BLASTP 7.6.0


Query=fugu4_572762 |jgi|Takru4|572762|e_gw2.78.88.1
        (660 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003qrc |6|NM_032861|Q96JX3|Q96JX3_HUMAN|SERAC1|NM_032861...    820   1e-237
hg18||uc003qrb |6|AK125878|NA|NA|SERAC1|NA|NA|Homo sapiens cDNA ...    538   1e-152

>hg18||uc003qrc
        |6|NM_032861|Q96JX3|Q96JX3_HUMAN|SERAC1|NM_032861|NP_116250|serine
        active site containing 1

          Length = 654

 Score =  820 bits (2118), Expect = 1e-237
 Identities = 390/652 (59%), Positives = 517/652 (79%), Gaps = 5/652 (0%)

Query:   2 SVAALRLIHCRRLSTAGTPGVRKALNWKTFRRFAKVTGAVVLGSYLFITYEVEYLNKAVT 61
           |.||  .| |||. |. .|  .   .|.  |   | ||...||  ||.||||  | ||||
Sbjct:   2 SLAAYCVICCRRIGTSTSP-PKSGTHWRDIRNIIKFTGSLILGGSLFLTYEVLALKKAVT 60

Query:  62 LDTRAILQEKYKSYIYLKPTPSDDQEDLAAELTYKARKELHKAARRFLEISSRLLLQSLD 121
           |||. . .|| |||||.     |  |.    . ..|||||||| |. |  |...|     
Sbjct:  61 LDTQVVEREKMKSYIYVHTVSLDKGENHG--IAWQARKELHKAVRKVLATSAKILRNPFA 118

Query: 122 EHFSHVDADPHEVALWVLLKRTQSPNKAIRLQAVQELAGNHHWRDYQYQTAAQVIDQRTA 181
           . || || . || |.|.||....| .|  ||.||.|..  ||| ||||.  ||  | .| 
Sbjct: 119 DPFSTVDIEDHECAVWLLLRKSKSDDKTTRLEAVREMSETHHWHDYQYRIIAQACDPKTL 178

Query: 182 VGLARTPRVDLRFFLRTPSLPDLEDGLSAEDELRQLLASLPQSEVDKCVQYFTSLALRES 241
           .||||.   ||||||  | || |..  | |.|||||||||||.|.|.|.|||||||| ||
Sbjct: 179 IGLARSEESDLRFFLLPPPLPSLKEDSSTEEELRQLLASLPQTELDECIQYFTSLALSES 238

Query: 242 TQALAAQRGGLWCFGGNGLPYAQSLTSVPSQKVESFCLQALVQHSKVQSHCDHIVANGGV 301
           .|.||||.||||||||||||||.|   |||  || |||.|.|.||.. .||| | ||||.
Sbjct: 239 SQSLAAQKGGLWCFGGNGLPYAESFGEVPSATVEMFCLEAIVKHSEISTHCDKIEANGGL 298

Query: 302 QLLQRMYQLRKDSLKIQRNIVRIIGNLALNESIHQAIAQSGWVSVLAEMMQSPHIMQASH 361
           |||||.|.| ||  |.||||.|.|||.|||| .| .| .|||||..|| |.|||||..||
Sbjct: 299 QLLQRLYRLHKDCPKVQRNIMRVIGNMALNEHLHSSIVRSGWVSIMAEAMKSPHIMESSH 358

Query: 362 AARALANLDREAVNEKYQDGIYILHPQTRSNQPIKADVLFIHGILGAAFKTWRQKDRVTS 421
           ||| ||||||| | ||||||.|.|||| |..||||||||||||..|||||||||.|   .
Sbjct: 359 AARILANLDRETVQEKYQDGVYVLHPQYRTSQPIKADVLFIHGLMGAAFKTWRQQDSEQA 418

Query: 422 EEKDETGSTENYTECWPKSWLAADCPNLRVLSVEYDSHLSDWMSKCPAENQRTSLAYRSQ 481
             .      . || ||||.||| ||| ||..|||||. |||| ..|| |  | |.|.|| 
Sbjct: 419 VIEKPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPME--RKSIAFRSN 476

Query: 482 ELLKKLKQAGIGDRPVIWVAHSMGGLLVKKILLDASMDPDMHGLLNNTKGMMFYSVPHHG 541
           |||.||. ||.|||||.|..||||||||||.||.||  |.|  ..|||.|..||||||||
Sbjct: 477 ELLRKLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMSTVINNTRGIIFYSVPHHG 536

Query: 542 TSMAEYSVNVRYLLFPSIEVRELCKDSPALRNLNENFLIMAKERQFKVLSFAETEPTNIG 601
           . .|||.||.|||||||.||.|| ||||||. | ..||  ||.. |.||.| || || ||
Sbjct: 537 SRLAEYTVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETLPTYIG 596

Query: 602 PMIKLLVVPTQSANLGIGELIEVDVDHLNICKPEKKDSFLYKRSLQFIQEVL 653
            |||| ||| .||.||||.|| |||.|||||||.|||.|||.|.||||.| |
Sbjct: 597 SMIKLHVVPVESADLGIGDLIPVDVNHLNICKPKKKDAFLYQRTLQFIREAL 648

>hg18||uc003qrb |6|AK125878|NA|NA|SERAC1|NA|NA|Homo sapiens cDNA FLJ13594 fis,
        clone PLACE1009539

          Length = 382

 Score =  538 bits (1384), Expect = 1e-152
 Identities = 247/377 (65%), Positives = 321/377 (85%), Gaps = 2/377 (0%)

Query: 277 FCLQALVQHSKVQSHCDHIVANGGVQLLQRMYQLRKDSLKIQRNIVRIIGNLALNESIHQ 336
           |||.|.|.||.. .||| | ||||.|||||.|.| ||  |.||||.|.|||.|||| .| 
Sbjct:   2 FCLEAIVKHSEISTHCDKIEANGGLQLLQRLYRLHKDCPKVQRNIMRVIGNMALNEHLHS 61

Query: 337 AIAQSGWVSVLAEMMQSPHIMQASHAARALANLDREAVNEKYQDGIYILHPQTRSNQPIK 396
           .| .|||||..|| |.|||||..||||| ||||||| | ||||||.|.|||| |..||||
Sbjct:  62 SIVRSGWVSIMAEAMKSPHIMESSHAARILANLDRETVQEKYQDGVYVLHPQYRTSQPIK 121

Query: 397 ADVLFIHGILGAAFKTWRQKDRVTSEEKDETGSTENYTECWPKSWLAADCPNLRVLSVEY 456
           ||||||||..|||||||||.|   .  .      . || ||||.||| ||| ||..||||
Sbjct: 122 ADVLFIHGLMGAAFKTWRQQDSEQAVIEKPMEDEDRYTTCWPKTWLAKDCPALRIISVEY 181

Query: 457 DSHLSDWMSKCPAENQRTSLAYRSQELLKKLKQAGIGDRPVIWVAHSMGGLLVKKILLDA 516
           |. |||| ..|| |  | |.|.|| |||.||. ||.|||||.|..||||||||||.||.|
Sbjct: 182 DTSLSDWRARCPME--RKSIAFRSNELLRKLRAAGVGDRPVVWISHSMGGLLVKKMLLEA 239

Query: 517 SMDPDMHGLLNNTKGMMFYSVPHHGTSMAEYSVNVRYLLFPSIEVRELCKDSPALRNLNE 576
           |  |.|  ..|||.|..||||||||. .||||||.|||||||.||.|| ||||||. | .
Sbjct: 240 STKPEMSTVINNTRGIIFYSVPHHGSRLAEYSVNIRYLLFPSLEVKELSKDSPALKTLQD 299

Query: 577 NFLIMAKERQFKVLSFAETEPTNIGPMIKLLVVPTQSANLGIGELIEVDVDHLNICKPEK 636
           .||  ||.. |.||.| || || || |||| ||| .||.||||.|| |||.|||||||.|
Sbjct: 300 DFLEFAKDKNFQVLNFVETLPTYIGSMIKLHVVPVESADLGIGDLIPVDVNHLNICKPKK 359

Query: 637 KDSFLYKRSLQFIQEVL 653
           ||.|||.|.||||.| |
Sbjct: 360 KDAFLYQRTLQFIREAL 376

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0