BLASTP 7.6.0


Query=fugu4_572487 |jgi|Takru4|572487|e_gw2.439.39.1
        (361 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003bbs |22|NM_019106|Q9UH03-2|Q9UH03-2|SEPT3|NM_019106|N...    543   2e-154
hg18||uc003bbr |22|NM_145733|Q9UH03|SEPT3_HUMAN|SEPT3|NM_145733|...    536   2e-152
hg18||uc002jts |17|AF189713|Q9UHD8|SEPT9_HUMAN|SEPT9|NM_006640|N...    331   9e-091
hg18||uc002jtt |17|AF189712|Q9UHD8-3|Q9UHD8-3|SEPT9|NM_006640|NP...    331   9e-091
hg18||uc002jtu |17|NM_006640|Q9UHD8-2|Q9UHD8-2|SEPT9|NM_006640|N...    331   9e-091
hg18||uc002jtv |17|AJ312319|Q9UHD8-5|Q9UHD8-5|SEPT9|NM_006640|NP...    331   9e-091
hg18||uc002jtw |17|AJ312322|Q9UHD8-3|Q9UHD8-3|SEPT9|NM_006640|NP...    331   9e-091
hg18||uc002jty |17|AJ312320|Q9UHD8-4|Q9UHD8-4|SEPT9|NM_006640|NP...    331   9e-091
hg18||uc002iwm |17|NM_004574|O43236|SEPT4_HUMAN|SEPT4|NM_004574|...    300   3e-081
hg18||uc002iwn |17|CR597931|O43236-2|O43236-2|SEPT4|NM_080416|NP...    300   3e-081
hg18||uc002iwo |17|NM_080416|O43236-2|O43236-2|SEPT4|NM_080416|N...    300   3e-081
hg18||uc002zpv |22|NM_002688|Q99719|SEPT5_HUMAN|SEPT5|NM_002688|...    290   2e-078
hg18||uc002wbc |2|NM_001008491|Q15019|SEPT2_HUMAN|SEPT2|NM_00100...    279   5e-075
hg18||uc002wbd |2|NM_006155|Q15019|SEPT2_HUMAN|SEPT2|NM_006155|N...    279   5e-075
hg18||uc002wbf |2|NM_001008492|Q15019|SEPT2_HUMAN|SEPT2|NM_00100...    279   5e-075
hg18||uc002wbg |2|NM_004404|Q15019|SEPT2_HUMAN|SEPT2|NM_004404|N...    279   5e-075
hg18||uc002wbh |2|BC033559|Q15019|SEPT2_HUMAN|SEPT2|NM_006155|NP...    277   2e-074
hg18||uc002iwk |17|DQ895541|O43236-2|O43236-2|SEPT4|NM_080416|NP...    275   6e-074
hg18||uc002iwl |17|AK094579|NA|NA|CE5B3 alpha|NA|NA|Homo sapiens...    275   6e-074
hg18||uc002cxq |16|NM_144605|Q8IYM1|Q8IYM1_HUMAN|SEPT12|NM_14460...    273   3e-073
hg18||uc002dxy |16|NM_052838|Q8WYJ6|SEPT1_HUMAN|SEPT1|NM_052838|...    271   1e-072
hg18||uc003kxv |5|AK057797|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8      248   1e-065
hg18||uc003tex |7|NM_001788|Q309B3|Q309B3_HUMAN|SEPT7|NM_001788|...    212   6e-055
hg18||uc003hkj |4|NM_018243|Q9NVA2|SEP11_HUMAN|SEPT11|NM_018243|...    182   7e-046
hg18||uc003kxr |5|AF440762|Q92599|SEPT8_HUMAN|SEPT8|NA|NA|Septin-8     176   6e-044
hg18||uc003kxs |5|AF440761|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8      176   6e-044
hg18||uc003kxu |5|CR590471|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8      176   6e-044
hg18||uc002tew |2|NM_144710|Q9P0V9-2|Q9P0V9-2|SEPT10|NM_144710|N...    174   1e-043
hg18||uc002tex |2|NM_178584|Q9P0V9-2|Q9P0V9-2|SEPT10|NM_178584|N...    174   1e-043
hg18||uc002tey |2|BC050345|Q86VP5|Q86VP5_HUMAN|SEPT10|NA|NA|SEPT...    174   1e-043
hg18||uc004ers |X|NM_145800|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145800|...    174   2e-043
hg18||uc004ert |X|NM_145802|Q5JTK1|Q5JTK1_HUMAN|SEPT6|NM_145802|...    174   2e-043
hg18||uc004eru |X|NM_145799|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145799|...    174   2e-043
hg18||uc004erv |X|NM_015129|Q14141|SEPT6_HUMAN|SEPT6|NM_015129|N...    174   2e-043
hg18||uc002iwp |17|NM_080415|Q9H315|Q9H315_HUMAN|SEPT4|NM_080415...    159   6e-039
hg18||uc003kxt |5|AF440763|Q92599-3|Q92599-3|SEPT8|NA|NA|Septin-8      136   4e-032
hg18||uc004erw |X|AF512946|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145800|N...    135   1e-031
hg18||uc002cxr |16|DQ456996|Q1PBH0|Q1PBH0_HUMAN|SEPT12|NM_144605...    122   1e-027
hg18||uc002cxr |16|DQ456996|Q1PBH0|Q1PBH0_HUMAN|SEPT12|NM_144605...    120   3e-027
hg18||uc002jts |17|AF189713|Q9UHD8|SEPT9_HUMAN|SEPT9|NM_006640|N...    119   5e-027
hg18||uc002jtt |17|AF189712|Q9UHD8-3|Q9UHD8-3|SEPT9|NM_006640|NP...    119   5e-027
hg18||uc002jtu |17|NM_006640|Q9UHD8-2|Q9UHD8-2|SEPT9|NM_006640|N...    119   5e-027
hg18||uc002jtv |17|AJ312319|Q9UHD8-5|Q9UHD8-5|SEPT9|NM_006640|NP...    119   5e-027
hg18||uc002jtw |17|AJ312322|Q9UHD8-3|Q9UHD8-3|SEPT9|NM_006640|NP...    119   5e-027
hg18||uc002jty |17|AJ312320|Q9UHD8-4|Q9UHD8-4|SEPT9|NM_006640|NP...    119   5e-027
hg18||uc002cxq |16|NM_144605|Q8IYM1|Q8IYM1_HUMAN|SEPT12|NM_14460...    119   7e-027
hg18||uc003tey |7|CR623918|Q309B3|Q309B3_HUMAN|SEPT7|NM_00101155...    104   3e-022
hg18||uc003tex |7|NM_001788|Q309B3|Q309B3_HUMAN|SEPT7|NM_001788|...     98   2e-020
hg18||uc003tey |7|CR623918|Q309B3|Q309B3_HUMAN|SEPT7|NM_00101155...     98   2e-020
hg18||uc002dxx |16|CR615337|Q658T1|Q658T1_HUMAN|DKFZp666C094|NA|...     96   5e-020
hg18||uc003kxr |5|AF440762|Q92599|SEPT8_HUMAN|SEPT8|NA|NA|Septin-8      89   8e-018
hg18||uc003kxs |5|AF440761|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8       89   8e-018
hg18||uc003kxt |5|AF440763|Q92599-3|Q92599-3|SEPT8|NA|NA|Septin-8       89   8e-018
hg18||uc003kxu |5|CR590471|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8       89   8e-018
hg18||uc003hkj |4|NM_018243|Q9NVA2|SEP11_HUMAN|SEPT11|NM_018243|...     87   3e-017
hg18||uc003hkk |4|AK094473|NA|NA|SEPT11|NM_018243|NP_060713|sept...     87   3e-017
hg18||uc002tev |2|AB208875|Q59H84|Q59H84_HUMAN|SEPT10|NM_178584|...     86   8e-017
hg18||uc002tew |2|NM_144710|Q9P0V9-2|Q9P0V9-2|SEPT10|NM_144710|N...     86   8e-017
hg18||uc002tex |2|NM_178584|Q9P0V9-2|Q9P0V9-2|SEPT10|NM_178584|N...     86   8e-017
hg18||uc002tey |2|BC050345|Q86VP5|Q86VP5_HUMAN|SEPT10|NA|NA|SEPT...     86   8e-017
hg18||uc002tez |2|AF316880|Q9NSH2|Q9NSH2_HUMAN|SEPT10|NM_178584|...     86   8e-017
hg18||uc003tqz |7|NM_207366|Q6ZU15|Q6ZU15_HUMAN|FLJ44060|NM_2073...     86   8e-017
hg18||uc002cxr |16|DQ456996|Q1PBH0|Q1PBH0_HUMAN|SEPT12|NM_144605...     84   2e-016
hg18||uc004ers |X|NM_145800|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145800|...     82   7e-016
hg18||uc004ert |X|NM_145802|Q5JTK1|Q5JTK1_HUMAN|SEPT6|NM_145802|...     82   7e-016
hg18||uc004eru |X|NM_145799|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145799|...     82   7e-016
hg18||uc004erv |X|NM_015129|Q14141|SEPT6_HUMAN|SEPT6|NM_015129|N...     82   7e-016
hg18||uc004erw |X|AF512946|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145800|N...     82   7e-016
hg18||uc002jtx |17|BC114550|Q1WWK5|Q1WWK5_HUMAN|SEPT9|NA|NA|SEPT...     52   1e-006
hg18||uc002tev |2|AB208875|Q59H84|Q59H84_HUMAN|SEPT10|NM_178584|...     49   1e-005

>hg18||uc003bbs |22|NM_019106|Q9UH03-2|Q9UH03-2|SEPT3|NM_019106|NP_061979|septin
        3 isoform B

          Length = 337

 Score =  543 bits (1397), Expect = 2e-154
 Identities = 266/315 (84%), Positives = 288/315 (91%), Gaps = 9/315 (2%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |||||||||||||||||||||||||||| |||||||||||||||||||... | |.||||
Sbjct:  28 YIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIP 87

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           ||||.||. ||.|||||||||||||||||||||||||||||| |||||||||||||||||
Sbjct:  88 KTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNI 147

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            ||||||||||||||||||||||||| ||.|||| ||  ||||||||||||||.||. ||
Sbjct: 148 ARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEF 207

Query: 225 KQRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQV 284
           |||||||||. |||||||||||||.|||..|||||        ||.||||||||||||||
Sbjct: 208 KQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIR--------QESMPFAVVGSDKEYQV 259

Query: 285 NAKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAKRLHEN 344
           | |||||||| |||.|||| |||||| ||||.||.||||||||||||||||||||||..|
Sbjct: 260 NGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDN 319

Query: 345 GGLHPVSCNDTQESN 359
           ||| |||  ||.||.
Sbjct: 320 GGLPPVSV-DTEESH 333

>hg18||uc003bbr
        |22|NM_145733|Q9UH03|SEPT3_HUMAN|SEPT3|NM_145733|NP_663786|septin 3
        isoform A

          Length = 345

 Score =  536 bits (1379), Expect = 2e-152
 Identities = 260/305 (85%), Positives = 280/305 (91%), Gaps = 8/305 (2%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |||||||||||||||||||||||||||| |||||||||||||||||||... | |.||||
Sbjct:  28 YIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIP 87

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           ||||.||. ||.|||||||||||||||||||||||||||||| |||||||||||||||||
Sbjct:  88 KTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNI 147

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            ||||||||||||||||||||||||| ||.|||| ||  ||||||||||||||.||. ||
Sbjct: 148 ARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEF 207

Query: 225 KQRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQV 284
           |||||||||. |||||||||||||.|||..|||||        ||.||||||||||||||
Sbjct: 208 KQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIR--------QESMPFAVVGSDKEYQV 259

Query: 285 NAKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAKRLHEN 344
           | |||||||| |||.|||| |||||| ||||.||.||||||||||||||||||||||..|
Sbjct: 260 NGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDN 319

Query: 345 GGLHP 349
           ||| |
Sbjct: 320 GGLPP 324

>hg18||uc002jts |17|AF189713|Q9UHD8|SEPT9_HUMAN|SEPT9|NM_006640|NP_006631|septin
        9

          Length = 586

 Score =  331 bits (848), Expect = 9e-091
 Identities = 154/218 (70%), Positives = 187/218 (85%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|||.|.||||.| || ||.||||||| ||||||||.||||||..||.|   | .|.||
Sbjct: 278 YVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIP 337

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           ||.|.|...| .|| ||.||||||||||||| |||||||.|| |.||.||||.|.|||||
Sbjct: 338 KTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNI 397

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            |||||||||||||||||  |||||| ||.|||||||  |||.||||||||.|.|||  |
Sbjct: 398 NRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHF 457

Query: 225 KQRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRNHV 262
           |||.  .|   ||. ||||||||| ||.  |.| |  .
Sbjct: 458 KQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMI 495

>hg18||uc002jtt |17|AF189712|Q9UHD8-3|Q9UHD8-3|SEPT9|NM_006640|NP_006631|septin
        9

          Length = 422

 Score =  331 bits (848), Expect = 9e-091
 Identities = 154/218 (70%), Positives = 187/218 (85%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|||.|.||||.| || ||.||||||| ||||||||.||||||..||.|   | .|.||
Sbjct: 114 YVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIP 173

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           ||.|.|...| .|| ||.||||||||||||| |||||||.|| |.||.||||.|.|||||
Sbjct: 174 KTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNI 233

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            |||||||||||||||||  |||||| ||.|||||||  |||.||||||||.|.|||  |
Sbjct: 234 NRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHF 293

Query: 225 KQRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRNHV 262
           |||.  .|   ||. ||||||||| ||.  |.| |  .
Sbjct: 294 KQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMI 331

>hg18||uc002jtu |17|NM_006640|Q9UHD8-2|Q9UHD8-2|SEPT9|NM_006640|NP_006631|septin
        9

          Length = 568

 Score =  331 bits (848), Expect = 9e-091
 Identities = 154/218 (70%), Positives = 187/218 (85%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|||.|.||||.| || ||.||||||| ||||||||.||||||..||.|   | .|.||
Sbjct: 260 YVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIP 319

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           ||.|.|...| .|| ||.||||||||||||| |||||||.|| |.||.||||.|.|||||
Sbjct: 320 KTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNI 379

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            |||||||||||||||||  |||||| ||.|||||||  |||.||||||||.|.|||  |
Sbjct: 380 NRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHF 439

Query: 225 KQRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRNHV 262
           |||.  .|   ||. ||||||||| ||.  |.| |  .
Sbjct: 440 KQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMI 477

>hg18||uc002jtv |17|AJ312319|Q9UHD8-5|Q9UHD8-5|SEPT9|NM_006640|NP_006631|septin
        9

          Length = 579

 Score =  331 bits (848), Expect = 9e-091
 Identities = 154/218 (70%), Positives = 187/218 (85%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|||.|.||||.| || ||.||||||| ||||||||.||||||..||.|   | .|.||
Sbjct: 271 YVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIP 330

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           ||.|.|...| .|| ||.||||||||||||| |||||||.|| |.||.||||.|.|||||
Sbjct: 331 KTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNI 390

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            |||||||||||||||||  |||||| ||.|||||||  |||.||||||||.|.|||  |
Sbjct: 391 NRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHF 450

Query: 225 KQRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRNHV 262
           |||.  .|   ||. ||||||||| ||.  |.| |  .
Sbjct: 451 KQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMI 488

>hg18||uc002jtw |17|AJ312322|Q9UHD8-3|Q9UHD8-3|SEPT9|NM_006640|NP_006631|septin
        9

          Length = 422

 Score =  331 bits (848), Expect = 9e-091
 Identities = 154/218 (70%), Positives = 187/218 (85%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|||.|.||||.| || ||.||||||| ||||||||.||||||..||.|   | .|.||
Sbjct: 114 YVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIP 173

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           ||.|.|...| .|| ||.||||||||||||| |||||||.|| |.||.||||.|.|||||
Sbjct: 174 KTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNI 233

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            |||||||||||||||||  |||||| ||.|||||||  |||.||||||||.|.|||  |
Sbjct: 234 NRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHF 293

Query: 225 KQRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRNHV 262
           |||.  .|   ||. ||||||||| ||.  |.| |  .
Sbjct: 294 KQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMI 331

>hg18||uc002jty |17|AJ312320|Q9UHD8-4|Q9UHD8-4|SEPT9|NM_006640|NP_006631|septin
        9

          Length = 335

 Score =  331 bits (848), Expect = 9e-091
 Identities = 154/218 (70%), Positives = 187/218 (85%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|||.|.||||.| || ||.||||||| ||||||||.||||||..||.|   | .|.||
Sbjct:  27 YVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIP 86

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           ||.|.|...| .|| ||.||||||||||||| |||||||.|| |.||.||||.|.|||||
Sbjct:  87 KTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNI 146

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            |||||||||||||||||  |||||| ||.|||||||  |||.||||||||.|.|||  |
Sbjct: 147 NRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHF 206

Query: 225 KQRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRNHV 262
           |||.  .|   ||. ||||||||| ||.  |.| |  .
Sbjct: 207 KQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMI 244

>hg18||uc002iwm
        |17|NM_004574|O43236|SEPT4_HUMAN|SEPT4|NM_004574|NP_004565|septin 4
        isoform 1

          Length = 478

 Score =  300 bits (766), Expect = 3e-081
 Identities = 144/297 (48%), Positives = 206/297 (69%), Gaps = 12/297 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|  |.  |. .|..| |||| .|| | ||||||||||.|| . . |       .|.| 
Sbjct: 124 YVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIM 183

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           .|||.   .  .|| ||...||..||||||| .||  ||.|...||..|.|.. ..|  .
Sbjct: 184 QTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGL 243

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            | | | | ||||||||||| || || ||||||| |   |||.|..|||||.|  |    
Sbjct: 244 NR-KNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHK 302

Query: 225 KQRVRKELEMGGIEFY--PQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEY 282
           |...|.|.|  ||. |  |  . ||| . |  .  ..         |..||||.||.   
Sbjct: 303 KRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALK---------ESIPFAVIGSNTVV 353

Query: 283 QVNAKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAK 339
           .   .|| ||   ||||||||| ||.| .||  |.|.|.||||.||   ||| |||.
Sbjct: 354 EARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQ 410

>hg18||uc002iwn |17|CR597931|O43236-2|O43236-2|SEPT4|NM_080416|NP_536341|septin
        4 isoform 3

          Length = 379

 Score =  300 bits (766), Expect = 3e-081
 Identities = 144/297 (48%), Positives = 206/297 (69%), Gaps = 12/297 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|  |.  |. .|..| |||| .|| | ||||||||||.|| . . |       .|.| 
Sbjct:  25 YVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIM 84

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           .|||.   .  .|| ||...||..||||||| .||  ||.|...||..|.|.. ..|  .
Sbjct:  85 QTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGL 144

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            | | | | ||||||||||| || || ||||||| |   |||.|..|||||.|  |    
Sbjct: 145 NR-KNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHK 203

Query: 225 KQRVRKELEMGGIEFY--PQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEY 282
           |...|.|.|  ||. |  |  . ||| . |  .  ..         |..||||.||.   
Sbjct: 204 KRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALK---------ESIPFAVIGSNTVV 254

Query: 283 QVNAKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAK 339
           .   .|| ||   ||||||||| ||.| .||  |.|.|.||||.||   ||| |||.
Sbjct: 255 EARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQ 311

>hg18||uc002iwo |17|NM_080416|O43236-2|O43236-2|SEPT4|NM_080416|NP_536341|septin
        4 isoform 3

          Length = 459

 Score =  300 bits (766), Expect = 3e-081
 Identities = 144/297 (48%), Positives = 206/297 (69%), Gaps = 12/297 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|  |.  |. .|..| |||| .|| | ||||||||||.|| . . |       .|.| 
Sbjct: 105 YVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIM 164

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           .|||.   .  .|| ||...||..||||||| .||  ||.|...||..|.|.. ..|  .
Sbjct: 165 QTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGL 224

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            | | | | ||||||||||| || || ||||||| |   |||.|..|||||.|  |    
Sbjct: 225 NR-KNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHK 283

Query: 225 KQRVRKELEMGGIEFY--PQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEY 282
           |...|.|.|  ||. |  |  . ||| . |  .  ..         |..||||.||.   
Sbjct: 284 KRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALK---------ESIPFAVIGSNTVV 334

Query: 283 QVNAKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAK 339
           .   .|| ||   ||||||||| ||.| .||  |.|.|.||||.||   ||| |||.
Sbjct: 335 EARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQ 391

>hg18||uc002zpv
        |22|NM_002688|Q99719|SEPT5_HUMAN|SEPT5|NM_002688|NP_002679|septin 5

          Length = 369

 Score =  290 bits (741), Expect = 2e-078
 Identities = 140/296 (47%), Positives = 205/296 (69%), Gaps = 12/296 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|  |.  |. .|..| |||| .|| | |||||||||..|| . . .     . .|.| 
Sbjct:  24 YVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERIS 83

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           .|||.   .  .|| |||.|||..||||||| .||  ||.||. |...|.|.. ..|  .
Sbjct:  84 QTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKPITDYVDQQFEQYFRDESGL 143

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            | | | | ||||||||||| || || .|| ||| |   |||.|.||||| .   | .. 
Sbjct: 144 NR-KNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKL 202

Query: 225 KQRVRKELEMGGIEFY--PQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEY 282
           |.|.|.|..  ||  |  |. . ||| . |  . ...         |. ||||.||.   
Sbjct: 203 KERIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELK---------ESAPFAVIGSNTVV 253

Query: 283 QVNAKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRA 338
           .   .|| ||   ||||||||  ||.| .||. |||.|. |||.|| ..||| |||
Sbjct: 254 EAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRA 309

>hg18||uc002wbc
        |2|NM_001008491|Q15019|SEPT2_HUMAN|SEPT2|NM_001008491|NP_001008491|sept
        in 2

          Length = 361

 Score =  279 bits (712), Expect = 5e-075
 Identities = 143/303 (47%), Positives = 207/303 (68%), Gaps = 13/303 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|   .  |. .|..| ||.| .|||| ||||||||.|.|| . .          ||| 
Sbjct:  17 YVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIE 76

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           .||...| .  .|| |||..|||.||||.|| ||  .|.. |  ||.||.|..| .|  .
Sbjct:  77 RTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGL 136

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            | . | | ||||| ||||| || |. ||| ||| . . |||.||||||||.|..||.  
Sbjct: 137 NR-RHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERL 195

Query: 225 KQRVRKELEMGGIEFY--PQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEY 282
           |.|.  |.|   |. |  |  | ||| . |          |||  . ..||.||||..  
Sbjct: 196 KKRILDEIEEHNIKIYHLPDAESDEDEDFKEQ--------TRLL-KASIPFSVVGSNQLI 246

Query: 283 QVNAKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAKRLH 342
           .   |.| ||   ||.|||||| | .| .||  || .|.|||.||| ..||| .|..|| 
Sbjct: 247 EAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFRSERLK 305

Query: 343 ENG 345
             |
Sbjct: 306 RGG 308

>hg18||uc002wbd |2|NM_006155|Q15019|SEPT2_HUMAN|SEPT2|NM_006155|NP_006146|septin
        2

          Length = 361

 Score =  279 bits (712), Expect = 5e-075
 Identities = 143/303 (47%), Positives = 207/303 (68%), Gaps = 13/303 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|   .  |. .|..| ||.| .|||| ||||||||.|.|| . .          ||| 
Sbjct:  17 YVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIE 76

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           .||...| .  .|| |||..|||.||||.|| ||  .|.. |  ||.||.|..| .|  .
Sbjct:  77 RTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGL 136

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            | . | | ||||| ||||| || |. ||| ||| . . |||.||||||||.|..||.  
Sbjct: 137 NR-RHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERL 195

Query: 225 KQRVRKELEMGGIEFY--PQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEY 282
           |.|.  |.|   |. |  |  | ||| . |          |||  . ..||.||||..  
Sbjct: 196 KKRILDEIEEHNIKIYHLPDAESDEDEDFKEQ--------TRLL-KASIPFSVVGSNQLI 246

Query: 283 QVNAKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAKRLH 342
           .   |.| ||   ||.|||||| | .| .||  || .|.|||.||| ..||| .|..|| 
Sbjct: 247 EAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFRSERLK 305

Query: 343 ENG 345
             |
Sbjct: 306 RGG 308

>hg18||uc002wbf
        |2|NM_001008492|Q15019|SEPT2_HUMAN|SEPT2|NM_001008492|NP_001008492|sept
        in 2

          Length = 361

 Score =  279 bits (712), Expect = 5e-075
 Identities = 143/303 (47%), Positives = 207/303 (68%), Gaps = 13/303 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|   .  |. .|..| ||.| .|||| ||||||||.|.|| . .          ||| 
Sbjct:  17 YVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIE 76

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           .||...| .  .|| |||..|||.||||.|| ||  .|.. |  ||.||.|..| .|  .
Sbjct:  77 RTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGL 136

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            | . | | ||||| ||||| || |. ||| ||| . . |||.||||||||.|..||.  
Sbjct: 137 NR-RHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERL 195

Query: 225 KQRVRKELEMGGIEFY--PQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEY 282
           |.|.  |.|   |. |  |  | ||| . |          |||  . ..||.||||..  
Sbjct: 196 KKRILDEIEEHNIKIYHLPDAESDEDEDFKEQ--------TRLL-KASIPFSVVGSNQLI 246

Query: 283 QVNAKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAKRLH 342
           .   |.| ||   ||.|||||| | .| .||  || .|.|||.||| ..||| .|..|| 
Sbjct: 247 EAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFRSERLK 305

Query: 343 ENG 345
             |
Sbjct: 306 RGG 308

>hg18||uc002wbg |2|NM_004404|Q15019|SEPT2_HUMAN|SEPT2|NM_004404|NP_004395|septin
        2

          Length = 361

 Score =  279 bits (712), Expect = 5e-075
 Identities = 143/303 (47%), Positives = 207/303 (68%), Gaps = 13/303 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|   .  |. .|..| ||.| .|||| ||||||||.|.|| . .          ||| 
Sbjct:  17 YVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIE 76

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           .||...| .  .|| |||..|||.||||.|| ||  .|.. |  ||.||.|..| .|  .
Sbjct:  77 RTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGL 136

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            | . | | ||||| ||||| || |. ||| ||| . . |||.||||||||.|..||.  
Sbjct: 137 NR-RHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERL 195

Query: 225 KQRVRKELEMGGIEFY--PQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEY 282
           |.|.  |.|   |. |  |  | ||| . |          |||  . ..||.||||..  
Sbjct: 196 KKRILDEIEEHNIKIYHLPDAESDEDEDFKEQ--------TRLL-KASIPFSVVGSNQLI 246

Query: 283 QVNAKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAKRLH 342
           .   |.| ||   ||.|||||| | .| .||  || .|.|||.||| ..||| .|..|| 
Sbjct: 247 EAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFRSERLK 305

Query: 343 ENG 345
             |
Sbjct: 306 RGG 308

>hg18||uc002wbh |2|BC033559|Q15019|SEPT2_HUMAN|SEPT2|NM_006155|NP_006146|septin
        2

          Length = 371

 Score =  277 bits (707), Expect = 2e-074
 Identities = 145/316 (45%), Positives = 212/316 (67%), Gaps = 29/316 (9%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQV-------------S 91
           |.|   .  |. .|..| ||.| .|||| ||||||||.|.|| . .             .
Sbjct:  17 YVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAALNT 76

Query:  92 RRSAGWTRDEKIPKTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYIN 151
           |..  |   ||| .||...| .  .|| |||..|||.||||.|| ||  .|.. |  ||.
Sbjct:  77 RKTLLW---EKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYID 133

Query: 152 EQYEKFLKEEVNITRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIA 211
           ||.|..| .|  . | . | | ||||| ||||| || |. ||| ||| . . |||.||||
Sbjct: 134 EQFERYLHDESGLNR-RHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIA 192

Query: 212 KADTMTMEERQEFKQRVRKELEMGGIEFY--PQKEFDEDMEDKSDNDKIRNHVTRLCPQE 269
           ||||.|..||.  |.|.  |.|   |. |  |  | ||| . |          |||  . 
Sbjct: 193 KADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQ--------TRLL-KA 243

Query: 270 AMPFAVVGSDKEYQVNAKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTH 329
           ..||.||||..  .   |.| ||   ||.|||||| | .| .||  || .|.|||.||| 
Sbjct: 244 SIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQ 302

Query: 330 NIHYETYRAKRLHENG 345
           ..||| .|..||   |
Sbjct: 303 DLHYENFRSERLKRGG 318

>hg18||uc002iwk |17|DQ895541|O43236-2|O43236-2|SEPT4|NM_080416|NP_536341|septin
        4 isoform 3

          Length = 331

 Score =  275 bits (703), Expect = 6e-074
 Identities = 134/273 (49%), Positives = 189/273 (69%), Gaps = 12/273 (4%)

Query:  69 MVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIPKTVEVKAVSHVLEEGGVKMKLTVI 128
           || | ||||||||||.|| . . |       .|.| .|||.   .  .|| ||...||..
Sbjct:   1 MVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIV 60

Query: 129 DTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNITRKKRIPDTRVHCCLYFISPTGHS 188
           ||||||| .||  ||.|...||..|.|.. ..|  . | | | | ||||||||||| || 
Sbjct:  61 DTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNR-KNIQDNRVHCCLYFISPFGHG 119

Query: 189 LRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEFKQRVRKELEMGGIEFY--PQKEFD 246
           || ||||||| |   |||.|..|||||.|  |    |...|.|.|  ||. |  |  . |
Sbjct: 120 LRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSD 179

Query: 247 EDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQVNAKRVLGRKTAWGIVEVENPNH 306
           || . |  .  ..         |..||||.||.   .   .|| ||   ||||||||| |
Sbjct: 180 EDEDFKLQDQALK---------ESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGH 230

Query: 307 CEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAK 339
           |.| .||  |.|.|.||||.||   ||| |||.
Sbjct: 231 CDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQ 263

>hg18||uc002iwl |17|AK094579|NA|NA|CE5B3 alpha|NA|NA|Homo sapiens CE5B3 alpha
        mRNA for Bradeion alpha, complete cds

          Length = 331

 Score =  275 bits (703), Expect = 6e-074
 Identities = 134/273 (49%), Positives = 189/273 (69%), Gaps = 12/273 (4%)

Query:  69 MVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIPKTVEVKAVSHVLEEGGVKMKLTVI 128
           || | ||||||||||.|| . . |       .|.| .|||.   .  .|| ||...||..
Sbjct:   1 MVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIV 60

Query: 129 DTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNITRKKRIPDTRVHCCLYFISPTGHS 188
           ||||||| .||  ||.|...||..|.|.. ..|  . | | | | ||||||||||| || 
Sbjct:  61 DTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNR-KNIQDNRVHCCLYFISPFGHG 119

Query: 189 LRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEFKQRVRKELEMGGIEFY--PQKEFD 246
           || ||||||| |   |||.|..|||||.|  |    |...|.|.|  ||. |  |  . |
Sbjct: 120 LRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSD 179

Query: 247 EDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQVNAKRVLGRKTAWGIVEVENPNH 306
           || . |  .  ..         |..||||.||.   .   .|| ||   ||||||||| |
Sbjct: 180 EDEDFKLQDQALK---------ESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGH 230

Query: 307 CEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAK 339
           |.| .||  |.|.|.||||.||   ||| |||.
Sbjct: 231 CDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQ 263

>hg18||uc002cxq
        |16|NM_144605|Q8IYM1|Q8IYM1_HUMAN|SEPT12|NM_144605|NP_653206|septin 12

          Length = 358

 Score =  273 bits (697), Expect = 3e-073
 Identities = 124/217 (57%), Positives = 175/217 (80%), Gaps = 1/217 (0%)

Query:  46 IGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIPK 105
           .||. ...|.. | || ||.||||||| |||||||.|||||||.| . .         |.
Sbjct:  30 VGIEAVLDQLKIKAMKMGFEFNIMVVGQSGLGKSTMVNTLFKSKVWKSNPPGL-GVPTPQ 88

Query: 106 TVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNIT 165
           |... ...||.|| |||.|||| |||||||||||.|||.||  |||||||..|.||. ||
Sbjct:  89 TLQLHSLTHVIEEKGVKLKLTVTDTPGFGDQINNDNCWDPILGYINEQYEQYLQEEILIT 148

Query: 166 RKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEFK 225
           |.. |||||||||.||. |||| || ||.||..||  .||..||||.||..|||||. |.
Sbjct: 149 RQRHIPDTRVHCCVYFVPPTGHCLRPLDIEFLQRLCRTVNVVPVIARADSLTMEEREAFR 208

Query: 226 QRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRNHV 262
           .|... |    |. |||  ||||. ||  | |.|. .
Sbjct: 209 RRIQQNLRTHCIDVYPQMCFDEDINDKILNSKLRDRI 245

>hg18||uc002dxy
        |16|NM_052838|Q8WYJ6|SEPT1_HUMAN|SEPT1|NM_052838|NP_443070|septin 1

          Length = 367

 Score =  271 bits (692), Expect = 1e-072
 Identities = 137/300 (45%), Positives = 200/300 (66%), Gaps = 13/300 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|   .  |. .|..| |||| .|| | ||||||||.|.|| . .           .. 
Sbjct:   5 YVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLT 64

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           .|. ..     .||||||.|||..||||||| ..  .|| |. |.| ||.|..|..|  .
Sbjct:  65 QTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGL 124

Query: 165 TRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEF 224
            | | | |.||||||||||| |  || ||| |.. .   ||||||| ||| .  .| |  
Sbjct: 125 NR-KNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQAL 183

Query: 225 KQRVRKELEMGGIEFY--PQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEY 282
           ||..| .|.   |  |  |. . ||| . |  . ...         |..||||||| .  
Sbjct: 184 KQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMK---------ESIPFAVVGSCEVV 234

Query: 283 QVNAKR-VLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAKRL 341
           .    | | ||. .|| ||||||.||.|  ||  |...||||||||||.. || |||. |
Sbjct: 235 RDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCL 294

>hg18||uc003kxv |5|AK057797|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8

          Length = 440

 Score =  248 bits (631), Expect = 1e-065
 Identities = 134/321 (41%), Positives = 198/321 (61%), Gaps = 25/321 (7%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           ..| |.. .|.  |..  || |||. || .|.|||||.|||| .      |         
Sbjct:  24 HVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTLMNTLFNTTFETEEASHHE----- 78

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
             | ..  .. |.|  |..|||..|  ||||||| .    ||  ||. |.| .|.||. |
Sbjct:  79 ACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDE--RPIVDYIDAQFENYLQEELKI 136

Query: 165 TRKK-RIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
            |      |||.| |||||.||||||. ||.  ||.|   |||||.||||||..  |  .
Sbjct: 137 RRSLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHK 196

Query: 224 FKQRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQ 283
           || ..  ||   |.. |   .|  | |  .. . . |          .||||||| .| .
Sbjct: 197 FKIKIMGELVSNGVQIY---QFPTDDEAVAEINAVMN--------AHLPFAVVGSTEEVK 245

Query: 284 VNAKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAKRLHE 343
           |  | |  |.  ||.|.||| |||.| .||. ||| ...||.| ||. ||| ||  .| |
Sbjct: 246 VGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEE 305

Query: 344 ------NGGLHPVSCNDTQES 358
                 .|   | |  .| |.
Sbjct: 306 MGFQDSDGDSQPFSLQETYEA 326

>hg18||uc003tex |7|NM_001788|Q309B3|Q309B3_HUMAN|SEPT7|NM_001788|NP_001779|cell
        division cycle 10 isoform 1

          Length = 418

 Score =  212 bits (539), Expect = 6e-055
 Identities = 101/209 (48%), Positives = 151/209 (72%), Gaps = 4/209 (1%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQV-SRRSAGWTRDEKI 103
           |.|   .  |. .|..| ||.| .|||| ||||||||.|.|| . . |    |     .|
Sbjct:  11 YVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPG--PSHRI 68

Query: 104 PKTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVN 163
            |||.|.    ...||||.. ||..||||||| ..| |||.|.  ||. ..| .|  |  
Sbjct:  69 KKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESR 128

Query: 164 ITRKKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
           . | ...|| || ||||||.|.|| |. ||.||||||   |||||.||||||.| || |.
Sbjct: 129 VNR-RQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQ 187

Query: 224 FKQRVRKELEMGGIEFYPQKEFDEDMEDK 252
           ||... ||..   |. |   | |.. |.|
Sbjct: 188 FKKQIMKEIQEHKIKIYEFPETDDEEENK 216

>hg18||uc003hkj
        |4|NM_018243|Q9NVA2|SEP11_HUMAN|SEPT11|NM_018243|NP_060713|septin 11

          Length = 429

 Score =  182 bits (461), Expect = 7e-046
 Identities = 94/207 (45%), Positives = 139/207 (67%), Gaps = 9/207 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           ..| |.. .|.  |.   || |||. || .|.|||||..||| ..     |  | .|   
Sbjct:  21 HVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPA--THNE--- 75

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
             | .|| |. |.|  |..|||..|| ||||||| .. ..|| .||. |.| .|.||. |
Sbjct:  76 PGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKI 135

Query: 165 TRKK-RIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
            |      |||.| |||||.||||||. ||.  ||.|   |||||.||||||.   |  .
Sbjct: 136 KRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHK 195

Query: 224 FKQRVRKELEMGGIEFYPQKEFDEDME 250
           || ..  ||   |.. |   .|  | |
Sbjct: 196 FKSKIMSELVSNGVQIY---QFPTDEE 219

>hg18||uc003kxr |5|AF440762|Q92599|SEPT8_HUMAN|SEPT8|NA|NA|Septin-8

          Length = 483

 Score =  176 bits (444), Expect = 6e-044
 Identities = 90/217 (41%), Positives = 137/217 (63%), Gaps = 9/217 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           ..| |.. .|.  |..  || |||. || .|.|||||.|||| .      |         
Sbjct:  24 HVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTLMNTLFNTTFETEEASHHE----- 78

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
             | ..  .. |.|  |..|||..|  ||||||| .  . ||  ||. |.| .|.||. |
Sbjct:  79 ACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFENYLQEELKI 138

Query: 165 TRKK-RIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
            |      |||.| |||||.||||||. ||.  ||.|   |||||.||||||..  |  .
Sbjct: 139 RRSLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHK 198

Query: 224 FKQRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRN 260
           || ..  ||   |.. |   .|  | |  .. . . |
Sbjct: 199 FKIKIMGELVSNGVQIY---QFPTDDEAVAEINAVMN 232

>hg18||uc003kxs |5|AF440761|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8

          Length = 429

 Score =  176 bits (444), Expect = 6e-044
 Identities = 90/217 (41%), Positives = 137/217 (63%), Gaps = 9/217 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           ..| |.. .|.  |..  || |||. || .|.|||||.|||| .      |         
Sbjct:  24 HVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTLMNTLFNTTFETEEASHHE----- 78

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
             | ..  .. |.|  |..|||..|  ||||||| .  . ||  ||. |.| .|.||. |
Sbjct:  79 ACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFENYLQEELKI 138

Query: 165 TRKK-RIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
            |      |||.| |||||.||||||. ||.  ||.|   |||||.||||||..  |  .
Sbjct: 139 RRSLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHK 198

Query: 224 FKQRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRN 260
           || ..  ||   |.. |   .|  | |  .. . . |
Sbjct: 199 FKIKIMGELVSNGVQIY---QFPTDDEAVAEINAVMN 232

>hg18||uc003kxu |5|CR590471|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8

          Length = 442

 Score =  176 bits (444), Expect = 6e-044
 Identities = 90/217 (41%), Positives = 137/217 (63%), Gaps = 9/217 (4%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           ..| |.. .|.  |..  || |||. || .|.|||||.|||| .      |         
Sbjct:  24 HVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTLMNTLFNTTFETEEASHHE----- 78

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
             | ..  .. |.|  |..|||..|  ||||||| .  . ||  ||. |.| .|.||. |
Sbjct:  79 ACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFENYLQEELKI 138

Query: 165 TRKK-RIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
            |      |||.| |||||.||||||. ||.  ||.|   |||||.||||||..  |  .
Sbjct: 139 RRSLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHK 198

Query: 224 FKQRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRN 260
           || ..  ||   |.. |   .|  | |  .. . . |
Sbjct: 199 FKIKIMGELVSNGVQIY---QFPTDDEAVAEINAVMN 232

>hg18||uc002tew |2|NM_144710|Q9P0V9-2|Q9P0V9-2|SEPT10|NM_144710|NP_653311|septin
        10 isoform 1

          Length = 454

 Score =  174 bits (441), Expect = 1e-043
 Identities = 90/205 (43%), Positives = 137/205 (66%), Gaps = 7/205 (3%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           ..| ... .|.  .... || |||. || .|.|||||..||| .      .         
Sbjct:  46 HVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYES-----SHFC 100

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
             |..|| .. |.|  |..|||...| ||||||| |  ..||  ||. |.| .|.||. |
Sbjct: 101 PNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKI 160

Query: 165 TRKK-RIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
            |      |.|.| ||||||||||||. ||.  || |   ||||||||||||..  | |.
Sbjct: 161 KRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQK 220

Query: 224 FKQRVRKELEMGGIEFYPQKEFDED 248
           || ..  ||   |.. | |   |.|
Sbjct: 221 FKIKLMSELVSNGVQIY-QFPTDDD 244

>hg18||uc002tex |2|NM_178584|Q9P0V9-2|Q9P0V9-2|SEPT10|NM_178584|NP_848699|septin
        10 isoform 2

          Length = 431

 Score =  174 bits (441), Expect = 1e-043
 Identities = 90/205 (43%), Positives = 137/205 (66%), Gaps = 7/205 (3%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           ..| ... .|.  .... || |||. || .|.|||||..||| .      .         
Sbjct:  23 HVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYES-----SHFC 77

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
             |..|| .. |.|  |..|||...| ||||||| |  ..||  ||. |.| .|.||. |
Sbjct:  78 PNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKI 137

Query: 165 TRKK-RIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
            |      |.|.| ||||||||||||. ||.  || |   ||||||||||||..  | |.
Sbjct: 138 KRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQK 197

Query: 224 FKQRVRKELEMGGIEFYPQKEFDED 248
           || ..  ||   |.. | |   |.|
Sbjct: 198 FKIKLMSELVSNGVQIY-QFPTDDD 221

>hg18||uc002tey |2|BC050345|Q86VP5|Q86VP5_HUMAN|SEPT10|NA|NA|SEPT10 protein

          Length = 544

 Score =  174 bits (441), Expect = 1e-043
 Identities = 90/205 (43%), Positives = 137/205 (66%), Gaps = 7/205 (3%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           ..| ... .|.  .... || |||. || .|.|||||..||| .      .         
Sbjct:  46 HVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYES-----SHFC 100

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
             |..|| .. |.|  |..|||...| ||||||| |  ..||  ||. |.| .|.||. |
Sbjct: 101 PNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKI 160

Query: 165 TRKK-RIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
            |      |.|.| ||||||||||||. ||.  || |   ||||||||||||..  | |.
Sbjct: 161 KRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQK 220

Query: 224 FKQRVRKELEMGGIEFYPQKEFDED 248
           || ..  ||   |.. | |   |.|
Sbjct: 221 FKIKLMSELVSNGVQIY-QFPTDDD 244

>hg18||uc004ers
        |X|NM_145800|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145800|NP_665799|septin 6
        isoform A

          Length = 427

 Score =  174 bits (440), Expect = 2e-043
 Identities = 87/208 (41%), Positives = 139/208 (66%), Gaps = 6/208 (2%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           ..| |.. .|.  |..  || |||. || .|||||||..||| ..     |  |.     
Sbjct:  22 HVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQ----- 76

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
             |.... .. |.|  |..|||.. | ||||||| |. ..|| ..|. |.| .|.||. |
Sbjct:  77 PGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKI 136

Query: 165 TR-KKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
            |      |.|.| |||||.||||||. ||.  ||.|   |||||.||||| ..  |  .
Sbjct: 137 RRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTK 196

Query: 224 FKQRVRKELEMGGIEFYPQKEFDEDMED 251
           || ..  ||   |.. |     || . .
Sbjct: 197 FKIKITSELVSNGVQIYQFPTDDESVAE 224

>hg18||uc004ert
        |X|NM_145802|Q5JTK1|Q5JTK1_HUMAN|SEPT6|NM_145802|NP_665801|septin 6
        isoform D

          Length = 429

 Score =  174 bits (440), Expect = 2e-043
 Identities = 87/208 (41%), Positives = 139/208 (66%), Gaps = 6/208 (2%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           ..| |.. .|.  |..  || |||. || .|||||||..||| ..     |  |.     
Sbjct:  22 HVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQ----- 76

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
             |.... .. |.|  |..|||.. | ||||||| |. ..|| ..|. |.| .|.||. |
Sbjct:  77 PGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKI 136

Query: 165 TR-KKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
            |      |.|.| |||||.||||||. ||.  ||.|   |||||.||||| ..  |  .
Sbjct: 137 RRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTK 196

Query: 224 FKQRVRKELEMGGIEFYPQKEFDEDMED 251
           || ..  ||   |.. |     || . .
Sbjct: 197 FKIKITSELVSNGVQIYQFPTDDESVAE 224

>hg18||uc004eru
        |X|NM_145799|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145799|NP_665798|septin 6
        isoform A

          Length = 427

 Score =  174 bits (440), Expect = 2e-043
 Identities = 87/208 (41%), Positives = 139/208 (66%), Gaps = 6/208 (2%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           ..| |.. .|.  |..  || |||. || .|||||||..||| ..     |  |.     
Sbjct:  22 HVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQ----- 76

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
             |.... .. |.|  |..|||.. | ||||||| |. ..|| ..|. |.| .|.||. |
Sbjct:  77 PGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKI 136

Query: 165 TR-KKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
            |      |.|.| |||||.||||||. ||.  ||.|   |||||.||||| ..  |  .
Sbjct: 137 RRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTK 196

Query: 224 FKQRVRKELEMGGIEFYPQKEFDEDMED 251
           || ..  ||   |.. |     || . .
Sbjct: 197 FKIKITSELVSNGVQIYQFPTDDESVAE 224

>hg18||uc004erv |X|NM_015129|Q14141|SEPT6_HUMAN|SEPT6|NM_015129|NP_055944|septin
        6 isoform B

          Length = 434

 Score =  174 bits (440), Expect = 2e-043
 Identities = 87/208 (41%), Positives = 139/208 (66%), Gaps = 6/208 (2%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           ..| |.. .|.  |..  || |||. || .|||||||..||| ..     |  |.     
Sbjct:  22 HVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQ----- 76

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
             |.... .. |.|  |..|||.. | ||||||| |. ..|| ..|. |.| .|.||. |
Sbjct:  77 PGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKI 136

Query: 165 TR-KKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQE 223
            |      |.|.| |||||.||||||. ||.  ||.|   |||||.||||| ..  |  .
Sbjct: 137 RRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTK 196

Query: 224 FKQRVRKELEMGGIEFYPQKEFDEDMED 251
           || ..  ||   |.. |     || . .
Sbjct: 197 FKIKITSELVSNGVQIYQFPTDDESVAE 224

>hg18||uc002iwp
        |17|NM_080415|Q9H315|Q9H315_HUMAN|SEPT4|NM_080415|NP_536340|septin 4
        isoform 2

          Length = 274

 Score =  159 bits (401), Expect = 6e-039
 Identities = 71/143 (49%), Positives = 105/143 (73%), Gaps = 1/143 (0%)

Query:  45 YIGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIP 104
           |.|  |.  |. .|..| |||| .|| | ||||||||||.|| . . |       .|.| 
Sbjct: 105 YVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIM 164

Query: 105 KTVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNI 164
           .|||.   .  .|| ||...||..||||||| .||  ||.|...||..|.|.. ..|  .
Sbjct: 165 QTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGL 224

Query: 165 TRKKRIPDTRVHCCLYFISPTGH 187
            | | | | ||||||||||| ||
Sbjct: 225 NR-KNIQDNRVHCCLYFISPFGH 246

>hg18||uc003kxt |5|AF440763|Q92599-3|Q92599-3|SEPT8|NA|NA|Septin-8

          Length = 369

 Score =  136 bits (342), Expect = 4e-032
 Identities = 68/155 (43%), Positives = 102/155 (65%), Gaps = 4/155 (2%)

Query: 107 VEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNITR 166
           | ..  .. |.|  |..|||..|  ||||||| .  . ||  ||. |.| .|.||. | |
Sbjct:  21 VRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFENYLQEELKIRR 80

Query: 167 KK-RIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEFK 225
                 |||.| |||||.||||||. ||.  ||.|   |||||.||||||..  |  .||
Sbjct:  81 SLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFK 140

Query: 226 QRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRN 260
            ..  ||   |.. |   .|  | |  .. . . |
Sbjct: 141 IKIMGELVSNGVQIY---QFPTDDEAVAEINAVMN 172

>hg18||uc004erw |X|AF512946|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145800|NP_665799|septin
        6 isoform A

          Length = 369

 Score =  135 bits (338), Expect = 1e-031
 Identities = 64/146 (43%), Positives = 101/146 (69%), Gaps = 1/146 (0%)

Query: 107 VEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPISKYINEQYEKFLKEEVNITR 166
           |.... .. |.|  |..|||.. | ||||||| |. ..|| ..|. |.| .|.||. | |
Sbjct:  21 VQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRR 80

Query: 167 -KKRIPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEFK 225
                 |.|.| |||||.||||||. ||.  ||.|   |||||.||||| ..  |  .||
Sbjct:  81 VLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFK 140

Query: 226 QRVRKELEMGGIEFYPQKEFDEDMED 251
            ..  ||   |.. |     || . .
Sbjct: 141 IKITSELVSNGVQIYQFPTDDESVAE 166

>hg18||uc002cxr
        |16|DQ456996|Q1PBH0|Q1PBH0_HUMAN|SEPT12|NM_144605|NP_653206|septin 12

          Length = 312

 Score =  122 bits (304), Expect = 1e-027
 Identities = 57/101 (56%), Positives = 80/101 (79%), Gaps = 1/101 (0%)

Query:  46 IGIDTIIEQMRKKTMKTGFDFNIMVVGNSGLGKSTLVNTLFKSQVSRRSAGWTRDEKIPK 105
           .||. ...|.. | || ||.||||||| |||||||.|||||||.| . .         |.
Sbjct:  30 VGIEAVLDQLKIKAMKMGFEFNIMVVGQSGLGKSTMVNTLFKSKVWKSNPPGL-GVPTPQ 88

Query: 106 TVEVKAVSHVLEEGGVKMKLTVIDTPGFGDQINNENCWEPI 146
           |... ...||.|| |||.|||| |||||||||||.||  |.
Sbjct:  89 TLQLHSLTHVIEEKGVKLKLTVTDTPGFGDQINNDNCLRPL 129

>hg18||uc002cxr
        |16|DQ456996|Q1PBH0|Q1PBH0_HUMAN|SEPT12|NM_144605|NP_653206|septin 12

          Length = 312

 Score =  120 bits (300), Expect = 3e-027
 Identities = 59/94 (62%), Positives = 71/94 (75%), Gaps = 4/94 (4%)

Query: 251 DKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQVNAKRVLGRKTAWGIVEVENPNHCEFA 310
           |.  |||| |   |    . .||||||.|.|. || . |||||| |||.||||  |||| 
Sbjct: 183 DEDINDKILNSKLR----DRIPFAVVGADQEHLVNGRCVLGRKTKWGIIEVENMAHCEFP 238

Query: 311 QLRDFLIRSHLQDLKEVTHNIHYETYRAKRLHEN 344
            ||| ||||||||||..||||||| ||  ||.|.
Sbjct: 239 LLRDLLIRSHLQDLKDITHNIHYENYRVIRLNES 272

>hg18||uc002jts |17|AF189713|Q9UHD8|SEPT9_HUMAN|SEPT9|NM_006640|NP_006631|septin
        9

          Length = 586

 Score =  119 bits (298), Expect = 5e-027
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 4/93 (4%)

Query: 251 DKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQVNAKRVLGRKTAWGIVEVENPNHCEFA 310
           |.   |.. |   |    | .|||||||| ||||| ||.||||| || .||||  |||||
Sbjct: 479 DEDSEDRLVNEKFR----EMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFA 534

Query: 311 QLRDFLIRSHLQDLKEVTHNIHYETYRAKRLHE 343
            ||| |||.|.|..|..| .||.| || |||.|
Sbjct: 535 YLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNE 567

>hg18||uc002jtt |17|AF189712|Q9UHD8-3|Q9UHD8-3|SEPT9|NM_006640|NP_006631|septin
        9

          Length = 422

 Score =  119 bits (298), Expect = 5e-027
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 4/93 (4%)

Query: 251 DKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQVNAKRVLGRKTAWGIVEVENPNHCEFA 310
           |.   |.. |   |    | .|||||||| ||||| ||.||||| || .||||  |||||
Sbjct: 315 DEDSEDRLVNEKFR----EMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFA 370

Query: 311 QLRDFLIRSHLQDLKEVTHNIHYETYRAKRLHE 343
            ||| |||.|.|..|..| .||.| || |||.|
Sbjct: 371 YLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNE 403

>hg18||uc002jtu |17|NM_006640|Q9UHD8-2|Q9UHD8-2|SEPT9|NM_006640|NP_006631|septin
        9

          Length = 568

 Score =  119 bits (298), Expect = 5e-027
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 4/93 (4%)

Query: 251 DKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQVNAKRVLGRKTAWGIVEVENPNHCEFA 310
           |.   |.. |   |    | .|||||||| ||||| ||.||||| || .||||  |||||
Sbjct: 461 DEDSEDRLVNEKFR----EMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFA 516

Query: 311 QLRDFLIRSHLQDLKEVTHNIHYETYRAKRLHE 343
            ||| |||.|.|..|..| .||.| || |||.|
Sbjct: 517 YLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNE 549

>hg18||uc002jtv |17|AJ312319|Q9UHD8-5|Q9UHD8-5|SEPT9|NM_006640|NP_006631|septin
        9

          Length = 579

 Score =  119 bits (298), Expect = 5e-027
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 4/93 (4%)

Query: 251 DKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQVNAKRVLGRKTAWGIVEVENPNHCEFA 310
           |.   |.. |   |    | .|||||||| ||||| ||.||||| || .||||  |||||
Sbjct: 472 DEDSEDRLVNEKFR----EMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFA 527

Query: 311 QLRDFLIRSHLQDLKEVTHNIHYETYRAKRLHE 343
            ||| |||.|.|..|..| .||.| || |||.|
Sbjct: 528 YLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNE 560

>hg18||uc002jtw |17|AJ312322|Q9UHD8-3|Q9UHD8-3|SEPT9|NM_006640|NP_006631|septin
        9

          Length = 422

 Score =  119 bits (298), Expect = 5e-027
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 4/93 (4%)

Query: 251 DKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQVNAKRVLGRKTAWGIVEVENPNHCEFA 310
           |.   |.. |   |    | .|||||||| ||||| ||.||||| || .||||  |||||
Sbjct: 315 DEDSEDRLVNEKFR----EMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFA 370

Query: 311 QLRDFLIRSHLQDLKEVTHNIHYETYRAKRLHE 343
            ||| |||.|.|..|..| .||.| || |||.|
Sbjct: 371 YLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNE 403

>hg18||uc002jty |17|AJ312320|Q9UHD8-4|Q9UHD8-4|SEPT9|NM_006640|NP_006631|septin
        9

          Length = 335

 Score =  119 bits (298), Expect = 5e-027
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 4/93 (4%)

Query: 251 DKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQVNAKRVLGRKTAWGIVEVENPNHCEFA 310
           |.   |.. |   |    | .|||||||| ||||| ||.||||| || .||||  |||||
Sbjct: 228 DEDSEDRLVNEKFR----EMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFA 283

Query: 311 QLRDFLIRSHLQDLKEVTHNIHYETYRAKRLHE 343
            ||| |||.|.|..|..| .||.| || |||.|
Sbjct: 284 YLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNE 316

>hg18||uc002cxq
        |16|NM_144605|Q8IYM1|Q8IYM1_HUMAN|SEPT12|NM_144605|NP_653206|septin 12

          Length = 358

 Score =  119 bits (297), Expect = 7e-027
 Identities = 58/94 (61%), Positives = 71/94 (75%), Gaps = 4/94 (4%)

Query: 251 DKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQVNAKRVLGRKTAWGIVEVENPNHCEFA 310
           |.  |||| |   |    . .||||||.|.|. .| . |||||| |||.||||  |||| 
Sbjct: 229 DEDINDKILNSKLR----DRIPFAVVGADQEHLMNGRCVLGRKTKWGIIEVENMAHCEFP 284

Query: 311 QLRDFLIRSHLQDLKEVTHNIHYETYRAKRLHEN 344
            ||| ||||||||||..||||||| ||  ||.|.
Sbjct: 285 LLRDLLIRSHLQDLKDITHNIHYENYRVIRLNES 318

>hg18||uc003tey
        |7|CR623918|Q309B3|Q309B3_HUMAN|SEPT7|NM_001011553|NP_001011553|cell
        division cycle 10 isoform 2

          Length = 285

 Score =  104 bits (257), Expect = 3e-022
 Identities = 47/83 (56%), Positives = 64/83 (77%)

Query: 170 IPDTRVHCCLYFISPTGHSLRQLDVEFMKRLSHSVNIIPVIAKADTMTMEERQEFKQRVR 229
           .|| || ||||||.|.|| |. ||.||||||   |||||.||||||.| || |.||... 
Sbjct:   1 MPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIM 60

Query: 230 KELEMGGIEFYPQKEFDEDMEDK 252
           ||..   |. |   | |.. |.|
Sbjct:  61 KEIQEHKIKIYEFPETDDEEENK 83

>hg18||uc003tex |7|NM_001788|Q309B3|Q309B3_HUMAN|SEPT7|NM_001788|NP_001779|cell
        division cycle 10 isoform 1

          Length = 418

 Score =  98 bits (242), Expect = 2e-020
 Identities = 48/116 (41%), Positives = 77/116 (66%), Gaps = 6/116 (5%)

Query: 226 QRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQVN 285
           |. .|.. |  |. .  | ..    |  . .|.   .     .. .| |||||.   .||
Sbjct: 186 QQFKKQI-MKEIQEHKIKIYEFPETDDEEENKLVKKI-----KDRLPLAVVGSNTIIEVN 239

Query: 286 AKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAKRL 341
            ||| ||.  ||. ||||  ||.|  ||. |||.|.||||.||.|.||| ||...|
Sbjct: 240 GKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKL 295

>hg18||uc003tey
        |7|CR623918|Q309B3|Q309B3_HUMAN|SEPT7|NM_001011553|NP_001011553|cell
        division cycle 10 isoform 2

          Length = 285

 Score =  98 bits (242), Expect = 2e-020
 Identities = 48/116 (41%), Positives = 77/116 (66%), Gaps = 6/116 (5%)

Query: 226 QRVRKELEMGGIEFYPQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEYQVN 285
           |. .|.. |  |. .  | ..    |  . .|.   .     .. .| |||||.   .||
Sbjct:  53 QQFKKQI-MKEIQEHKIKIYEFPETDDEEENKLVKKI-----KDRLPLAVVGSNTIIEVN 106

Query: 286 AKRVLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAKRL 341
            ||| ||.  ||. ||||  ||.|  ||. |||.|.||||.||.|.||| ||...|
Sbjct: 107 GKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKL 162

>hg18||uc002dxx |16|CR615337|Q658T1|Q658T1_HUMAN|DKFZp666C094|NA|NA|Septin
        (Fragment)

          Length = 192

 Score =  96 bits (238), Expect = 5e-020
 Identities = 53/120 (44%), Positives = 78/120 (65%), Gaps = 12/120 (10%)

Query: 225 KQRVRKELEMGGIEFY--PQKEFDEDMEDKSDNDKIRNHVTRLCPQEAMPFAVVGSDKEY 282
           ||..| .|.   |  |  |. . ||| . |  . ...         |..||||||| .  
Sbjct:   9 KQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMK---------ESIPFAVVGSCEVV 59

Query: 283 QVNAKR-VLGRKTAWGIVEVENPNHCEFAQLRDFLIRSHLQDLKEVTHNIHYETYRAKRL 341
           .    | | ||. .|| ||||||.||.|  ||  |...||||||||||.. || |||. |
Sbjct:  60 RDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCL 119

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0