .||  . .| | ||| ||  .|   |    |  |
Sbjct: 137 RYVAVTKVPS--QSGVGKPCWIICFCVWMAAILLSIPQLVFYTVNDNA---RCIPIFPRY 191

Query: 157 GIHANNWALTMRVLEHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVF 216
            .  .  ||   .   . | .|  ||| ||     ||.|                   ||
Sbjct: 192 -LGTSMKALIQMLEICIGFVVPFLIMGVCYFITARTLMKMP-NIKISRPLKVLLTVVIVF 249

Query: 217 CVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGV 276
            |  ||||.    .  | .      ||     .  |. ||.|.   | |||| || |.| 
Sbjct: 250 IVTQLPYNIVKFCRAID-IIYSLITSCNMSKRMDIAIQVTESIALFHSCLNPILYVFMGA 308

Query: 277 RFRRELLRLLSKAGCGR 293
            |.  ....  | |  |
Sbjct: 309 SFKNYVMKVAKKYGSWR 325

>hg18||uc002vwc
        |2|NM_001047841|P25106|CXCR7_HUMAN|CXCR7|NM_001047841|NP_001041306|chem
        okine orphan receptor 1

          Length = 362

 Score =  110 bits (273), Expect = 4e-024
 Identities = 69/223 (30%), Positives = 109/223 (48%), Gaps = 7/223 (3%)

Query:  65 WIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRRRTVHLTCTALW 124
           |  ||  ||.  |   .||    | | |.||||||.| .   .   ...    . |  .|
Sbjct: 110 WPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVW 169

Query: 125 MVCLAISAPNLVFL-TVTGDANSSRLSCSFDDYGIHA-NNWALTMRVLEHVC-FFLPLAI 181
           ..   .| |.  .| |||  .|.     ||  |  |.   | . | ..  |  | .| .|
Sbjct: 170 LLAFCVSLPDTYYLKTVTSASNNETYCRSF--YPEHSIKEWLIGMELVSVVLGFAVPFSI 227

Query: 182 MGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQTRDNLSTDPSR 241
           .   |  ..   . ..                 || ||||||.|| .|     |   |  
Sbjct: 228 IAVFY-FLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPF- 285

Query: 242 SCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLR 284
           .|     |  || ||. |   |||.|| ||.|.   .| ||..
Sbjct: 286 TCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMK 328

>hg18||uc002vwd
        |2|NM_020311|P25106|CXCR7_HUMAN|CXCR7|NM_020311|NP_064707|chemokine
        orphan receptor 1

          Length = 362

 Score =  110 bits (273), Expect = 4e-024
 Identities = 69/223 (30%), Positives = 109/223 (48%), Gaps = 7/223 (3%)

Query:  65 WIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRRRTVHLTCTALW 124
           |  ||  ||.  |   .||    | | |.||||||.| .   .   ...    . |  .|
Sbjct: 110 WPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVW 169

Query: 125 MVCLAISAPNLVFL-TVTGDANSSRLSCSFDDYGIHA-NNWALTMRVLEHVC-FFLPLAI 181
           ..   .| |.  .| |||  .|.     ||  |  |.   | . | ..  |  | .| .|
Sbjct: 170 LLAFCVSLPDTYYLKTVTSASNNETYCRSF--YPEHSIKEWLIGMELVSVVLGFAVPFSI 227

Query: 182 MGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQTRDNLSTDPSR 241
           .   |  ..   . ..                 || ||||||.|| .|     |   |  
Sbjct: 228 IAVFY-FLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPF- 285

Query: 242 SCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLR 284
           .|     |  || ||. |   |||.|| ||.|.   .| ||..
Sbjct: 286 TCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMK 328

>hg18||uc003cjn
        |3|NM_005201|P51685|CCR8_HUMAN|CCR8|NM_005201|NP_005192|chemokine (C-C
        motif) receptor 8

          Length = 355

 Score =  107 bits (267), Expect = 2e-023
 Identities = 73/277 (26%), Positives = 119/277 (42%), Gaps = 8/277 (2%)

Query:  37 EVYXXXXXXXXXXXXATFPFSILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVD 96
           .||             .|||        |.||  .||.|     .      | .  .|||
Sbjct:  71 DVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVD 130

Query:  97 RYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDY 156
           ||||.|||| .|. .  |     | |.|.  .  . | |||  |  .     | | .  |
Sbjct: 131 RYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASE--DGVLQC-YSFY 187

Query: 157 GIHANNWAL-TMRVLEHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXV 215
                 | . |   .  .   .|  |   ||  ..   ||  .                 
Sbjct: 188 NQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQ-LKRCQNHNKTKAIRLVLIVVIA 246

Query: 216 FCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVG 275
             . |.|.||   | .  ..       |     |  |  ||. . |.|||.|| .|||||
Sbjct: 247 SLLFWVPFNVVLFLTSLHSMHI--LDGCSISQQLTYATHVTEIISFTHCCVNPVIYAFVG 304

Query: 276 VRFRRELLRLLSKAGCGRVCPPLSGVQNGTSCSEATS 312
            .|.. |  .  |. | ..   |       || ...|
Sbjct: 305 EKFKKHLSEIFQKS-CSQIFNYLGRQMPRESCEKSSS 340

>hg18||uc003cph
        |3|NM_001295|P32246|CCR1_HUMAN|CCR1|NM_001295|NP_001286|chemokine (C-C
        motif) receptor 1

          Length = 355

 Score =  105 bits (260), Expect = 1e-022
 Identities = 70/239 (29%), Positives = 110/239 (46%), Gaps = 9/239 (3%)

Query:  53 TFPFSI-LENATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQ 111
           | || |  .    |.||. .||..       |    | .  ...|||||||||| .|. .
Sbjct:  86 TLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSEIFFIILLTIDRYLAIVHAVFALRAR 145

Query: 112 RRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRV-L 170
                 .|   .| . .  | | | |     .      |  |    .    | |   . |
Sbjct: 146 TVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESL--REWKLFQALKL 203

Query: 171 EHVCFFLPLAIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQ 230
                 ||| .|  ||  ..  ||.                   .| . | |||.  .. 
Sbjct: 204 NLFGLVLPLLVMIICYTGIIKILLRRP-NEKKSKAVRLIFVIMIIFFLFWTPYNLTILIS 262

Query: 231 T-RDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSK 288
             .| | |     ||    |  |. ||. . ..|||.|| .||||| |||. | .|  .
Sbjct: 263 VFQDFLFT---HECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLFHR 318

>hg18||uc003cjl
        |3|NM_001337|P49238|CX3C1_HUMAN|CX3CR1|NM_001337|NP_001328|chemokine
        (C-X3-C motif) receptor 1

          Length = 355

 Score =  104 bits (257), Expect = 3e-022
 Identities = 84/297 (28%), Positives = 114/297 (38%), Gaps = 17/297 (5%)

Query:   3 FESLFYSCXXXXXXXXXXXXXXXXXXXXXXXXXXEVYXXXXXXXXXXXXATFPF--SILE 60
           | |.|||                           ..|            || ||    | 
Sbjct:  33 FLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLI 92

Query:  61 NATGWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRRRTVHLTC 120
           |  |      .||       .      | .  ||.||||||| |  |.  .  .      
Sbjct:  93 NEKG--LHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTIS 150

Query: 121 TALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRV-LEHVCFFLPL 179
             .|   . ..||  .|             |  |   .    | .   |    . | |||
Sbjct: 151 LGVWAAAILVAAPQFMF------TKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPL 204

Query: 180 AIMGSCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQTRDNLSTDP 239
            ||  ||  .. ||  | .                || . | ||||   |.|       |
Sbjct: 205 LIMSYCYFRIIQTLF-SCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFP 263

Query: 240 SRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSK---AGCGR 293
             ||.    |. || ||... |||||||| .||| | .||| |  |  |     |||
Sbjct: 264 --SCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGR 318

>hg18||uc003cjm |3|BC107152|Q3KNR3|Q3KNR3_HUMAN|CCR8|NA|NA|CCR8 protein

          Length = 272

 Score =  104 bits (257), Expect = 3e-022
 Identities = 68/249 (27%), Positives = 112/249 (44%), Gaps = 8/249 (3%)

Query:  65 WIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRRRTVHLTCTALW 124
           |.||  .||.|     .      | .  .|||||||.|||| .|. .  |     | |.|
Sbjct:  16 WVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVW 75

Query: 125 MVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWAL-TMRVLEHVCFFLPLAIMG 183
           .  .  . | |||  |  .     | | .  |      | . |   .  .   .|  |  
Sbjct:  76 LTAIMATIPLLVFYQVASE--DGVLQC-YSFYNQQTLKWKIFTNFKMNILGLLIPFTIFM 132

Query: 184 SCYAAVVGTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQTRDNLSTDPSRSC 243
            ||  ..   ||  .                   . |.|.||   | .  ..       |
Sbjct: 133 FCYIKILHQ-LKRCQNHNKTKAIRLVLIVVIASLLFWVPFNVVLFLTSLHSMHI--LDGC 189

Query: 244 ESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLLSKAGCGRVCPPLSGVQN 303
                |  |  ||. . |.|||.|| .||||| .|.. |  .  |. | ..   |     
Sbjct: 190 SISQQLTYATHVTEIISFTHCCVNPVIYAFVGEKFKKHLSEIFQKS-CSQIFNYLGRQMP 248

Query: 304 GTSCSEATS 312
             || ...|
Sbjct: 249 RESCEKSSS 257

>hg18||uc004eqh
        |X|NM_000686|P50052|AGTR2_HUMAN|AGTR2|NM_000686|NP_000677|angiotensin
        II receptor, type 2

          Length = 363

 Score =  100 bits (247), Expect = 4e-021
 Identities = 63/223 (28%), Positives = 106/223 (47%), Gaps = 8/223 (3%)

Query:  65 WIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRRRTVHLTCTALW 124
           |.||  .||. |    ||.    | . |.||||| ....   | .|   .  ..      
Sbjct: 110 WLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWC 169

Query: 125 MVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLEHVC-FFLPLAIMG 183
           | ||. | |   |  |         .|           |.  . .....  | .||  . 
Sbjct: 170 MACLS-SLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIA 228

Query: 184 SCYAAVVGTLLK-SARGXXXXXXXXXXXXXXXV---FCVCWLPYNVASVLQTRDNLSTDP 239
           .||  .   ||| .. |               |   | .||||..| . |     .    
Sbjct: 229 TCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGV-- 286

Query: 240 SRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRREL 282
             ||| . ..  ||     |||.. |.||||| ||| ||...|
Sbjct: 287 INSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKL 329

>hg18||uc001vcd
        |13|NM_005767|P43657|P2RY5_HUMAN|P2RY5|NM_005767|NP_005758|G-protein
        coupled purinergic receptor P2Y5

          Length = 344

 Score =  99 bits (246), Expect = 5e-021
 Identities = 65/228 (28%), Positives = 107/228 (46%), Gaps = 10/228 (4%)

Query:  53 TFPFSILENAT-GWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQ 111
           | || |    |  | ||. |||.  .    |.      | ||||||.||||.   |   .
Sbjct:  69 TLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLR 128

Query: 112 RRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRV-- 169
            .|   . || .|.  .  ||| .   .     |..  .| |...        |.  |  
Sbjct: 129 TKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEAC-FENFPEATWKTYLSRIVIF 187

Query: 170 LEHVCFFLPLAIMGSCYAAVVGTLLK----SARGXXXXXXXXXXXXXXXVFCVCWLPYNV 225
           .| | ||.|| .  .| . |. || |    |                  .|| |..|||.
Sbjct: 188 IEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNI 247

Query: 226 ASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAF 273
             .| .   . |    .|  |  ..    .|  .  |.|| .| .| |
Sbjct: 248 NLILYSL--VRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYF 293

>hg18||uc001vce
        |13|AK122856|P43657|P2RY5_HUMAN|P2RY5|NM_005767|NP_005758|G-protein
        coupled purinergic receptor P2Y5

          Length = 344

 Score =  99 bits (246), Expect = 5e-021
 Identities = 65/228 (28%), Positives = 107/228 (46%), Gaps = 10/228 (4%)

Query:  53 TFPFSILENAT-GWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQ 111
           | || |    |  | ||. |||.  .    |.      | ||||||.||||.   |   .
Sbjct:  69 TLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLR 128

Query: 112 RRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRV-- 169
            .|   . || .|.  .  ||| .   .     |..  .| |...        |.  |  
Sbjct: 129 TKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEAC-FENFPEATWKTYLSRIVIF 187

Query: 170 LEHVCFFLPLAIMGSCYAAVVGTLLK----SARGXXXXXXXXXXXXXXXVFCVCWLPYNV 225
           .| | ||.|| .  .| . |. || |    |                  .|| |..|||.
Sbjct: 188 IEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNI 247

Query: 226 ASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAF 273
             .| .   . |    .|  |  ..    .|  .  |.|| .| .| |
Sbjct: 248 NLILYSL--VRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYF 293

>hg18||uc001vcf
        |13|BC045651|P43657|P2RY5_HUMAN|P2RY5|NM_005767|NP_005758|G-protein
        coupled purinergic receptor P2Y5

          Length = 344

 Score =  99 bits (246), Expect = 5e-021
 Identities = 65/228 (28%), Positives = 107/228 (46%), Gaps = 10/228 (4%)

Query:  53 TFPFSILENAT-GWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQ 111
           | || |    |  | ||. |||.  .    |.      | ||||||.||||.   |   .
Sbjct:  69 TLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLR 128

Query: 112 RRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRV-- 169
            .|   . || .|.  .  ||| .   .     |..  .| |...        |.  |  
Sbjct: 129 TKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEAC-FENFPEATWKTYLSRIVIF 187

Query: 170 LEHVCFFLPLAIMGSCYAAVVGTLLK----SARGXXXXXXXXXXXXXXXVFCVCWLPYNV 225
           .| | ||.|| .  .| . |. || |    |                  .|| |..|||.
Sbjct: 188 IEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNI 247

Query: 226 ASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAF 273
             .| .   . |    .|  |  ..    .|  .  |.|| .| .| |
Sbjct: 248 NLILYSL--VRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYF 293

>hg18||uc003ewg
        |3|NM_031850|P30556|AGTR1_HUMAN|AGTR1|NM_031850|NP_114038|angiotensin
        II receptor, type 1

          Length = 359

 Score =  97 bits (239), Expect = 3e-020
 Identities = 61/227 (26%), Positives = 103/227 (45%), Gaps = 8/227 (3%)

Query:  65 WIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRRRTVHLTCTALW 124
           | || .|||.   .   ||    ||| |.|.|||||||| . |  |.      .||  .|
Sbjct:  94 WPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIW 153

Query: 125 MVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLEHVCFFL-PLAIMG 183
           ..    | | ..   |    |..   |.|  |    .   . . . ...  || |  |. 
Sbjct: 154 LLAGLASLPAIIHRNVFFIENTNITVCAF-HYESQNSTLPIGLGLTKNILGFLFPFLIIL 212

Query: 184 SCYAAVVGTLLKS----ARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQTRDNLSTDP 239
           . |  .   | |.                       |   |.|. . . |     |    
Sbjct: 213 TSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGI-- 270

Query: 240 SRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLL 286
            | |    ..  |. .|  . . . ||||  | |.| .|.|  |.||
Sbjct: 271 IRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLL 317

>hg18||uc003ewh
        |3|NM_004835|P30556|AGTR1_HUMAN|AGTR1|NM_004835|NP_004826|angiotensin
        II receptor, type 1

          Length = 359

 Score =  97 bits (239), Expect = 3e-020
 Identities = 61/227 (26%), Positives = 103/227 (45%), Gaps = 8/227 (3%)

Query:  65 WIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRRRTVHLTCTALW 124
           | || .|||.   .   ||    ||| |.|.|||||||| . |  |.      .||  .|
Sbjct:  94 WPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIW 153

Query: 125 MVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLEHVCFFL-PLAIMG 183
           ..    | | ..   |    |..   |.|  |    .   . . . ...  || |  |. 
Sbjct: 154 LLAGLASLPAIIHRNVFFIENTNITVCAF-HYESQNSTLPIGLGLTKNILGFLFPFLIIL 212

Query: 184 SCYAAVVGTLLKS----ARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQTRDNLSTDP 239
           . |  .   | |.                       |   |.|. . . |     |    
Sbjct: 213 TSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGI-- 270

Query: 240 SRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLL 286
            | |    ..  |. .|  . . . ||||  | |.| .|.|  |.||
Sbjct: 271 IRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLL 317

>hg18||uc003ewi
        |3|NM_000685|P30556|AGTR1_HUMAN|AGTR1|NM_000685|NP_000676|angiotensin
        II receptor, type 1

          Length = 359

 Score =  97 bits (239), Expect = 3e-020
 Identities = 61/227 (26%), Positives = 103/227 (45%), Gaps = 8/227 (3%)

Query:  65 WIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRRRTVHLTCTALW 124
           | || .|||.   .   ||    ||| |.|.|||||||| . |  |.      .||  .|
Sbjct:  94 WPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIW 153

Query: 125 MVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLEHVCFFL-PLAIMG 183
           ..    | | ..   |    |..   |.|  |    .   . . . ...  || |  |. 
Sbjct: 154 LLAGLASLPAIIHRNVFFIENTNITVCAF-HYESQNSTLPIGLGLTKNILGFLFPFLIIL 212

Query: 184 SCYAAVVGTLLKS----ARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQTRDNLSTDP 239
           . |  .   | |.                       |   |.|. . . |     |    
Sbjct: 213 TSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGI-- 270

Query: 240 SRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLL 286
            | |    ..  |. .|  . . . ||||  | |.| .|.|  |.||
Sbjct: 271 IRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLL 317

>hg18||uc003ewj
        |3|NM_009585|P30556|AGTR1_HUMAN|AGTR1|NM_009585|NP_033611|angiotensin
        II receptor, type 1

          Length = 359

 Score =  97 bits (239), Expect = 3e-020
 Identities = 61/227 (26%), Positives = 103/227 (45%), Gaps = 8/227 (3%)

Query:  65 WIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRRRTVHLTCTALW 124
           | || .|||.   .   ||    ||| |.|.|||||||| . |  |.      .||  .|
Sbjct:  94 WPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIW 153

Query: 125 MVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLEHVCFFL-PLAIMG 183
           ..    | | ..   |    |..   |.|  |    .   . . . ...  || |  |. 
Sbjct: 154 LLAGLASLPAIIHRNVFFIENTNITVCAF-HYESQNSTLPIGLGLTKNILGFLFPFLIIL 212

Query: 184 SCYAAVVGTLLKS----ARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQTRDNLSTDP 239
           . |  .   | |.                       |   |.|. . . |     |    
Sbjct: 213 TSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGI-- 270

Query: 240 SRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLL 286
            | |    ..  |. .|  . . . ||||  | |.| .|.|  |.||
Sbjct: 271 IRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLL 317

>hg18||uc003ewk
        |3|NM_032049|P30556|AGTR1_HUMAN|AGTR1|NM_032049|NP_114438|angiotensin
        II receptor, type 1

          Length = 359

 Score =  97 bits (239), Expect = 3e-020
 Identities = 61/227 (26%), Positives = 103/227 (45%), Gaps = 8/227 (3%)

Query:  65 WIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRRRTVHLTCTALW 124
           | || .|||.   .   ||    ||| |.|.|||||||| . |  |.      .||  .|
Sbjct:  94 WPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIW 153

Query: 125 MVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMRVLEHVCFFL-PLAIMG 183
           ..    | | ..   |    |..   |.|  |    .   . . . ...  || |  |. 
Sbjct: 154 LLAGLASLPAIIHRNVFFIENTNITVCAF-HYESQNSTLPIGLGLTKNILGFLFPFLIIL 212

Query: 184 SCYAAVVGTLLKS----ARGXXXXXXXXXXXXXXXVFCVCWLPYNVASVLQTRDNLSTDP 239
           . |  .   | |.                       |   |.|. . . |     |    
Sbjct: 213 TSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGI-- 270

Query: 240 SRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRLL 286
            | |    ..  |. .|  . . . ||||  | |.| .|.|  |.||
Sbjct: 271 IRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLL 317

>hg18||uc001yfg
        |14|NM_000623|P30411|BKRB2_HUMAN|BDKRB2|NM_000623|NP_000614|bradykinin
        receptor B2

          Length = 391

 Score =  95 bits (235), Expect = 9e-020
 Identities = 69/269 (25%), Positives = 112/269 (41%), Gaps = 19/269 (7%)

Query:  37 EVYXXXXXXXXXXXXATFPF--SILENATGWIFGEFLCKLVGLARQLNLLCGSFLLACIS 94
           |.|               ||    . |   |.||| ||..|     .||      |  .|
Sbjct:  93 EIYLGNLAAADLILACGLPFWAITISNNFDWLFGETLCRVVNAIISMNLYSSICFLMLVS 152

Query:  95 VDRYLAIVHAVASLQRQRRRTVHLTCTALWMVCLAISAPNLVFLTVT--GDANSSRLSCS 152
           .|||||.|  ..  . .  |   |    .|   | .|.| ||| |.    |   .  .| 
Sbjct: 153 IDRYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLVFRTMKEYSDEGHNVTACV 212

Query: 153 FDDYGIHANNW-ALTMRVLEHVCFFLPLAIMGSCYAAVVGTL-----LKSARGXXXXXXX 206
                .    |   |  .|  | | |||...  |   ..  |      |           
Sbjct: 213 ISYPSL---IWEVFTNMLLNVVGFLLPLSVITFCTMQIMQVLRNNEMQKFKEIQTERRAT 269

Query: 207 XXXXXXXXVFCVCWLPYNVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCL 266
                   .| .||||. ... | |   |      ||.   ..     .   . .|. ||
Sbjct: 270 VLVLVVLLLFIICWLPFQISTFLDTLHRLGI--LSSCQDERIIDVITQIASFMAYSNSCL 327

Query: 267 NPFLYAFVGVRFRRELLR----LLSKAGC 291
           || .|  || |||..       .  | ||
Sbjct: 328 NPLVYVIVGKRFRKKSWEVYQGVCQKGGC 356

>hg18||uc002ckq
        |16|NM_001053|P35346|SSR5_HUMAN|SSTR5|NM_001053|NP_001044|somatostatin
        receptor 5

          Length = 364

 Score =  92 bits (227), Expect = 8e-019
 Identities = 71/241 (29%), Positives = 108/241 (44%), Gaps = 24/241 (9%)

Query:  55 PFSILENATG-WIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQRR 113
           ||   .||   | ||  ||.||     .|     | |  .|||||||.|| ..| . .| 
Sbjct:  94 PFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRP 153

Query: 114 RTVHLTCTALWMVCLAISAPNLVFLTVT--GDANSSRLSCSFDDYGIHANNWALTMRVLE 171
           |   |   | |.. | .| | |||  |   |  |.|      .  |.    . .   || 
Sbjct: 154 RVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWP----EPVGLWGAVFIIYTAVLG 209

Query: 172 HVCFFLPLAIMGSCYAAVV------GTLLKSARGXXXXXXXXXXXXXXXVFCVCWLPYNV 225
              || || ..  ||  .|      |  .   |                ||  ||||.  
Sbjct: 210 ---FFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFT 266

Query: 226 ASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRRELLRL 285
            ...     |  .|. .      |   .|.   | ... | || || |.   ||.   ..
Sbjct: 267 VNIVNLAVALPQEPASAG-----LYFFVVI---LSYANSCANPVLYGFLSDNFRQSFQKV 318

Query: 286 L 286
           |
Sbjct: 319 L 319

>hg18||uc004edd |X|NM_005296|Q99677|P2RY9_HUMAN|GPR23|NM_005296|NP_005287|G
        protein-coupled receptor 23

          Length = 370

 Score =  92 bits (227), Expect = 8e-019
 Identities = 71/237 (29%), Positives = 106/237 (44%), Gaps = 16/237 (6%)

Query:  53 TFPFSILENAT-GWIFGEFLCKLVGLARQLNLLCGSFLLACISVDRYLAIVHAVASLQRQ 111
           | || |  |    | ||. |||. | |   |.      | ||||||.||||.   |   .
Sbjct:  91 TLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIR 150

Query: 112 RRRTVHLTCTALWMVCLAISAPNLVFLTVTGDANSSRLSCSFDDYGIHANNWALTMR--- 168
            ||   . |  .|.. |.      .| |   . |..  .| |.  |     |   .    
Sbjct: 151 TRRNSAIVCAGVWILVLSGGISASLFSTT--NVNNATTTC-FE--GFSKRVWKTYLSKIT 205

Query: 169 -VLEHVCFFLPLAIMGSCYAAVVGTLLKSAR----GXXXXXXXXXXXXXXXVFCVCWLPY 223
             .| | | .|| .  || . |. || | |     |               || ||..||
Sbjct: 206 IFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPY 265

Query: 224 NVASVLQTRDNLSTDPSRSCESVLLLQAALVVTKSLGFSHCCLNPFLYAFVGVRFRR 280
           |  |||     . .    .|      .    .|  |   .|| .||.| |    |..
Sbjct: 266 N--SVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQK 320

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0