BLASTP 7.6.0


Query=fugu4_572379 |jgi|Takru4|572379|e_gw2.208.87.1
        (400 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001guk |1|NM_020204|Q86UH2|Q86UH2_HUMAN|LHX9|NM_020204|N...    616   3e-176
hg18||uc001gui |1|NM_001014434|Q9NQ69|LHX9_HUMAN|LHX9|NM_0010144...    600   2e-171
hg18||uc001guj |1|CR625363|Q5VUE2|Q5VUE2_HUMAN|LHX9|NA|NA|LIM ho...    490   1e-138
hg18||uc004boe |9|NM_004789|P50458|LHX2_HUMAN|LHX2|NM_004789|NP_...    241   2e-063
hg18||uc004boe |9|NM_004789|P50458|LHX2_HUMAN|LHX2|NM_004789|NP_...    236   3e-062
hg18||uc002bbw |15|NM_145805|Q96A47|ISL2_HUMAN|ISL2|NM_145805|NP...     96   6e-020
hg18||uc001rdj |12|AB044745|Q58A66|Q58A66_HUMAN|LMO3|NM_018640|N...     84   2e-016
hg18||uc001rdk |12|NM_018640|Q8TAP4|LMO3_HUMAN|LMO3|NM_018640|NP...     84   2e-016
hg18||uc001rdl |12|BC050085|Q8TAP4|LMO3_HUMAN|LMO3|NM_018640|NP_...     84   2e-016
hg18||uc001rdm |12|NM_001001395|Q8TAP4|LMO3_HUMAN|LMO3|NM_001001...     84   2e-016
hg18||uc001rdn |12|AB044746|Q8TAP4|LMO3_HUMAN|LMO3|NM_018640|NP_...     84   2e-016
hg18||uc001mgg |11|NM_002315|P25800|RBTN1_HUMAN|LMO1|NM_002315|N...     82   1e-015
hg18||uc001dmi |1|NM_006769|P61968|LMO4_HUMAN|LMO4|NM_006769|NP_...     81   2e-015
hg18||uc001dmj |1|BC065818|P61968|LMO4_HUMAN|LMO4|NM_006769|NP_0...     81   2e-015
hg18||uc001mgh |11|BC039512|Q8IXR0|Q8IXR0_HUMAN|LMO1|NM_002315|N...     81   2e-015
hg18||uc001dgo |1|NM_001001933|Q68G74|Q68G74_HUMAN|LHX8|NM_00100...     74   4e-013
hg18||uc001dgq |1|BC036423|NA|NA|LHX8|NA|NA|Homo sapiens cDNA cl...     74   4e-013
hg18||uc004blx |9|NM_014368|Q9UPM6|LHX61_HUMAN|LHX6|NM_014368|NP...     72   1e-012
hg18||uc004bly |9|NM_199160|Q5T7S7|Q5T7S7_HUMAN|LHX6|NM_199160|N...     72   1e-012
hg18||uc001xcp |14|NM_172337|P32243|OTX2_HUMAN|OTX2|NM_172337|NP...     65   1e-010
hg18||uc001ghe |1|NM_006902|P54821-2|P54821-2|PRRX1|NM_006902|NP...     65   1e-010
hg18||uc001ghf |1|NM_022716|P54821|PRRX1_HUMAN|PRRX1|NM_022716|N...     64   2e-010
hg18||uc003kfg |5|NM_032109|Q5XKR4|Q5XKR4_HUMAN|OTP|NM_032109|NP...     64   2e-010
hg18||uc002wuf |20|NM_014588|Q9NZR4|VSX1_HUMAN|VSX1|NM_014588|NP...     64   4e-010
hg18||uc001xcq |14|NM_021728|P32243-2|P32243-2|OTX2|NM_021728|NP...     63   5e-010
hg18||uc002bbw |15|NM_145805|Q96A47|ISL2_HUMAN|ISL2|NM_145805|NP...     62   9e-010
hg18||uc001wkd |14|NM_033400|Q9C0A1|ZFHX2_HUMAN|ZFHX2|NM_033400|...     62   2e-009
hg18||uc001jhq |10|NM_001080520|NA|NA|LOC644168|NM_001080520|NP_...     61   2e-009
hg18||uc004byh |9|NM_016307|Q99811|PRRX2_HUMAN|PRRX2|NM_016307|N...     60   3e-009
hg18||uc003gwf |4|NM_003924|Q99453|PHX2B_HUMAN|PHOX2B|NM_003924|...     60   4e-009
hg18||uc004dbp |X|NM_139058|Q96QS3|ARX_HUMAN|ARX|NM_139058|NP_62...     60   4e-009
hg18||uc001osh |11|NM_005169|O14813|PHX2A_HUMAN|PHOX2A|NM_005169...     60   6e-009
hg18||uc001tvj |12|NM_022363|Q9H2C1|LHX5_HUMAN|LHX5|NM_022363|NP...     60   6e-009
hg18||uc003jor |5|NM_002202|P61371|ISL1_HUMAN|ISL1|NM_002202|NP_...     59   7e-009
hg18||uc002hnh |17|NM_005568|P48742|LHX1_HUMAN|LHX1|NM_005568|NP...     59   1e-008
hg18||uc003yau |8|AB083343|Q18PS0|Q18PS0_HUMAN|ZFHX4|NM_024721|N...     59   1e-008
hg18||uc003yav |8|NM_024721|Q86UP3|Q86UP3_HUMAN|ZFHX4|NM_024721|...     59   1e-008
hg18||uc003yaw |8|AY260762|Q86UP3|Q86UP3_HUMAN|ZFHX4|NM_024721|N...     59   1e-008
hg18||uc002fck |16|NM_006885|Q15911|ATBF1_HUMAN|ATBF1|NM_006885|...     57   3e-008
hg18||uc002fcl |16|D10250|Q15911-2|Q15911-2|ATBF1|NA|NA|Alpha-fe...     57   3e-008
hg18||uc001myb |11|NM_021926|Q9H161|ALX4_HUMAN|ALX4|NM_021926|NP...     57   4e-008
hg18||uc001gcy |1|NM_177398|Q8TE12|LMX1A_HUMAN|LMX1A|NM_177398|N...     57   5e-008
hg18||uc001gcz |1|AK122800|Q8TE12|LMX1A_HUMAN|LMX1A|NM_177398|NP...     57   5e-008
hg18||uc002lyr |19|NM_032753|Q96IS3|Q96IS3_HUMAN|RAXL1|NM_032753...     57   5e-008
hg18||uc002lys |19|AY211277|Q96IS3|Q96IS3_HUMAN|RAXL1|NM_032753|...     57   5e-008
hg18||uc001tae |12|NM_006982|Q15699|CART1_HUMAN|CART1|NM_006982|...     56   8e-008
hg18||uc004ely |X|NM_153448|Q8N693|ESX1L_HUMAN|ESX1|NM_153448|NP...     56   8e-008
hg18||uc001ldh |10|NM_004098|Q04743|EMX2_HUMAN|EMX2|NM_004098|NP...     55   1e-007
hg18||uc001dzb |1|NM_006492|Q5T8M4|Q5T8M4_HUMAN|ALX3|NM_006492|N...     55   1e-007
hg18||uc002lhx |18|NM_013435|Q9Y2V3|RX_HUMAN|RAX|NM_013435|NP_03...     55   1e-007
hg18||uc004cph |X|NM_000451|O15266|SHOX_HUMAN|SHOX|NM_000451|NP_...     55   1e-007
hg18||uc004cpi |X|NM_006883|Q5HYX6|Q5HYX6_HUMAN|SHOX|NM_006883|N...     55   1e-007
hg18||uc004fou |Y|NM_000451|O15266|SHOX_HUMAN|SHOX|NM_000451|NP_...     55   1e-007
hg18||uc004fov |Y|NM_006883|Q5HYX6|Q5HYX6_HUMAN|SHOX|NM_006883|N...     55   1e-007
hg18||uc001bay |1|NM_002584|P23759|PAX7_HUMAN|PAX7|NM_002584|NP_...     55   2e-007
hg18||uc001baz |1|NM_013945|Q0VA99|Q0VA99_HUMAN|PAX7|NM_013945|N...     55   2e-007
hg18||uc003yau |8|AB083343|Q18PS0|Q18PS0_HUMAN|ZFHX4|NM_024721|N...     54   2e-007
hg18||uc003yav |8|NM_024721|Q86UP3|Q86UP3_HUMAN|ZFHX4|NM_024721|...     54   2e-007
hg18||uc003yaw |8|AY260762|Q86UP3|Q86UP3_HUMAN|ZFHX4|NM_024721|N...     54   2e-007
hg18||uc001mtd |11|AK074881|P26367|PAX6_HUMAN|PAX6|NM_000280|NP_...     54   3e-007
hg18||uc001mte |11|M77844|P26367|PAX6_HUMAN|PAX6|NM_000280|NP_00...     54   3e-007
hg18||uc001mtf |11|NM_000280|P26367|PAX6_HUMAN|PAX6|NM_000280|NP...     54   3e-007
hg18||uc001mtg |11|NM_001604|P26367-2|P26367-2|PAX6|NM_001604|NP...     54   3e-007
hg18||uc001mth |11|BC011953|P26367|PAX6_HUMAN|PAX6|NM_000280|NP_...     54   3e-007
hg18||uc002fck |16|NM_006885|Q15911|ATBF1_HUMAN|ATBF1|NM_006885|...     54   3e-007
hg18||uc002fcl |16|D10250|Q15911-2|Q15911-2|ATBF1|NA|NA|Alpha-fe...     54   3e-007
hg18||uc003fbq |3|NM_003030|NA|NA|SHOX2|NM_003030|NP_003021|shor...     54   4e-007
hg18||uc003fbr |3|NM_006884|O60902|SHOX2_HUMAN|SHOX2|NM_006884|N...     54   4e-007
hg18||uc003fbs |3|BC008829|O60902|SHOX2_HUMAN|SHOX2|NM_006884|NP...     54   4e-007
hg18||uc002scd |2|NM_014562|P32242|OTX1_HUMAN|OTX1|NM_014562|NP_...     53   5e-007
hg18||uc002sil |2|NM_001040404|Q04741-2|Q04741-2|EMX1|NM_0010404...     53   5e-007
hg18||uc002sin |2|NM_004097|NA|NA|EMX1|NM_004097|NP_004088|empty...     53   5e-007
hg18||uc001wkd |14|NM_033400|Q9C0A1|ZFHX2_HUMAN|ZFHX2|NM_033400|...     53   7e-007
hg18||uc004bqi |9|NM_002316|Q6ISC9|Q6ISC9_HUMAN|LMX1B|NM_002316|...     53   7e-007
hg18||uc004bqj |9|BC069588|Q6ISE0|Q6ISE0_HUMAN|LMX1B|NM_002316|N...     53   7e-007
hg18||uc002vmt |2|NM_181459|Q494Z3|Q494Z3_HUMAN|PAX3|NM_181459|N...     52   9e-007
hg18||uc002vmu |2|NM_181457|P23760|PAX3_HUMAN|PAX3|NM_181457|NP_...     52   9e-007
hg18||uc002vmv |2|NM_181458|Q494Z3|Q494Z3_HUMAN|PAX3|NM_181458|N...     52   9e-007
hg18||uc002vmw |2|NM_181460|Q86UQ2|Q86UQ2_HUMAN|PAX3|NM_181460|N...     52   9e-007
hg18||uc002vmx |2|NM_181461|Q86UQ3|Q86UQ3_HUMAN|PAX3|NM_181461|N...     52   9e-007
hg18||uc002vmy |2|BC114363|Q494Z4|Q494Z4_HUMAN|PAX3|NM_181458|NP...     52   9e-007
hg18||uc004cgz |9|NM_014564|Q9UBR4-2|Q9UBR4-2|LHX3|NM_014564|NP_...     52   9e-007
hg18||uc004cha |9|NM_178138|Q9UBR4|LHX3_HUMAN|LHX3|NM_178138|NP_...     52   9e-007
hg18||uc002fck |16|NM_006885|Q15911|ATBF1_HUMAN|ATBF1|NM_006885|...     52   1e-006
hg18||uc002fcl |16|D10250|Q15911-2|Q15911-2|ATBF1|NA|NA|Alpha-fe...     52   1e-006
hg18||uc001xpq |14|NM_182894|P58304|CHX10_HUMAN|CHX10|NM_182894|...     52   2e-006
hg18||uc003ani |22|CR749372|Q68DJ5|Q68DJ5_HUMAN|ISX|NM_001008494...     52   2e-006
hg18||uc003anj |22|NM_001008494|Q68DJ5|Q68DJ5_HUMAN|ISX|NM_00100...     52   2e-006
hg18||uc001cpw |1|NM_172225|Q8NFW5-2|Q8NFW5-2|DMBX1|NM_172225|NP...     51   2e-006
hg18||uc001cpx |1|NM_147192|Q8NFW5|DMBX1_HUMAN|DMBX1|NM_147192|N...     51   2e-006
hg18||uc001wkd |14|NM_033400|Q9C0A1|ZFHX2_HUMAN|ZFHX2|NM_033400|...     51   2e-006
hg18||uc001goe |1|NM_033343|Q969G2|LHX4_HUMAN|LHX4|NM_033343|NP_...     51   3e-006
hg18||uc003mif |5|NM_006261|O75360|PROP1_HUMAN|PROP1|NM_006261|N...     51   3e-006
hg18||uc002phq |19|NM_000554|O43186|CRX_HUMAN|CRX|NM_000554|NP_0...     50   6e-006
hg18||uc003yau |8|AB083343|Q18PS0|Q18PS0_HUMAN|ZFHX4|NM_024721|N...     50   6e-006
hg18||uc003yav |8|NM_024721|Q86UP3|Q86UP3_HUMAN|ZFHX4|NM_024721|...     50   6e-006
hg18||uc003yaw |8|AY260762|Q86UP3|Q86UP3_HUMAN|ZFHX4|NM_024721|N...     50   6e-006
hg18||uc003din |3|NM_003865|Q9UBX0|HESX1_HUMAN|HESX1|NM_003865|N...     49   8e-006
hg18||uc003ikv |4|NM_004575|Q12837|PO4F2_HUMAN|POU4F2|NM_004575|...     49   8e-006
hg18||uc003loa |5|NM_002700|Q15319|PO4F3_HUMAN|POU4F3|NM_002700|...     49   8e-006

>hg18||uc001guk |1|NM_020204|Q86UH2|Q86UH2_HUMAN|LHX9|NM_020204|NP_064589|LIM
        homeobox 9 isoform 1

          Length = 397

 Score =  616 bits (1586), Expect = 3e-176
 Identities = 304/398 (76%), Positives = 326/398 (81%), Gaps = 4/398 (1%)

Query:   3 VVGCKAEADSCTLRPGPGAMLFHGISGDHIQGIMEEMERRSKTESRLAKGMQLNGRESTM 62
           .|||.|| .||  |  | ||||||||| ||||||||||||||||.||||| |||||.. |
Sbjct:   3 IVGCRAEDNSCPFR--PPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGM 60

Query:  63 PSMSPEKPALCAGCGGKISDRYYLLAVDKQWHLRXXXXXXXXXXXXXXXTCFAKDGSIYC 122
           | .|||||||||||||||||||||||||||||||               |||||||||||
Sbjct:  61 PPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYC 120

Query: 123 KEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSXXXXXXXXXXXXXGDHFGMKDSL 182
           |||||||||||||||||||||||||||||||||||||             ||||||||||
Sbjct: 121 KEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSL 180

Query: 183 VYCRLHFETLVQGPDYHAQLNFAELAAKGGGLSLPYFNGTGTAQKGRPRKRKSPAMGIDI 242
           |||| |||||.|| .|  ||.. ||||| |||.||||||||| ||||||||||||.|.||
Sbjct: 181 VYCRAHFETLLQG-EYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDI 239

Query: 243 SSYNTGCNENDTDHLDRDQQAYPPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQ 302
            .||.|||||. |||||||| |||.|||||||||||||||||||||||||||||||||||
Sbjct: 240 VNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQ 299

Query: 303 LAQKTGLTKRVLQVWFQNARAKFRRNILRQENGGVDKADGTSVP-PPSSDSGALTPPSSA 361
           ||||||||||||||||||||||||||.|||||||||||||||.| |||.|||||||| .|
Sbjct: 300 LAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTA 359

Query: 362 ATLTDLTNPXXXXXXXXXXXXXXXXXXXXXQTTLTNLF 399
            ||||||||                     ||||||||
Sbjct: 360 TTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF 397

>hg18||uc001gui
        |1|NM_001014434|Q9NQ69|LHX9_HUMAN|LHX9|NM_001014434|NP_001014434|LIM
        homeobox 9 isoform 2

          Length = 388

 Score =  600 bits (1545), Expect = 2e-171
 Identities = 295/380 (77%), Positives = 314/380 (82%), Gaps = 2/380 (0%)

Query:  21 AMLFHGISGDHIQGIMEEMERRSKTESRLAKGMQLNGRESTMPSMSPEKPALCAGCGGKI 80
           ||||||||| ||||||||||||||||.||||| |||||.. || .|||||||||||||||
Sbjct:  10 AMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPALCAGCGGKI 69

Query:  81 SDRYYLLAVDKQWHLRXXXXXXXXXXXXXXXTCFAKDGSIYCKEDYYRRFSVQRCARCHL 140
           ||||||||||||||||               |||||||||||||||||||||||||||||
Sbjct:  70 SDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHL 129

Query: 141 GISASEMVMRARDSVYHLSXXXXXXXXXXXXXGDHFGMKDSLVYCRLHFETLVQGPDYHA 200
           |||||||||||||||||||             |||||||||||||| |||||.|| .|  
Sbjct: 130 GISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQG-EYPP 188

Query: 201 QLNFAELAAKGGGLSLPYFNGTGTAQKGRPRKRKSPAMGIDISSYNTGCNENDTDHLDRD 260
           ||.. ||||| |||.||||||||| ||||||||||||.|.|| .||.|||||. ||||||
Sbjct: 189 QLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNENEADHLDRD 248

Query: 261 QQAYPPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQN 320
           || |||.|||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 249 QQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQN 308

Query: 321 ARAKFRRNILRQENGGVDKADGTSVP-PPSSDSGALTPPSSAATLTDLTNPXXXXXXXXX 379
           ||||||||.|||||||||||||||.| |||.|||||||| .| ||||||||         
Sbjct: 309 ARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTSVT 368

Query: 380 XXXXXXXXXXXXQTTLTNLF 399
                       ||||||||
Sbjct: 369 SNMDSHESGSPSQTTLTNLF 388

>hg18||uc001guj |1|CR625363|Q5VUE2|Q5VUE2_HUMAN|LHX9|NA|NA|LIM homeobox 9

          Length = 336

 Score =  490 bits (1261), Expect = 1e-138
 Identities = 238/295 (80%), Positives = 253/295 (85%), Gaps = 1/295 (0%)

Query:  21 AMLFHGISGDHIQGIMEEMERRSKTESRLAKGMQLNGRESTMPSMSPEKPALCAGCGGKI 80
           ||||||||| ||||||||||||||||.||||| |||||.. || .|||||||||||||||
Sbjct:  25 AMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPALCAGCGGKI 84

Query:  81 SDRYYLLAVDKQWHLRXXXXXXXXXXXXXXXTCFAKDGSIYCKEDYYRRFSVQRCARCHL 140
           ||||||||||||||||               |||||||||||||||||||||||||||||
Sbjct:  85 SDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHL 144

Query: 141 GISASEMVMRARDSVYHLSXXXXXXXXXXXXXGDHFGMKDSLVYCRLHFETLVQGPDYHA 200
           |||||||||||||||||||             |||||||||||||| |||||.|| .|  
Sbjct: 145 GISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQG-EYPP 203

Query: 201 QLNFAELAAKGGGLSLPYFNGTGTAQKGRPRKRKSPAMGIDISSYNTGCNENDTDHLDRD 260
           ||.. ||||| |||.||||||||| ||||||||||||.|.|| .||.|||||. ||||||
Sbjct: 204 QLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNENEADHLDRD 263

Query: 261 QQAYPPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 315
           || |||.||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264 QQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 318

>hg18||uc004boe |9|NM_004789|P50458|LHX2_HUMAN|LHX2|NM_004789|NP_004780|LIM
        homeobox protein 2

          Length = 406

 Score =  241 bits (613), Expect = 2e-063
 Identities = 119/205 (58%), Positives = 143/205 (69%), Gaps = 2/205 (0%)

Query:  22 MLFHGISGDHIQGIMEEMERRSKTES-RLAKGMQLNGRESTMPSMSPEKPALCAGCGGKI 80
           |||| .||  . |...||.||.|.|.  ..  .     |.||||.| .. ||||||||||
Sbjct:   1 MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKI 60

Query:  81 SDRYYLLAVDKQWHLRXXXXXXXXXXXXXXXTCFAKDGSIYCKEDYYRRFSVQRCARCHL 140
           ||||||||||||||.|               |||.|||||||||||||||||||||||||
Sbjct:  61 SDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHL 120

Query: 141 GISASEMVMRARDSVYHLSXXXXXXXXXXXXXGDHFGMKDSLVYCRLHFETLVQGPDYHA 200
           ||||||||||||| ||||.             |||||||||||||||||| |.|| .| |
Sbjct: 121 GISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQG-EYPA 179

Query: 201 QLNFAELAAKGGGLSLPYFNGTGTA 225
             | |..||     .     | | |
Sbjct: 180 HFNHADVAAAAAAAAAAKSAGLGAA 204

>hg18||uc004boe |9|NM_004789|P50458|LHX2_HUMAN|LHX2|NM_004789|NP_004780|LIM
        homeobox protein 2

          Length = 406

 Score =  236 bits (602), Expect = 3e-062
 Identities = 124/172 (72%), Positives = 135/172 (78%), Gaps = 10/172 (5%)

Query: 208 AAKGGGLSLPYFNGTGTAQKGRPRKRKSPAMGIDISSYNT--GCNENDTDHLDRDQQAYP 265
           ||    | |||.|| || |||||||||||  | |...||    ||||| .||||| | ||
Sbjct: 203 AAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNENDAEHLDRD-QPYP 261

Query: 266 PTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKF 325
            .||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 262 SSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKF 321

Query: 326 RRNILRQENGGVDKA------DGTSVPPPSSDSGA-LTPPSSAATLTDLTNP 370
           |||.||||| ||||.       ||   | |  | | |.| |.  ||||||.|
Sbjct: 322 RRNLLRQENTGVDKSTDAALQTGTPSGPASELSNASLSPSSTPTTLTDLTSP 373

>hg18||uc002bbw |15|NM_145805|Q96A47|ISL2_HUMAN|ISL2|NM_145805|NP_665804|ISL2
        transcription factor, LIM/homeodomain,

          Length = 359

 Score =  96 bits (238), Expect = 6e-020
 Identities = 49/136 (36%), Positives = 72/136 (52%), Gaps = 4/136 (2%)

Query:  62 MPSMSPEKP--ALCAGCGGKISDRYYL-LAVDKQWHLRXXXXXXXXXXXXXXXTCFAKDG 118
           |   | .||  |.| ||| .| |.. | .. | .||                 ||| .||
Sbjct:  14 MGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDG 73

Query: 119 SIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSXXXXXXXXXXXXXGDHFGM 178
             ||| || | | . .||.| .| |.|..||||||||||.              || | .
Sbjct:  74 KTYCKRDYVRLFGI-KCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSL 132

Query: 179 KDSLVYCRLHFETLVQ 194
           ..  . ||     |..
Sbjct: 133 REHELLCRADHGLLLE 148

>hg18||uc001rdj |12|AB044745|Q58A66|Q58A66_HUMAN|LMO3|NM_018640|NP_061110|LIM
        domain only 3

          Length = 156

 Score =  84 bits (207), Expect = 2e-016
 Identities = 53/144 (36%), Positives = 69/144 (47%), Gaps = 3/144 (2%)

Query:  62 MPSMSPE-KPALCAGCGGKISDRYYLLAVDKQWHLR-XXXXXXXXXXXXXXXTCFAKDGS 119
           | |. |. ||  ||||  || ||| | |.|| ||                  | . |   
Sbjct:  12 MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANL 71

Query: 120 IYCKEDYYRRFSVQ-RCARCHLGISASEMVMRARDSVYHLSXXXXXXXXXXXXXGDHFGM 178
           | |. || | | |   || |   | | ||||||.|.||||              || | .
Sbjct:  72 ILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFL 131

Query: 179 KDSLVYCRLHFETLVQGPDYHAQL 202
           |.... |.  .|  .    |  |.
Sbjct: 132 KNNMILCQTDYEEGLMKEGYAPQV 155

>hg18||uc001rdk |12|NM_018640|Q8TAP4|LMO3_HUMAN|LMO3|NM_018640|NP_061110|LIM
        domain only 3

          Length = 145

 Score =  84 bits (207), Expect = 2e-016
 Identities = 53/144 (36%), Positives = 69/144 (47%), Gaps = 3/144 (2%)

Query:  62 MPSMSPE-KPALCAGCGGKISDRYYLLAVDKQWHLR-XXXXXXXXXXXXXXXTCFAKDGS 119
           | |. |. ||  ||||  || ||| | |.|| ||                  | . |   
Sbjct:   1 MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANL 60

Query: 120 IYCKEDYYRRFSVQ-RCARCHLGISASEMVMRARDSVYHLSXXXXXXXXXXXXXGDHFGM 178
           | |. || | | |   || |   | | ||||||.|.||||              || | .
Sbjct:  61 ILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFL 120

Query: 179 KDSLVYCRLHFETLVQGPDYHAQL 202
           |.... |.  .|  .    |  |.
Sbjct: 121 KNNMILCQTDYEEGLMKEGYAPQV 144

>hg18||uc001rdl |12|BC050085|Q8TAP4|LMO3_HUMAN|LMO3|NM_018640|NP_061110|LIM
        domain only 3

          Length = 145

 Score =  84 bits (207), Expect = 2e-016
 Identities = 53/144 (36%), Positives = 69/144 (47%), Gaps = 3/144 (2%)

Query:  62 MPSMSPE-KPALCAGCGGKISDRYYLLAVDKQWHLR-XXXXXXXXXXXXXXXTCFAKDGS 119
           | |. |. ||  ||||  || ||| | |.|| ||                  | . |   
Sbjct:   1 MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANL 60

Query: 120 IYCKEDYYRRFSVQ-RCARCHLGISASEMVMRARDSVYHLSXXXXXXXXXXXXXGDHFGM 178
           | |. || | | |   || |   | | ||||||.|.||||              || | .
Sbjct:  61 ILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFL 120

Query: 179 KDSLVYCRLHFETLVQGPDYHAQL 202
           |.... |.  .|  .    |  |.
Sbjct: 121 KNNMILCQTDYEEGLMKEGYAPQV 144

>hg18||uc001rdm
        |12|NM_001001395|Q8TAP4|LMO3_HUMAN|LMO3|NM_001001395|NP_001001395|LIM
        domain only 3

          Length = 145

 Score =  84 bits (207), Expect = 2e-016
 Identities = 53/144 (36%), Positives = 69/144 (47%), Gaps = 3/144 (2%)

Query:  62 MPSMSPE-KPALCAGCGGKISDRYYLLAVDKQWHLR-XXXXXXXXXXXXXXXTCFAKDGS 119
           | |. |. ||  ||||  || ||| | |.|| ||                  | . |   
Sbjct:   1 MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANL 60

Query: 120 IYCKEDYYRRFSVQ-RCARCHLGISASEMVMRARDSVYHLSXXXXXXXXXXXXXGDHFGM 178
           | |. || | | |   || |   | | ||||||.|.||||              || | .
Sbjct:  61 ILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFL 120

Query: 179 KDSLVYCRLHFETLVQGPDYHAQL 202
           |.... |.  .|  .    |  |.
Sbjct: 121 KNNMILCQTDYEEGLMKEGYAPQV 144

>hg18||uc001rdn |12|AB044746|Q8TAP4|LMO3_HUMAN|LMO3|NM_018640|NP_061110|LIM
        domain only 3

          Length = 145

 Score =  84 bits (207), Expect = 2e-016
 Identities = 53/144 (36%), Positives = 69/144 (47%), Gaps = 3/144 (2%)

Query:  62 MPSMSPE-KPALCAGCGGKISDRYYLLAVDKQWHLR-XXXXXXXXXXXXXXXTCFAKDGS 119
           | |. |. ||  ||||  || ||| | |.|| ||                  | . |   
Sbjct:   1 MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANL 60

Query: 120 IYCKEDYYRRFSVQ-RCARCHLGISASEMVMRARDSVYHLSXXXXXXXXXXXXXGDHFGM 178
           | |. || | | |   || |   | | ||||||.|.||||              || | .
Sbjct:  61 ILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFL 120

Query: 179 KDSLVYCRLHFETLVQGPDYHAQL 202
           |.... |.  .|  .    |  |.
Sbjct: 121 KNNMILCQTDYEEGLMKEGYAPQV 144

>hg18||uc001mgg |11|NM_002315|P25800|RBTN1_HUMAN|LMO1|NM_002315|NP_002306|LIM
        domain only 1

          Length = 156

 Score =  82 bits (201), Expect = 1e-015
 Identities = 51/143 (35%), Positives = 69/143 (48%), Gaps = 5/143 (3%)

Query:  53 MQLNGRESTMPSMSPE---KPALCAGCGGKISDRYYLLAVDKQWHLR-XXXXXXXXXXXX 108
           | .  .|  .| .| .   |   ||||  || ||| | |.|| ||               
Sbjct:   1 MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGE 60

Query: 109 XXXTCFAKDGSIYCKEDYYRRF-SVQRCARCHLGISASEMVMRARDSVYHLSXXXXXXXX 167
              | . |   | |. || | | .   || |   | | ||||||||.||||         
Sbjct:  61 VGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCN 120

Query: 168 XXXXXGDHFGMKDSLVYCRLHFE 190
                || | .|.... |.. .|
Sbjct: 121 QRFCVGDKFFLKNNMILCQMDYE 143

>hg18||uc001dmi |1|NM_006769|P61968|LMO4_HUMAN|LMO4|NM_006769|NP_006760|LIM
        domain only 4

          Length = 165

 Score =  81 bits (199), Expect = 2e-015
 Identities = 44/115 (38%), Positives = 57/115 (49%), Gaps = 2/115 (1%)

Query:  73 CAGCGGKISDRYYLLAVDKQWHLRXXXXXXXXXXXXXXXT-CFAKDGSIYCKEDYYRRF- 130
           ||||||||.||. | |.|  || |               | |. | | | |. || | | 
Sbjct:  23 CAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFG 82

Query: 131 SVQRCARCHLGISASEMVMRARDSVYHLSXXXXXXXXXXXXXGDHFGMKDSLVYC 185
           .   |. |   | |||.||||. .||||              || |   .  ..|
Sbjct:  83 NSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFC 137

>hg18||uc001dmj |1|BC065818|P61968|LMO4_HUMAN|LMO4|NM_006769|NP_006760|LIM
        domain only 4

          Length = 165

 Score =  81 bits (199), Expect = 2e-015
 Identities = 44/115 (38%), Positives = 57/115 (49%), Gaps = 2/115 (1%)

Query:  73 CAGCGGKISDRYYLLAVDKQWHLRXXXXXXXXXXXXXXXT-CFAKDGSIYCKEDYYRRF- 130
           ||||||||.||. | |.|  || |               | |. | | | |. || | | 
Sbjct:  23 CAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFG 82

Query: 131 SVQRCARCHLGISASEMVMRARDSVYHLSXXXXXXXXXXXXXGDHFGMKDSLVYC 185
           .   |. |   | |||.||||. .||||              || |   .  ..|
Sbjct:  83 NSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFC 137

>hg18||uc001mgh |11|BC039512|Q8IXR0|Q8IXR0_HUMAN|LMO1|NM_002315|NP_002306|LIM
        domain only 1

          Length = 155

 Score =  81 bits (198), Expect = 2e-015
 Identities = 50/138 (36%), Positives = 67/138 (48%), Gaps = 5/138 (3%)

Query:  58 RESTMPSMSPE---KPALCAGCGGKISDRYYLLAVDKQWHLR-XXXXXXXXXXXXXXXTC 113
           .|  .| .| .   |   ||||  || ||| | |.|| ||                  | 
Sbjct:   5 QEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTL 64

Query: 114 FAKDGSIYCKEDYYRRF-SVQRCARCHLGISASEMVMRARDSVYHLSXXXXXXXXXXXXX 172
           . |   | |. || | | .   || |   | | ||||||||.||||              
Sbjct:  65 YTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCV 124

Query: 173 GDHFGMKDSLVYCRLHFE 190
           || | .|.... |.. .|
Sbjct: 125 GDKFFLKNNMILCQMDYE 142

>hg18||uc001dgo
        |1|NM_001001933|Q68G74|Q68G74_HUMAN|LHX8|NM_001001933|NP_001001933|LIM
        homeobox 8

          Length = 356

 Score =  74 bits (179), Expect = 4e-013
 Identities = 35/77 (45%), Positives = 55/77 (71%), Gaps = 3/77 (3%)

Query: 271 KRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNIL 330
           || ||||   ||. |.. || ..||||. |..||..|||..||.|||||| ||. .... 
Sbjct: 226 KRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVS 285

Query: 331 RQENGGVDKADGTSVPP 347
              .        |.|||
Sbjct: 286 PNHSSSTPV---TAVPP 299

>hg18||uc001dgq |1|BC036423|NA|NA|LHX8|NA|NA|Homo sapiens cDNA clone
        IMAGE:4797854, containing frame-shift errors

          Length = 295

 Score =  74 bits (179), Expect = 4e-013
 Identities = 35/77 (45%), Positives = 55/77 (71%), Gaps = 3/77 (3%)

Query: 271 KRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNIL 330
           || ||||   ||. |.. || ..||||. |..||..|||..||.|||||| ||. .... 
Sbjct: 165 KRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVS 224

Query: 331 RQENGGVDKADGTSVPP 347
              .        |.|||
Sbjct: 225 PNHSSSTPV---TAVPP 238

>hg18||uc004blx |9|NM_014368|Q9UPM6|LHX61_HUMAN|LHX6|NM_014368|NP_055183|LIM
        homeobox protein 6 isoform 1

          Length = 363

 Score =  72 bits (174), Expect = 1e-012
 Identities = 43/103 (41%), Positives = 62/103 (60%), Gaps = 5/103 (4%)

Query: 258 DRDQQAYPPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVW 317
           ..| |  |     || ||||   ||. |.. || ..||||. |..||  |||..||.|||
Sbjct: 211 EQDSQPKP----AKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVW 266

Query: 318 FQNARAKFRRNILRQENGGVDKADGTSVPPPSSDSGALTPPSS 360
           ||| ||. ...   |       |  . .|   ||    || ||
Sbjct: 267 FQNCRARHKKH-TPQHPVPPSGAPPSRLPSALSDDIHYTPFSS 308

>hg18||uc004bly |9|NM_199160|Q5T7S7|Q5T7S7_HUMAN|LHX6|NM_199160|NP_954629|LIM
        homeobox protein 6 isoform 2

          Length = 348

 Score =  72 bits (174), Expect = 1e-012
 Identities = 43/103 (41%), Positives = 62/103 (60%), Gaps = 5/103 (4%)

Query: 258 DRDQQAYPPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVW 317
           ..| |  |     || ||||   ||. |.. || ..||||. |..||  |||..||.|||
Sbjct: 211 EQDSQPKP----AKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVW 266

Query: 318 FQNARAKFRRNILRQENGGVDKADGTSVPPPSSDSGALTPPSS 360
           ||| ||. ...   |       |  . .|   ||    || ||
Sbjct: 267 FQNCRARHKKH-TPQHPVPPSGAPPSRLPSALSDDIHYTPFSS 308

>hg18||uc001xcp
        |14|NM_172337|P32243|OTX2_HUMAN|OTX2|NM_172337|NP_758840|orthodenticle
        homeobox 2 isoform b

          Length = 289

 Score =  65 bits (158), Expect = 1e-010
 Identities = 41/111 (36%), Positives = 59/111 (53%), Gaps = 9/111 (8%)

Query: 264 YPPT-QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNAR 322
           || | .| .| ||.|   ||  ... ||    ||    ...| |  | .  .||||.| |
Sbjct:  31 YPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRR 90

Query: 323 AKFRRNILRQENGGVDK--------ADGTSVPPPSSDSGALTPPSSAATLT 365
           || |.   .|.||| .|        .    |   |  ||  ||||| .  |
Sbjct:  91 AKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPT 141

>hg18||uc001ghe |1|NM_006902|P54821-2|P54821-2|PRRX1|NM_006902|NP_008833|paired
        mesoderm homeobox 1 isoform pmx-1a

          Length = 217

 Score =  65 bits (157), Expect = 1e-010
 Identities = 40/111 (36%), Positives = 57/111 (51%), Gaps = 13/111 (11%)

Query: 252 NDTDHLDRDQ--QAYPPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGL 309
           .||   | ||        .| .| ||.|   ||. ..  |   | |||   . ||..  |
Sbjct:  74 SDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNL 133

Query: 310 TKRVLQVWFQNARAKFRRN-----------ILRQENGGVDKADGTSVPPPS 349
           |.  .|||||| |||||||           .|.  .| |   .   || |.
Sbjct: 134 TEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPA 184

>hg18||uc001ghf |1|NM_022716|P54821|PRRX1_HUMAN|PRRX1|NM_022716|NP_073207|paired
        mesoderm homeobox 1 isoform pmx-1b

          Length = 245

 Score =  64 bits (155), Expect = 2e-010
 Identities = 41/105 (39%), Positives = 58/105 (55%), Gaps = 8/105 (7%)

Query: 252 NDTDHLDRDQ--QAYPPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGL 309
           .||   | ||        .| .| ||.|   ||. ..  |   | |||   . ||..  |
Sbjct:  74 SDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNL 133

Query: 310 TKRVLQVWFQNARAKFRRN---ILRQENGGVDKA---DGTSVPPP 348
           |.  .|||||| |||||||   .|  .|  . |.   | |.|  |
Sbjct: 134 TEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQP 178

>hg18||uc003kfg
        |5|NM_032109|Q5XKR4|Q5XKR4_HUMAN|OTP|NM_032109|NP_115485|orthopedia
        homeobox

          Length = 325

 Score =  64 bits (155), Expect = 2e-010
 Identities = 38/99 (38%), Positives = 55/99 (55%), Gaps = 3/99 (3%)

Query: 268 QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           || || || |   ||  ..  ||  | ||    ..|| . |||.  .|||||| |||...
Sbjct: 102 QKQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKK 161

Query: 328 NILRQENGGVDKADGTSVPPPSSDSGALTPPSSAATLTD 366
              |..   | .| || .| |          ..|| . |
Sbjct: 162 ---RKKTTNVFRAPGTLLPTPGLPQFPSAAAAAAAAMGD 197

>hg18||uc002wuf |20|NM_014588|Q9NZR4|VSX1_HUMAN|VSX1|NM_014588|NP_055403|visual
        system homeobox 1 protein isoform a

          Length = 365

 Score =  64 bits (153), Expect = 4e-010
 Identities = 37/98 (37%), Positives = 53/98 (54%), Gaps = 3/98 (3%)

Query: 233 RKSPAMGIDISSYNTGCNENDTDHLDRDQQAYPPT---QKTKRMRTSFKHHQLRTMKSYF 289
           |  ||.|    | .   .. |.   ||.     ||   .| .| || |  |||  ..  |
Sbjct: 124 RPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRKKRRHRTVFTAHQLEELEKAF 183

Query: 290 AINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           .  | ||    . || || | .  .|||||| |||.|.
Sbjct: 184 SEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRK 221

>hg18||uc001xcq
        |14|NM_021728|P32243-2|P32243-2|OTX2|NM_021728|NP_068374|orthodenticle
        homeobox 2 isoform a

          Length = 297

 Score =  63 bits (152), Expect = 5e-010
 Identities = 38/106 (35%), Positives = 56/106 (52%), Gaps = 8/106 (7%)

Query: 268 QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           .| .| ||.|   ||  ... ||    ||    ...| |  | .  .||||.| ||| |.
Sbjct:  44 RKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQ 103

Query: 328 NILRQENGGVDK--------ADGTSVPPPSSDSGALTPPSSAATLT 365
              .|.||| .|        .    |   |  ||  ||||| .  |
Sbjct: 104 QQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPT 149

>hg18||uc002bbw |15|NM_145805|Q96A47|ISL2_HUMAN|ISL2|NM_145805|NP_665804|ISL2
        transcription factor, LIM/homeodomain,

          Length = 359

 Score =  62 bits (150), Expect = 9e-010
 Identities = 33/80 (41%), Positives = 51/80 (63%), Gaps = 1/80 (1%)

Query: 267 TQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAK-F 325
           |.|| |.||     || |... .| |  |||   .|| . |||. ||..||||| | |  
Sbjct: 188 TEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDK 247

Query: 326 RRNILRQENGGVDKADGTSV 345
           ...|| ..      .| ||.
Sbjct: 248 KKSILMKQLQQQQHSDKTSL 267

>hg18||uc001wkd |14|NM_033400|Q9C0A1|ZFHX2_HUMAN|ZFHX2|NM_033400|NP_207646|Zinc
        finger homeobox protein 2

          Length = 1517

 Score =  62 bits (148), Expect = 2e-009
 Identities = 35/93 (37%), Positives = 53/93 (56%), Gaps = 5/93 (5%)

Query: 265 PPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAK 324
           ||  . ||.||.    ||  .  ..  . ||  | |  .... || |||.|||||| ||.
Sbjct: 799 PP--RDKRLRTTILPEQLEILYRWYMQDSNPTRKMLDCISEEVGLKKRVVQVWFQNTRAR 856

Query: 325 FRRNILRQENGGVDKADGTSVPPPSSDSGALTP 357
            |.   |   |||      .| ||.. . |  |
Sbjct: 857 ERKGQFRSTPGGV---PSPAVKPPATATPASLP 886

>hg18||uc001jhq
        |10|NM_001080520|NA|NA|LOC644168|NM_001080520|NP_001073989|similar to
        paired related homeobox protein-like

          Length = 268

 Score =  61 bits (147), Expect = 2e-009
 Identities = 37/100 (37%), Positives = 51/100 (51%), Gaps = 9/100 (9%)

Query: 268 QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           .| .| ||.|   ||  ... ||  | ||    ..|| |  ||.  .|||||| |||.|.
Sbjct:  36 RKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWRK 95

Query: 328 NILRQENGGVDKADGTSVP-----PPSSDSGALTPPSSAA 362
                | |  |.  |   |     ||   .    ||   |
Sbjct:  96 T----ERGASDQEPGAKEPMAEVTPPPVRNINSPPPGDQA 131

>hg18||uc004byh |9|NM_016307|Q99811|PRRX2_HUMAN|PRRX2|NM_016307|NP_057391|paired
        related homeobox 2

          Length = 253

 Score =  60 bits (145), Expect = 3e-009
 Identities = 40/127 (31%), Positives = 63/127 (49%), Gaps = 8/127 (6%)

Query: 202 LNFAELAAKGGGLSLPYFNGTGTAQKGRPRKRKSPAMGIDISSYNTGCNENDTDHLDRDQ 261
           |.  |.|| |   . |       |..|  |.    . | . .  .  |            
Sbjct:  44 LDLEEVAAAGRLAARP--GARAEAREGAAREPSGGSSGSEAAPQDGECPSPGRG------ 95

Query: 262 QAYPPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNA 321
            |    .| .| ||.|   ||. ..  |   | |||   ..||..  |..  .|||||| 
Sbjct:  96 SAAKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNR 155

Query: 322 RAKFRRN 328
           |||||||
Sbjct: 156 RAKFRRN 162

>hg18||uc003gwf
        |4|NM_003924|Q99453|PHX2B_HUMAN|PHOX2B|NM_003924|NP_003915|paired-like
        homeobox 2b

          Length = 314

 Score =  60 bits (144), Expect = 4e-009
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 7/100 (7%)

Query: 268 QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           .| .|.||.|   ||. ..  ||  | ||    ..|| |  ||.  .|||||| |||||.
Sbjct:  96 RKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRK 155

Query: 328 N-------ILRQENGGVDKADGTSVPPPSSDSGALTPPSS 360
                       .||   |   .|    | .. .  | |.
Sbjct: 156 QERAAAAAAAAAKNGSSGKKSDSSRDDESKEAKSTDPDST 195

>hg18||uc004dbp |X|NM_139058|Q96QS3|ARX_HUMAN|ARX|NM_139058|NP_620689|aristaless
        related homeobox

          Length = 562

 Score =  60 bits (144), Expect = 4e-009
 Identities = 33/90 (36%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 268 QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           .| .| ||.|  .||  ..  |   | ||    ..|| .  ||.  .|||||| |||.|.
Sbjct: 326 RKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRK 385

Query: 328 NILRQENGGVDKADGTSVPPPSSDSGALTP 357
              |.. |      |   | | | .  |.|
Sbjct: 386 ---REKAGAQTHPPGLPFPGPLSATHPLSP 412

>hg18||uc001osh
        |11|NM_005169|O14813|PHX2A_HUMAN|PHOX2A|NM_005169|NP_005160|paired-like
        homeobox 2a

          Length = 284

 Score =  60 bits (143), Expect = 6e-009
 Identities = 38/105 (36%), Positives = 53/105 (50%), Gaps = 8/105 (7%)

Query: 268 QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           .| .|.||.|   ||. ..  ||  | ||    ..|| |  ||.  .|||||| |||||.
Sbjct:  88 RKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRK 147

Query: 328 NILRQENGGVDKADG--------TSVPPPSSDSGALTPPSSAATL 364
                   |   | |        .|    | .|     | | |.|
Sbjct: 148 QERAASAKGAAGAAGAKKGEARCSSEDDDSKESTCSPTPDSTASL 192

>hg18||uc001tvj |12|NM_022363|Q9H2C1|LHX5_HUMAN|LHX5|NM_022363|NP_071758|LIM
        homeobox protein 5

          Length = 402

 Score =  60 bits (143), Expect = 6e-009
 Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 6/84 (7%)

Query: 246 NTGCNENDTDHLDRDQQAYPPTQKTKRM--RTSFKHHQLRTMKSYFAINHNPDAKDLKQL 303
           |.  .. .| . . ..|       |||   ||. |  || |.|. ||    |     .||
Sbjct: 158 NSTSSDKETANNENEEQ----NSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQL 213

Query: 304 AQKTGLTKRVLQVWFQNARAKFRR 327
           ||.|||  ||.|||||| |.| ||
Sbjct: 214 AQETGLNMRVIQVWFQNRRSKERR 237

>hg18||uc003jor |5|NM_002202|P61371|ISL1_HUMAN|ISL1|NM_002202|NP_002193|islet-1

          Length = 349

 Score =  59 bits (142), Expect = 7e-009
 Identities = 31/79 (39%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 268 QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAK-FR 326
           .|| |.||     || |... .| |  |||   .|| . |||. ||..||||| | |  .
Sbjct: 179 EKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKK 238

Query: 327 RNILRQENGGVDKADGTSV 345
           |.|. ..       | |..
Sbjct: 239 RSIMMKQLQQQQPNDKTNI 257

>hg18||uc002hnh |17|NM_005568|P48742|LHX1_HUMAN|LHX1|NM_005568|NP_005559|LIM
        homeobox protein 1

          Length = 406

 Score =  59 bits (140), Expect = 1e-008
 Identities = 30/59 (50%), Positives = 38/59 (64%)

Query: 269 KTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           | .  ||. |  || |.|. ||    |     .||||.|||  ||.|||||| |.| ||
Sbjct: 179 KRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERR 237

>hg18||uc003yau |8|AB083343|Q18PS0|Q18PS0_HUMAN|ZFHX4|NM_024721|NP_078997|zinc
        finger homeodomain 4

          Length = 3126

 Score =  59 bits (140), Expect = 1e-008
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query:  246 NTGCNENDTDHLDRDQQAYPPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQ 305
            .  |.| .  .   ||       . ||.||.    ||  .   . .. ||  | |  .|.
Sbjct: 2587 DNNCSEKEGGNSGEDQ------HRDKRLRTTITPEQLEILYEKYLLDSNPTRKMLDHIAR 2640

Query:  306 KTGLTKRVLQVWFQNARAKFRRNILR 331
            . || |||.|||||| ||. |.   |
Sbjct: 2641 EVGLKKRVVQVWFQNTRARERKGQFR 2666

>hg18||uc003yav |8|NM_024721|Q86UP3|Q86UP3_HUMAN|ZFHX4|NM_024721|NP_078997|zinc
        finger homeodomain 4

          Length = 3571

 Score =  59 bits (140), Expect = 1e-008
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query:  246 NTGCNENDTDHLDRDQQAYPPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQ 305
            .  |.| .  .   ||       . ||.||.    ||  .   . .. ||  | |  .|.
Sbjct: 2542 DNNCSEKEGGNSGEDQ------HRDKRLRTTITPEQLEILYEKYLLDSNPTRKMLDHIAR 2595

Query:  306 KTGLTKRVLQVWFQNARAKFRRNILR 331
            . || |||.|||||| ||. |.   |
Sbjct: 2596 EVGLKKRVVQVWFQNTRARERKGQFR 2621

>hg18||uc003yaw |8|AY260762|Q86UP3|Q86UP3_HUMAN|ZFHX4|NM_024721|NP_078997|zinc
        finger homeodomain 4

          Length = 3084

 Score =  59 bits (140), Expect = 1e-008
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query:  246 NTGCNENDTDHLDRDQQAYPPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQ 305
            .  |.| .  .   ||       . ||.||.    ||  .   . .. ||  | |  .|.
Sbjct: 2542 DNNCSEKEGGNSGEDQ------HRDKRLRTTITPEQLEILYEKYLLDSNPTRKMLDHIAR 2595

Query:  306 KTGLTKRVLQVWFQNARAKFRRNILR 331
            . || |||.|||||| ||. |.   |
Sbjct: 2596 EVGLKKRVVQVWFQNTRARERKGQFR 2621

>hg18||uc002fck
        |16|NM_006885|Q15911|ATBF1_HUMAN|ATBF1|NM_006885|NP_008816|AT-binding
        transcription factor 1

          Length = 3703

 Score =  57 bits (137), Expect = 3e-008
 Identities = 27/64 (42%), Positives = 39/64 (60%)

Query:  268 QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
            |. ||.||.    ||  .   . .. ||  | |  .| . || |||.|||||| ||. |.
Sbjct: 2639 QRDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTRARERK 2698

Query:  328 NILR 331
               |
Sbjct: 2699 GQFR 2702

>hg18||uc002fcl |16|D10250|Q15911-2|Q15911-2|ATBF1|NA|NA|Alpha-fetoprotein
        enhancer-binding protein (AT motif-binding factor) (AT-binding
        transcription factor 1)

          Length = 2789

 Score =  57 bits (137), Expect = 3e-008
 Identities = 27/64 (42%), Positives = 39/64 (60%)

Query:  268 QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
            |. ||.||.    ||  .   . .. ||  | |  .| . || |||.|||||| ||. |.
Sbjct: 1725 QRDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTRARERK 1784

Query:  328 NILR 331
               |
Sbjct: 1785 GQFR 1788

>hg18||uc001myb
        |11|NM_021926|Q9H161|ALX4_HUMAN|ALX4|NM_021926|NP_068745|aristaless-lik
        e homeobox 4

          Length = 411

 Score =  57 bits (136), Expect = 4e-008
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 269 KTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           | .| ||.|  .||  ..  |   | ||    .||| .| ||.  .|||||| |||.|.
Sbjct: 213 KKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRK 271

>hg18||uc001gcy |1|NM_177398|Q8TE12|LMX1A_HUMAN|LMX1A|NM_177398|NP_796372|LIM
        homeobox transcription factor 1, alpha

          Length = 382

 Score =  57 bits (135), Expect = 5e-008
 Identities = 35/103 (33%), Positives = 53/103 (51%), Gaps = 6/103 (5%)

Query: 268 QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           .. || ||     | |  |. | ..  |  |  . || .|||. ||.|||||| ||| ..
Sbjct: 193 KRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKK 252

Query: 328 NILRQENGGVDKADGTSVPPPSSDSGALTPPSSAATLTDLTNP 370
              ||.    |. .   .      | | |    .| .  . ||
Sbjct: 253 LARRQQQQQQDQQNTQRL------SSAQTNGGGSAGMEGIMNP 289

>hg18||uc001gcz |1|AK122800|Q8TE12|LMX1A_HUMAN|LMX1A|NM_177398|NP_796372|LIM
        homeobox transcription factor 1, alpha

          Length = 382

 Score =  57 bits (135), Expect = 5e-008
 Identities = 35/103 (33%), Positives = 53/103 (51%), Gaps = 6/103 (5%)

Query: 268 QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           .. || ||     | |  |. | ..  |  |  . || .|||. ||.|||||| ||| ..
Sbjct: 193 KRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKK 252

Query: 328 NILRQENGGVDKADGTSVPPPSSDSGALTPPSSAATLTDLTNP 370
              ||.    |. .   .      | | |    .| .  . ||
Sbjct: 253 LARRQQQQQQDQQNTQRL------SSAQTNGGGSAGMEGIMNP 289

>hg18||uc002lyr
        |19|NM_032753|Q96IS3|Q96IS3_HUMAN|RAXL1|NM_032753|NP_116142|retina and
        anterior neural fold homeobox like 1

          Length = 184

 Score =  57 bits (135), Expect = 5e-008
 Identities = 37/108 (34%), Positives = 55/108 (50%), Gaps = 9/108 (8%)

Query: 266 PTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKF 325
           | .| .| ||.|  .||  ..  |  .| ||    ..|| |  | .  .|||||| |||.
Sbjct:  23 PKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKW 82

Query: 326 RRNILRQENGGVDKADGTSVPPPSSDSGAL---TPPSSAATLTDLTNP 370
           |    |||   ..   |    |   .. ||    ||. .  |     |
Sbjct:  83 R----RQER--LESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGP 124

>hg18||uc002lys
        |19|AY211277|Q96IS3|Q96IS3_HUMAN|RAXL1|NM_032753|NP_116142|retina and
        anterior neural fold homeobox like 1

          Length = 184

 Score =  57 bits (135), Expect = 5e-008
 Identities = 37/108 (34%), Positives = 55/108 (50%), Gaps = 9/108 (8%)

Query: 266 PTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKF 325
           | .| .| ||.|  .||  ..  |  .| ||    ..|| |  | .  .|||||| |||.
Sbjct:  23 PKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKW 82

Query: 326 RRNILRQENGGVDKADGTSVPPPSSDSGAL---TPPSSAATLTDLTNP 370
           |    |||   ..   |    |   .. ||    ||. .  |     |
Sbjct:  83 R----RQER--LESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGP 124

>hg18||uc001tae
        |12|NM_006982|Q15699|CART1_HUMAN|CART1|NM_006982|NP_008913|cartilage
        paired-class homeoprotein 1

          Length = 326

 Score =  56 bits (133), Expect = 8e-008
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 11/108 (10%)

Query: 233 RKSPAMGIDISSYNTGCNENDTDHLDRDQQAYPPTQKTKRMRTSFKHHQLRTMKSYFAIN 292
           | ||  |.          . . | |         . | .| ||.|   ||  ..  |   
Sbjct: 103 RMSPVKGMQ--------EKGELDELGDKCDTNVSSSKKRRHRTTFTSLQLEELEKVFQKT 154

Query: 293 HNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNILRQENGGVDKA 340
           | ||    .||| .| ||.  .|||||| |||.|.   |.  | . .|
Sbjct: 155 HYPDVYVREQLALRTELTEARVQVWFQNRRAKWRK---RERYGQIQQA 199

>hg18||uc004ely
        |X|NM_153448|Q8N693|ESX1L_HUMAN|ESX1|NM_153448|NP_703149|extraembryonic
        , spermatogenesis, homeobox

          Length = 406

 Score =  56 bits (133), Expect = 8e-008
 Identities = 25/63 (39%), Positives = 42/63 (66%)

Query: 266 PTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKF 325
           | .. .| ||.|   ||. ....|  .  ||    ..|| .  ||.  .|||||| |||.
Sbjct: 135 PPERKRRRRTAFTQFQLQELENFFDESQYPDVVARERLAARLNLTEDRVQVWFQNRRAKW 194

Query: 326 RRN 328
           .||
Sbjct: 195 KRN 197

>hg18||uc001ldh |10|NM_004098|Q04743|EMX2_HUMAN|EMX2|NM_004098|NP_004089|empty
        spiracles homolog 2

          Length = 252

 Score =  55 bits (132), Expect = 1e-007
 Identities = 28/66 (42%), Positives = 39/66 (59%)

Query: 268 QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           .| ||.||.|   ||  ..  |  ||     . ||||    ||.  ..||||| | ||.|
Sbjct: 152 RKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKR 211

Query: 328 NILRQE 333
             | .|
Sbjct: 212 QKLEEE 217

>hg18||uc001dzb
        |1|NM_006492|Q5T8M4|Q5T8M4_HUMAN|ALX3|NM_006492|NP_006483|aristaless-li
        ke homeobox 3

          Length = 343

 Score =  55 bits (131), Expect = 1e-007
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 269 KTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR 327
           | .| ||.|   ||  ..  |   | ||    .||| .| ||.  .|||||| |||.|.
Sbjct: 152 KKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRK 210

>hg18||uc002lhx |18|NM_013435|Q9Y2V3|RX_HUMAN|RAX|NM_013435|NP_038463|retina and
        anterior neural fold homeobox

          Length = 346

 Score =  55 bits (131), Expect = 1e-007
 Identities = 27/62 (43%), Positives = 39/62 (62%)

Query: 266 PTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKF 325
           | .| .| ||.|  .||  ..  |  .| ||    ..|| |  | .  .|||||| |||.
Sbjct: 132 PKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKW 191

Query: 326 RR 327
           ||
Sbjct: 192 RR 193

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0