BLASTP 7.6.0


Query=fugu4_572350 |jgi|Takru4|572350|e_gw2.192.1.1
        (1850 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003yqw |8|NM_001039112|Q2WGJ9|Q2WGJ9_HUMAN|C8ORFK23|NM_0...    533   1e-150
hg18||uc002rhh |2|NM_004802|Q9HC10-4|Q9HC10-4|OTOF|NM_004802|NP_...    502   2e-141
hg18||uc002rhi |2|NM_194322|Q9HC10-3|Q9HC10-3|OTOF|NM_194322|NP_...    502   2e-141
hg18||uc002rhj |2|NM_194323|Q9HC10-2|Q9HC10-2|OTOF|NM_194323|NP_...    502   2e-141
hg18||uc002rhk |2|NM_194248|Q9HC10|OTOF_HUMAN|OTOF|NM_194248|NP_...    502   2e-141
hg18||uc002rhk |2|NM_194248|Q9HC10|OTOF_HUMAN|OTOF|NM_194248|NP_...    460   1e-128
hg18||uc002xcw |20|CR601296|Q9GZQ9|Q9GZQ9_HUMAN|CR601296|NA|NA|H...    399   3e-110
hg18||uc002xcx |20|AF218012|Q9GZQ9|Q9GZQ9_HUMAN|AF218012|NA|NA|H...    399   3e-110
hg18||uc001kin |10|NM_013451|Q9NZM1|MYOF_HUMAN|FER1L3|NM_013451|...    357   8e-098
hg18||uc001kio |10|NM_133337|Q5VWW4|Q5VWW4_HUMAN|FER1L3|NM_13333...    357   8e-098
hg18||uc002sws |2|AL133022|A0AVI2|A0AVI2_HUMAN|LOC90342|NM_00107...    342   3e-093
hg18||uc002swt |2|NM_001077400|A0AVI2|A0AVI2_HUMAN|LOC90342|NM_0...    342   3e-093
hg18||uc002rhk |2|NM_194248|Q9HC10|OTOF_HUMAN|OTOF|NM_194248|NP_...    310   1e-083
hg18||uc003yqw |8|NM_001039112|Q2WGJ9|Q2WGJ9_HUMAN|C8ORFK23|NM_0...    299   2e-080
hg18||uc002xda |20|BC029951|Q5JX50|Q5JX50_HUMAN|C20orf124|NA|NA|...    240   2e-062
hg18||uc003yqw |8|NM_001039112|Q2WGJ9|Q2WGJ9_HUMAN|C8ORFK23|NM_0...    223   3e-057
hg18||uc002sie |2|NM_003494|O75923|DYSF_HUMAN|DYSF|NM_003494|NP_...    217   1e-055
hg18||uc002sif |2|DQ267935|Q0H395|Q0H395_HUMAN|DYSF|NM_003494|NP...    217   1e-055
hg18||uc002sig |2|AK074104|Q8TEL8|Q8TEL8_HUMAN|DYSF|NM_003494|NP...    217   1e-055
hg18||uc002rhi |2|NM_194322|Q9HC10-3|Q9HC10-3|OTOF|NM_194322|NP_...    199   4e-050
hg18||uc002rhh |2|NM_004802|Q9HC10-4|Q9HC10-4|OTOF|NM_004802|NP_...    191   1e-047
hg18||uc002rhj |2|NM_194323|Q9HC10-2|Q9HC10-2|OTOF|NM_194323|NP_...    191   1e-047
hg18||uc002sie |2|NM_003494|O75923|DYSF_HUMAN|DYSF|NM_003494|NP_...    168   1e-040
hg18||uc002sif |2|DQ267935|Q0H395|Q0H395_HUMAN|DYSF|NM_003494|NP...    168   1e-040
hg18||uc002sig |2|AK074104|Q8TEL8|Q8TEL8_HUMAN|DYSF|NM_003494|NP...    168   1e-040
hg18||uc002rhh |2|NM_004802|Q9HC10-4|Q9HC10-4|OTOF|NM_004802|NP_...    127   2e-028
hg18||uc002rhi |2|NM_194322|Q9HC10-3|Q9HC10-3|OTOF|NM_194322|NP_...    127   2e-028
hg18||uc002rhj |2|NM_194323|Q9HC10-2|Q9HC10-2|OTOF|NM_194323|NP_...    127   2e-028
hg18||uc002rhk |2|NM_194248|Q9HC10|OTOF_HUMAN|OTOF|NM_194248|NP_...    127   2e-028
hg18||uc003yqw |8|NM_001039112|Q2WGJ9|Q2WGJ9_HUMAN|C8ORFK23|NM_0...    114   2e-024
hg18||uc003yqw |8|NM_001039112|Q2WGJ9|Q2WGJ9_HUMAN|C8ORFK23|NM_0...    101   2e-020
hg18||uc001kin |10|NM_013451|Q9NZM1|MYOF_HUMAN|FER1L3|NM_013451|...     96   5e-019
hg18||uc001kio |10|NM_133337|Q5VWW4|Q5VWW4_HUMAN|FER1L3|NM_13333...     96   5e-019
hg18||uc002sie |2|NM_003494|O75923|DYSF_HUMAN|DYSF|NM_003494|NP_...     91   1e-017
hg18||uc002sif |2|DQ267935|Q0H395|Q0H395_HUMAN|DYSF|NM_003494|NP...     91   1e-017
hg18||uc002sig |2|AK074104|Q8TEL8|Q8TEL8_HUMAN|DYSF|NM_003494|NP...     91   1e-017
hg18||uc002rhh |2|NM_004802|Q9HC10-4|Q9HC10-4|OTOF|NM_004802|NP_...     84   2e-015
hg18||uc002rhi |2|NM_194322|Q9HC10-3|Q9HC10-3|OTOF|NM_194322|NP_...     84   2e-015
hg18||uc002rhk |2|NM_194248|Q9HC10|OTOF_HUMAN|OTOF|NM_194248|NP_...     84   2e-015
hg18||uc002rhj |2|NM_194323|Q9HC10-2|Q9HC10-2|OTOF|NM_194323|NP_...     83   3e-015
hg18||uc001kin |10|NM_013451|Q9NZM1|MYOF_HUMAN|FER1L3|NM_013451|...     78   1e-013
hg18||uc001kio |10|NM_133337|Q5VWW4|Q5VWW4_HUMAN|FER1L3|NM_13333...     78   1e-013
hg18||uc002sig |2|AK074104|Q8TEL8|Q8TEL8_HUMAN|DYSF|NM_003494|NP...     75   1e-012
hg18||uc002xda |20|BC029951|Q5JX50|Q5JX50_HUMAN|C20orf124|NA|NA|...     70   2e-011
hg18||uc001kin |10|NM_013451|Q9NZM1|MYOF_HUMAN|FER1L3|NM_013451|...     69   4e-011
hg18||uc001kio |10|NM_133337|Q5VWW4|Q5VWW4_HUMAN|FER1L3|NM_13333...     69   4e-011
hg18||uc002sie |2|NM_003494|O75923|DYSF_HUMAN|DYSF|NM_003494|NP_...     59   7e-008
hg18||uc002sif |2|DQ267935|Q0H395|Q0H395_HUMAN|DYSF|NM_003494|NP...     59   7e-008
hg18||uc001kin |10|NM_013451|Q9NZM1|MYOF_HUMAN|FER1L3|NM_013451|...     57   2e-007
hg18||uc001kio |10|NM_133337|Q5VWW4|Q5VWW4_HUMAN|FER1L3|NM_13333...     57   2e-007
hg18||uc002rfe |2|NM_006277|Q9NZM3|ITSN2_HUMAN|ITSN2|NM_006277|N...     49   6e-005
hg18||uc002rff |2|NM_019595|Q9NZM3-2|Q9NZM3-2|ITSN2|NM_019595|NP...     49   6e-005
hg18||uc001tul |12|BC014420|O95294-2|O95294-2|RASAL1|NM_004658|N...     46   4e-004
hg18||uc001tun |12|AB208935|Q59H24|Q59H24_HUMAN|RASAL1|NM_004658...     46   4e-004
hg18||uc001tuo |12|AL136672|Q59H24|Q59H24_HUMAN|RASAL1|NM_004658...     46   4e-004
hg18||uc002sie |2|NM_003494|O75923|DYSF_HUMAN|DYSF|NM_003494|NP_...     45   0.001
hg18||uc002sif |2|DQ267935|Q0H395|Q0H395_HUMAN|DYSF|NM_003494|NP...     45   0.001
hg18||uc001tum |12|NM_004658|O95294|RASL1_HUMAN|RASAL1|NM_004658...     44   0.001
hg18||uc003kkv |5|NM_001002796|Q6DN13|Q6DN13_HUMAN|MCTP1|NM_0010...     39   0.078
hg18||uc003kkw |5|AK057694|Q96LX0|Q96LX0_HUMAN|MCTP1|NM_00100279...     39   0.078
hg18||uc003kkx |5|NM_024717|Q6DN14|Q6DN14_HUMAN|MCTP1|NM_024717|...     39   0.078
hg18||uc003kkz |5|AK058012|NA|NA|MCTP1|NM_024717|NP_078993|multi...     39   0.078
hg18||uc003kku |5|AX746916|Q8NBA2|Q8NBA2_HUMAN|MCTP1|NM_00100279...     37   0.173
hg18||uc003kkv |5|NM_001002796|Q6DN13|Q6DN13_HUMAN|MCTP1|NM_0010...     37   0.173
hg18||uc003kkw |5|AK057694|Q96LX0|Q96LX0_HUMAN|MCTP1|NM_00100279...     37   0.173
hg18||uc003kkx |5|NM_024717|Q6DN14|Q6DN14_HUMAN|MCTP1|NM_024717|...     37   0.173
hg18||uc003kkz |5|AK058012|NA|NA|MCTP1|NM_024717|NP_078993|multi...     37   0.173
hg18||uc003uht |7|BC108289|Q32P40|Q32P40_HUMAN|PCLO|NA|NA|PCLO p...     35   0.859
hg18||uc003uhu |7|BC001304|Q9Y6V0-3|Q9Y6V0-3|PCLO|NA|NA|Protein ...     35   0.859
hg18||uc003uhv |7|AB011131|NA|NA|KIAA0559|NA|NA|Homo sapiens mRN...     35   0.859
hg18||uc001sjq |12|NM_015292|Q9BSJ8|FA62A_HUMAN|FAM62A|NM_015292...     35   1.122
hg18||uc001sjr |12|AB018290|Q9BSJ8-2|Q9BSJ8-2|FAM62A|NM_015292|N...     35   1.122
hg18||uc001tul |12|BC014420|O95294-2|O95294-2|RASAL1|NM_004658|N...     35   1.122
hg18||uc001tum |12|NM_004658|O95294|RASL1_HUMAN|RASAL1|NM_004658...     35   1.122
hg18||uc001tun |12|AB208935|Q59H24|Q59H24_HUMAN|RASAL1|NM_004658...     35   1.122
hg18||uc001tuo |12|AL136672|Q59H24|Q59H24_HUMAN|RASAL1|NM_004658...     35   1.122

>hg18||uc003yqw
        |8|NM_001039112|Q2WGJ9|Q2WGJ9_HUMAN|C8ORFK23|NM_001039112|NP_001034201|
        hypothetical protein LOC654463

          Length = 1857

 Score =  533 bits (1372), Expect = 1e-150
 Identities = 276/631 (43%), Positives = 378/631 (59%), Gaps = 36/631 (5%)

Query: 1093 DYAPAETGLQPEEEDDEPKRRKTNGKRAEKEMMPSSRSACFPQSPLSKLMXXXXXXXXXX 1152
            | | |.  .  .  |  |     .   |..   |       |. |  .            
Sbjct: 1148 DSAQAQPAILVDVPDSSPMLEPEHTPVAQEP--PKDGKPKDPRKPSRRSTKRRKRTIADE 1205

Query: 1153 XXXXXLDWWSKYYASLEEIERKLWRFYISAEARNLTMANIXXXXXXXXXXXXXXXXXPPK 1212
                 .||||||||||.. ..        |. ||                       | |
Sbjct: 1206 SAENVIDWWSKYYASLKKAQK--------AKERN-PKGKKGNTEAKPDEVVVDIEDGPKK 1256

Query: 1213 RK--------------MIATLKLYGYDLESEFSQFQDWLKNFPLYKGRANAXXXXXXXXX 1258
            .|               .| |..|  ||||||. |.||.| | |..|. .          
Sbjct: 1257 KKDKMLKKKPKDDGIPNLAILQIYDGDLESEFNNFEDWVKTFELFRGK-STEDDHGLDGD 1315

Query: 1259 RFMGKYKGSFLVY--PIDEDDTDETKCEITKGIPINSAIKVLARVYIIKATNLAPSDPNG 1316
            | .||.|||| .|  | |    |  .  | .||| |  . || ||||. | ||.|.||.|
Sbjct: 1316 RVIGKFKGSFCIYKSPQDSSSEDSGQLRIQQGIPPNHPVTVLIRVYIVAAFNLSPADPDG 1375

Query: 1317 KADPYLVLRVGQQILDTKDRYIPKQLNPTFGEVFEFTVSFPLDTELVIRVMDHDLVGTDD 1376
            |.|||.|...|.  .  .|.|||||||| ||  ||   .|| .. | | . |||..||||
Sbjct: 1376 KSDPYIVIKLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSILIYDHDMIGTDD 1435

Query: 1377 IIGETRIDLENRFYSSHRASCGLALYYDVDGYNKWRDAKKPTTILAELCRSNGIAPPEYR 1436
            .||||.||||||||| ||| |||   |...||| |||  ||| || .||. | .  | . 
Sbjct: 1436 LIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYFH 1495

Query: 1437 PSEVKVLNKIFKIPPDAVPEGKSQLGKIL*MEEHAALSVLHRWGDMNEFLSGAIPLVPEH 1496
            | .... |..|        |   .  .     || || ||| | |. |       |||||
Sbjct: 1496 PGKIQIGNQVFSGKTIFTEEDTDETVE---SYEHLALKVLHSWEDIPEV---GCRLVPEH 1549

Query: 1497 VEIRPLQSYSNPGLPQGYLHMWVDLFPTDVPAP-PTVDIKPRQPVQYELRVIIWNTDDVF 1555
            .| |||     ||. || | ||||.|| |.| | | ||| ||.|  ||||| ||||.|| 
Sbjct: 1550 IETRPLYHKDKPGMEQGRLQMWVDMFPKDMPQPGPPVDISPRRPKGYELRVTIWNTEDVI 1609

Query: 1556 LEDVNPFTGNPSSDIYVKGWIKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEKE 1615
            ||| | |||  |||||||||.|||| ||||||||.|||||||||||||.| | ||| ||.
Sbjct: 1610 LEDENIFTGQKSSDIYVKGWLKGLEDDKQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQ 1669

Query: 1616 VVYKKKESFFSLEETTFRQPGVLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQASKCT 1675
            .|  |.|. ||||.   . | ||||||||..|. ..|||| .|.||.   | || |  | 
Sbjct: 1670 MVITKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGTLEMNLNSFPRAAKSAKACD 1729

Query: 1676 IELAKDWA-SPRFSIFRAKKMKGWWPLTRQK 1705
            .   .. .   . |||. |...|||| .. |
Sbjct: 1730 LAKFENASEETKISIFQQKRVRGWWPFSKSK 1760

>hg18||uc002rhh
        |2|NM_004802|Q9HC10-4|Q9HC10-4|OTOF|NM_004802|NP_004793|otoferlin
        isoform b

          Length = 1230

 Score =  502 bits (1292), Expect = 2e-141
 Identities = 253/508 (49%), Positives = 335/508 (65%), Gaps = 16/508 (3%)

Query: 1212 KRKMIATLKLYGYDLESEFSQFQDWLKNFPLYKGRANAXXXXXXXXXRFMGKYKGSFLVY 1271
            |.  |  ||.|  .|||||  |.|||  | | .|.            | .|..|||  ||
Sbjct:  634 KKPKIDELKVYPKELESEFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVY 693

Query: 1272 --PIDEDDTDETKCEIT----KGIPINSAIKVLARVYIIKATNLAPSDPNGKADPYLVLR 1325
              |. || . |   . |    .||| |  | || |||...||.| |.| |||||||. .|
Sbjct:  694 KVPLPEDVSREAGYDSTYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIR 753

Query: 1326 VGQQILDTKDRYIPKQLNPTFGEVFEFTVSFPLDTELVIRVMDHDLVGTDDIIGETRIDL 1385
            .|.  .  |. || ||||| ||. |.   |||... | . | | |||||||.||||.|||
Sbjct:  754 LGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDL 813

Query: 1386 ENRFYSSHRASCGLALYYDVDGYNKWRDAKKPTTILAELCRSNGIAPPEY-RPSEVKVLN 1444
            |||||| |||.||.|  |   ||| |||  ||. ||  ||.   .  | .  |  ||| |
Sbjct:  814 ENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGPPGRVKVAN 873

Query: 1445 KIFKIPPDAVPEGKSQLGKIL*MEEHAALSVLHRWGDMNEFLSGAIPLVPEHVEIRPLQS 1504
            ..|  | .   |     |.    .|| ||  |  | |.         ||||||| ||| .
Sbjct:  874 RVFTGPSEIEDEN----GQRKPTDEHVALLALRHWEDIPR---AGCRLVPEHVETRPLLN 926

Query: 1505 YSNPGLPQGYLHMWVDLFPTDVPAPPT-VDIKPRQPVQYELRVIIWNTDDVFLEDVNPFT 1563
               ||. || | .|||.|| |.||| | .|| ||.| .|||||||||||.| ||| . ||
Sbjct:  927 PDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFT 986

Query: 1564 GNPSSDIYVKGWIKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEKEVVYKKKES 1623
            |  ||||.|.||.|| . |||.||||..|||||||||||..| ||||  |...|  ||||
Sbjct:  987 GEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKES 1046

Query: 1624 FFSLEETTFRQPGVLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQASKCTIELAKDWA 1683
             || .|| .. |  | ||.|| |   |.|||| |||.|.   |||| | .||.|.|    
Sbjct: 1047 MFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEV 1106

Query: 1684 S-PRFSIFRAKKMKGWWPLTRQKTAEDF 1710
              |  |||. |..||||||  .   ..|
Sbjct: 1107 DVPLVSIFKQKRVKGWWPLLARNENDEF 1134

>hg18||uc002rhi
        |2|NM_194322|Q9HC10-3|Q9HC10-3|OTOF|NM_194322|NP_919303|otoferlin
        isoform c

          Length = 1307

 Score =  502 bits (1292), Expect = 2e-141
 Identities = 253/508 (49%), Positives = 335/508 (65%), Gaps = 16/508 (3%)

Query: 1212 KRKMIATLKLYGYDLESEFSQFQDWLKNFPLYKGRANAXXXXXXXXXRFMGKYKGSFLVY 1271
            |.  |  ||.|  .|||||  |.|||  | | .|.            | .|..|||  ||
Sbjct:  711 KKPKIDELKVYPKELESEFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVY 770

Query: 1272 --PIDEDDTDETKCEIT----KGIPINSAIKVLARVYIIKATNLAPSDPNGKADPYLVLR 1325
              |. || . |   . |    .||| |  | || |||...||.| |.| |||||||. .|
Sbjct:  771 KVPLPEDVSREAGYDSTYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIR 830

Query: 1326 VGQQILDTKDRYIPKQLNPTFGEVFEFTVSFPLDTELVIRVMDHDLVGTDDIIGETRIDL 1385
            .|.  .  |. || ||||| ||. |.   |||... | . | | |||||||.||||.|||
Sbjct:  831 LGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDL 890

Query: 1386 ENRFYSSHRASCGLALYYDVDGYNKWRDAKKPTTILAELCRSNGIAPPEY-RPSEVKVLN 1444
            |||||| |||.||.|  |   ||| |||  ||. ||  ||.   .  | .  |  ||| |
Sbjct:  891 ENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGPPGRVKVAN 950

Query: 1445 KIFKIPPDAVPEGKSQLGKIL*MEEHAALSVLHRWGDMNEFLSGAIPLVPEHVEIRPLQS 1504
            ..|  | .   |     |.    .|| ||  |  | |.         ||||||| ||| .
Sbjct:  951 RVFTGPSEIEDEN----GQRKPTDEHVALLALRHWEDIPR---AGCRLVPEHVETRPLLN 1003

Query: 1505 YSNPGLPQGYLHMWVDLFPTDVPAPPT-VDIKPRQPVQYELRVIIWNTDDVFLEDVNPFT 1563
               ||. || | .|||.|| |.||| | .|| ||.| .|||||||||||.| ||| . ||
Sbjct: 1004 PDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFT 1063

Query: 1564 GNPSSDIYVKGWIKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEKEVVYKKKES 1623
            |  ||||.|.||.|| . |||.||||..|||||||||||..| ||||  |...|  ||||
Sbjct: 1064 GEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKES 1123

Query: 1624 FFSLEETTFRQPGVLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQASKCTIELAKDWA 1683
             || .|| .. |  | ||.|| |   |.|||| |||.|.   |||| | .||.|.|    
Sbjct: 1124 MFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEV 1183

Query: 1684 S-PRFSIFRAKKMKGWWPLTRQKTAEDF 1710
              |  |||. |..||||||  .   ..|
Sbjct: 1184 DVPLVSIFKQKRVKGWWPLLARNENDEF 1211

>hg18||uc002rhj
        |2|NM_194323|Q9HC10-2|Q9HC10-2|OTOF|NM_194323|NP_919304|otoferlin
        isoform d

          Length = 1230

 Score =  502 bits (1292), Expect = 2e-141
 Identities = 253/508 (49%), Positives = 335/508 (65%), Gaps = 16/508 (3%)

Query: 1212 KRKMIATLKLYGYDLESEFSQFQDWLKNFPLYKGRANAXXXXXXXXXRFMGKYKGSFLVY 1271
            |.  |  ||.|  .|||||  |.|||  | | .|.            | .|..|||  ||
Sbjct:  634 KKPKIDELKVYPKELESEFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVY 693

Query: 1272 --PIDEDDTDETKCEIT----KGIPINSAIKVLARVYIIKATNLAPSDPNGKADPYLVLR 1325
              |. || . |   . |    .||| |  | || |||...||.| |.| |||||||. .|
Sbjct:  694 KVPLPEDVSREAGYDSTYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIR 753

Query: 1326 VGQQILDTKDRYIPKQLNPTFGEVFEFTVSFPLDTELVIRVMDHDLVGTDDIIGETRIDL 1385
            .|.  .  |. || ||||| ||. |.   |||... | . | | |||||||.||||.|||
Sbjct:  754 LGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDL 813

Query: 1386 ENRFYSSHRASCGLALYYDVDGYNKWRDAKKPTTILAELCRSNGIAPPEY-RPSEVKVLN 1444
            |||||| |||.||.|  |   ||| |||  ||. ||  ||.   .  | .  |  ||| |
Sbjct:  814 ENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGPPGRVKVAN 873

Query: 1445 KIFKIPPDAVPEGKSQLGKIL*MEEHAALSVLHRWGDMNEFLSGAIPLVPEHVEIRPLQS 1504
            ..|  | .   |     |.    .|| ||  |  | |.         ||||||| ||| .
Sbjct:  874 RVFTGPSEIEDEN----GQRKPTDEHVALLALRHWEDIPR---AGCRLVPEHVETRPLLN 926

Query: 1505 YSNPGLPQGYLHMWVDLFPTDVPAPPT-VDIKPRQPVQYELRVIIWNTDDVFLEDVNPFT 1563
               ||. || | .|||.|| |.||| | .|| ||.| .|||||||||||.| ||| . ||
Sbjct:  927 PDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFT 986

Query: 1564 GNPSSDIYVKGWIKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEKEVVYKKKES 1623
            |  ||||.|.||.|| . |||.||||..|||||||||||..| ||||  |...|  ||||
Sbjct:  987 GEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKES 1046

Query: 1624 FFSLEETTFRQPGVLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQASKCTIELAKDWA 1683
             || .|| .. |  | ||.|| |   |.|||| |||.|.   |||| | .||.|.|    
Sbjct: 1047 MFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEV 1106

Query: 1684 S-PRFSIFRAKKMKGWWPLTRQKTAEDF 1710
              |  |||. |..||||||  .   ..|
Sbjct: 1107 DVPLVSIFKQKRVKGWWPLLARNENDEF 1134

>hg18||uc002rhk
        |2|NM_194248|Q9HC10|OTOF_HUMAN|OTOF|NM_194248|NP_919224|otoferlin
        isoform a

          Length = 1997

 Score =  502 bits (1292), Expect = 2e-141
 Identities = 253/508 (49%), Positives = 335/508 (65%), Gaps = 16/508 (3%)

Query: 1212 KRKMIATLKLYGYDLESEFSQFQDWLKNFPLYKGRANAXXXXXXXXXRFMGKYKGSFLVY 1271
            |.  |  ||.|  .|||||  |.|||  | | .|.            | .|..|||  ||
Sbjct: 1401 KKPKIDELKVYPKELESEFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVY 1460

Query: 1272 --PIDEDDTDETKCEIT----KGIPINSAIKVLARVYIIKATNLAPSDPNGKADPYLVLR 1325
              |. || . |   . |    .||| |  | || |||...||.| |.| |||||||. .|
Sbjct: 1461 KVPLPEDVSREAGYDSTYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIR 1520

Query: 1326 VGQQILDTKDRYIPKQLNPTFGEVFEFTVSFPLDTELVIRVMDHDLVGTDDIIGETRIDL 1385
            .|.  .  |. || ||||| ||. |.   |||... | . | | |||||||.||||.|||
Sbjct: 1521 LGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDL 1580

Query: 1386 ENRFYSSHRASCGLALYYDVDGYNKWRDAKKPTTILAELCRSNGIAPPEY-RPSEVKVLN 1444
            |||||| |||.||.|  |   ||| |||  ||. ||  ||.   .  | .  |  ||| |
Sbjct: 1581 ENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGPPGRVKVAN 1640

Query: 1445 KIFKIPPDAVPEGKSQLGKIL*MEEHAALSVLHRWGDMNEFLSGAIPLVPEHVEIRPLQS 1504
            ..|  | .   |     |.    .|| ||  |  | |.         ||||||| ||| .
Sbjct: 1641 RVFTGPSEIEDEN----GQRKPTDEHVALLALRHWEDIPR---AGCRLVPEHVETRPLLN 1693

Query: 1505 YSNPGLPQGYLHMWVDLFPTDVPAPPT-VDIKPRQPVQYELRVIIWNTDDVFLEDVNPFT 1563
               ||. || | .|||.|| |.||| | .|| ||.| .|||||||||||.| ||| . ||
Sbjct: 1694 PDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFT 1753

Query: 1564 GNPSSDIYVKGWIKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEKEVVYKKKES 1623
            |  ||||.|.||.|| . |||.||||..|||||||||||..| ||||  |...|  ||||
Sbjct: 1754 GEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKES 1813

Query: 1624 FFSLEETTFRQPGVLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQASKCTIELAKDWA 1683
             || .|| .. |  | ||.|| |   |.|||| |||.|.   |||| | .||.|.|    
Sbjct: 1814 MFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEV 1873

Query: 1684 S-PRFSIFRAKKMKGWWPLTRQKTAEDF 1710
              |  |||. |..||||||  .   ..|
Sbjct: 1874 DVPLVSIFKQKRVKGWWPLLARNENDEF 1901

>hg18||uc002rhk
        |2|NM_194248|Q9HC10|OTOF_HUMAN|OTOF|NM_194248|NP_919224|otoferlin
        isoform a

          Length = 1997

 Score =  460 bits (1181), Expect = 1e-128
 Identities = 269/723 (37%), Positives = 390/723 (53%), Gaps = 40/723 (5%)

Query:  260 GTVSTRTALHHRFYQKWAPLTDPADTRSGIKGYVKMSVNVLMKGDXXXXXXXXXXXTSGA 319
            ||| ..    |.|. ||| |.|| |  ||.|||||  | |. |||               
Sbjct:  342 GTVYSQP--EHQFHHKWAILSDPDDISSGLKGYVKCDVAVVGKGDNIKTPHKANETD--- 396

Query:  320 QDHIEKNLMLPRGMVSERPWARFQIRIYKAEGLPTMDSGLMAKV--AMVTDRTVFIDPYV 377
            .| || ||.|| |.  || |||| ..||.||||| |.. ||| |  | . .    .||||
Sbjct:  397 EDDIEGNLLLPEGVPPERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYV 456

Query:  378 RVTFAGQQGETSVVTASSAPVWNEEISFIEQFPPLAQRIRVQILDDAKMGDIILATHFLD 437
            .| ||||.|.|||  .|  |.|||.. | . |||| .|..||| |  |. |. . |||.|
Sbjct:  457 QVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFID 516

Query:  438 LQQISDPTRNGNNCFSIGFNPVFGPSWINLYGSPQNSTLRDVHQALNEGLGEGIFYRGRI 497
            |..||.   .|.     || |  ||.|.|.||| .| || | || ||||||||. .| |.
Sbjct:  517 LRKISN---DGDK----GFLPTLGPAWVNMYGSTRNYTLLDEHQDLNEGLGEGVSFRARL 569

Query:  498 LLALXXXXXXXX----XXXXXXXXXXXHPLPEGFLGEKEDFLLFASVFEITMMDPSVGTK 553
            || |                        |. |   |. |.| || .  | .|.|   | |
Sbjct:  570 LLGLAVEIVDTSNPELTSSTEVQVEQATPISESCAGKMEEFFLFGAFLEASMIDRRNGDK 629

Query:  554 PVRFEXXXXXXXXXXXXXXX------XXXXXNEEGKSLLESEDELDKMDMLNPEPEIRSV 607
            |. ||                          .||   |...  .    |      .. ||
Sbjct:  630 PITFEVTIGNYGNEVDGLSRPQRPRPRKEPGDEEEVDLIQNASD----DEAGDAGDLASV 685

Query:  608 SDAMRPEPTQYDRSFHCIPLQPASVRQKPCLFIWTQFEDHNFRLYQANWLTKMADRLEIG 667
            |      |   ||..  .|     . .|||..| . . |   ||| || .  .||.|| |
Sbjct:  686 SSTPPMRPQVTDRNYFHLPY----LERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEG 741

Query:  668 LDEVDRLFRRPRSKAKERXXXXXXXXXATCKQFSVLTER-RSHSRPNKLDRCRRNFIKKN 726
            |...  . .  .|  . |           | .|  | .. . ||   .||| |     . 
Sbjct:  742 LNDIQEMIKTEKSYPERRLRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRE 801

Query:  727 LILLXXXXXXXXXXXXXXXXXXXSTETRKFLKTLRLLAKEPQSTIPDVFLWLLRGTKRLA 786
            |  .                       . ||. || || ||| .|||.|.|..   ||.|
Sbjct:  802 LENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVA 861

Query:  787 YVRIPAHSILFSLVEEQRGCNCGRVSTLYIKSPG----GSVS-EIFAKLEVYMWLGLAKY 841
            | |.|.  .|||.|||. | .| .| ||..| ||    ||    . ||.|.|.||||.| 
Sbjct:  862 YARVPSKDLLFSIVEEETGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKVELYLWLGLSKQ 921

Query:  842 SKEALNNLPDEFLPVYXXXXXXQKKLVPTGLRKLPFSLRYFQLRCHLYQGRGLMAAEDNG 901
             || |  ||  |  |            |  |  .    . |||| |.|| | | ||. .|
Sbjct:  922 RKEFLCGLPCGFQEVKAAQGLGLHAFPPVSL--VYTKKQAFQLRAHMYQARSLFAADSSG 979

Query:  902 LSSPFAKVVFSTQCLVTRVLHETLSPAWCETLLFDRVLLEGTPEQLRQDPPLIIVNIYSH 961
            || |||.| |  |   | ||.||| | | . |.|| . | |   .|| |||.|.. ||  
Sbjct:  980 LSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQ 1039

Query:  962 SSM 964
             ||
Sbjct: 1040 DSM 1042

>hg18||uc002xcw |20|CR601296|Q9GZQ9|Q9GZQ9_HUMAN|CR601296|NA|NA|Hypothetical
        protein

          Length = 328

 Score =  399 bits (1023), Expect = 3e-110
 Identities = 186/332 (56%), Positives = 235/332 (70%), Gaps = 8/332 (2%)

Query: 1517 MWVDLFPTDVPAPPTVDIKPRQPVQYELRVIIWNTDDVFLEDVNPFTGNPSSDIYVKGWI 1576
            ||.|.|| |||||| ||||||||. |||||.||||.|| |.| || ||  ||||||| |.
Sbjct:    1 MWIDIFPQDVPAPPPVDIKPRQPISYELRVVIWNTEDVVLDDENPLTGEMSSDIYVKSWV 60

Query: 1577 KGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEKEVVYKKKESFFSLEETTFRQPG 1636
            |||||||||||||||||||||||||||||||||||||.||   ..   |.|||  |||| 
Sbjct:   61 KGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEREVSVWRRSGPFALEEAEFRQPA 120

Query: 1637 VLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQASKCTIELAKDWASPRFSIFRAKKMK 1696
            |||||||||||| |||||| .|| | ||||||.    |...||.. | || ..|| ....
Sbjct:  121 VLVLQVWDYDRISANDFLGSLELQLPDMVRGARGPELCSVQLARNGAGPRCNLFRCRRLR 180

Query: 1697 GWWPLTRQKTAEDFXXXXXXXXXXXXXXXXXXXXXXXXWSHMKQEDIEYTDALGNTFLLM 1756
            ||||. . | |||                             . ||.|.||  || ..| 
Sbjct:  181 GWWPVVKLKEAEDVEREAQEAQAGKKKRKQRRRKG-------RPEDLEFTDMGGNVYILT 233

Query: 1757 GKVEAELQLVTLQQAEANPVGRARKEPEALEKPNRPTTSFNWFVNPMKTFIFLIWKKFKK 1816
            |||||| .|.|...||  |||. ||.|| ||||.|| |||||||||.|||.| ||... .
Sbjct:  234 GKVEAEFELLTVEEAEKRPVGKGRKQPEPLEKPSRPKTSFNWFVNPLKTFVFFIWRRYWR 293

Query: 1817 YXXXXXXXXXXXXXXXXXXYTLPQQITAMLIR 1848
                               ||.| ||. .. |
Sbjct:  294 -TLVLLLLVLLTVFLLLVFYTIPGQISQVIFR 324

>hg18||uc002xcx |20|AF218012|Q9GZQ9|Q9GZQ9_HUMAN|AF218012|NA|NA|Hypothetical
        protein

          Length = 328

 Score =  399 bits (1023), Expect = 3e-110
 Identities = 186/332 (56%), Positives = 235/332 (70%), Gaps = 8/332 (2%)

Query: 1517 MWVDLFPTDVPAPPTVDIKPRQPVQYELRVIIWNTDDVFLEDVNPFTGNPSSDIYVKGWI 1576
            ||.|.|| |||||| ||||||||. |||||.||||.|| |.| || ||  ||||||| |.
Sbjct:    1 MWIDIFPQDVPAPPPVDIKPRQPISYELRVVIWNTEDVVLDDENPLTGEMSSDIYVKSWV 60

Query: 1577 KGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEKEVVYKKKESFFSLEETTFRQPG 1636
            |||||||||||||||||||||||||||||||||||||.||   ..   |.|||  |||| 
Sbjct:   61 KGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEREVSVWRRSGPFALEEAEFRQPA 120

Query: 1637 VLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQASKCTIELAKDWASPRFSIFRAKKMK 1696
            |||||||||||| |||||| .|| | ||||||.    |...||.. | || ..|| ....
Sbjct:  121 VLVLQVWDYDRISANDFLGSLELQLPDMVRGARGPELCSVQLARNGAGPRCNLFRCRRLR 180

Query: 1697 GWWPLTRQKTAEDFXXXXXXXXXXXXXXXXXXXXXXXXWSHMKQEDIEYTDALGNTFLLM 1756
            ||||. . | |||                             . ||.|.||  || ..| 
Sbjct:  181 GWWPVVKLKEAEDVEREAQEAQAGKKKRKQRRRKG-------RPEDLEFTDMGGNVYILT 233

Query: 1757 GKVEAELQLVTLQQAEANPVGRARKEPEALEKPNRPTTSFNWFVNPMKTFIFLIWKKFKK 1816
            |||||| .|.|...||  |||. ||.|| ||||.|| |||||||||.|||.| ||... .
Sbjct:  234 GKVEAEFELLTVEEAEKRPVGKGRKQPEPLEKPSRPKTSFNWFVNPLKTFVFFIWRRYWR 293

Query: 1817 YXXXXXXXXXXXXXXXXXXYTLPQQITAMLIR 1848
                               ||.| ||. .. |
Sbjct:  294 -TLVLLLLVLLTVFLLLVFYTIPGQISQVIFR 324

>hg18||uc001kin
        |10|NM_013451|Q9NZM1|MYOF_HUMAN|FER1L3|NM_013451|NP_038479|myoferlin
        isoform a

          Length = 2061

 Score =  357 bits (916), Expect = 8e-098
 Identities = 196/502 (39%), Positives = 276/502 (54%), Gaps = 26/502 (5%)

Query: 1213 RKMIATLKLYGYDLE--SEFSQFQDWLKNFPLYKGRANAXXXXXXXXXRFMGKYKGSFLV 1270
            .|  . ||.|  .||  .||    |.   | ||.|...            .|..|||| .
Sbjct: 1472 QKGYSKLKIYNCELENVAEFEGLTDFSDTFKLYRGKSDENEDPS-----VVGEFKGSFRI 1526

Query: 1271 YPIDEDDTDETKCEITKGIPINSAIKVLARVYIIKATNLAPSDPNGKADPYLVLRVGQQI 1330
            ||. .| .        . .| .   .   |.||..   | | | ||  |||. . .|...
Sbjct: 1527 YPLPDDPSVPAPPRQFRELPDSVPQECTVRIYIVRGLELQPQDNNGLCDPYIKITLGKKV 1586

Query: 1331 LDTKDRYIPKQLNPTFGEVFEFTVSFPLDTELVIRVMDHDLVGTDDIIGETRIDLENRFY 1390
            .. .| |||  ||| || ..| .   | . .| | | |.|    |. .||| ||||||| 
Sbjct: 1587 IEDRDHYIPNTLNPVFGRMYELSCYLPQEKDLKISVYDYDTFTRDEKVGETIIDLENRFL 1646

Query: 1391 SSHRASCGLALYYDVDGYNKWRDAKKPTTILAELCRSNGIAPPEYRPSEVKVLNKIFKIP 1450
            |   . ||.   | | | | |||  .|| .|  . |  |   |       ..        
Sbjct: 1647 SRFGSHCGIPEEYCVSGVNTWRDQLRPTQLLQNVARFKGFPQPILSEDGSRIRYGGRDYS 1706

Query: 1451 PDAVPEGKSQLGKIL*MEEHAALSVLHRWGDMNEFLSGAIPLVPEHVEIRPLQSYSNPGL 1510
             |     |     .   ||  || .|   |           ||||||| | | |   | .
Sbjct: 1707 LDEFEANKILHQHLGAPEERLALHILRTQG-----------LVPEHVETRTLHSTFQPNI 1755

Query: 1511 PQGYLHMWVDLFPTDV-PAPPTVDIKPRQPVQYELRVIIWNTDDVFLEDVNPFTGNPSSD 1569
             || | ||||.||  . |  |  .| ||.  .| |||||||| || | |    ||   ||
Sbjct: 1756 SQGKLQMWVDVFPKSLGPPGPPFNITPRKAKKYYLRVIIWNTKDVIL-DEKSITGEEMSD 1814

Query: 1570 IYVKGWIKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEKEVVYKKKESFFSLEE 1629
            ||||||| | | .||.||||. || ||||||||||| ||||| |.  .  ||| |.|...
Sbjct: 1815 IYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFDYLPAEQLCIVAKKEHFWSIDQ 1874

Query: 1630 TTFRQPGVLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQASKCTIELAKD------WA 1683
            | || |  |..|.|| |.   .|.|| .||.|   .  ||   || ...  |        
Sbjct: 1875 TEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDMIPDLKAMNPLK 1934

Query: 1684 SPRFSIFRAKKMKGWWPLTRQK 1705
            .   |.|  | ||||||   .|
Sbjct: 1935 AKTASLFEQKSMKGWWPCYAEK 1956

>hg18||uc001kio
        |10|NM_133337|Q5VWW4|Q5VWW4_HUMAN|FER1L3|NM_133337|NP_579899|myoferlin
        isoform b

          Length = 2048

 Score =  357 bits (916), Expect = 8e-098
 Identities = 196/502 (39%), Positives = 276/502 (54%), Gaps = 26/502 (5%)

Query: 1213 RKMIATLKLYGYDLE--SEFSQFQDWLKNFPLYKGRANAXXXXXXXXXRFMGKYKGSFLV 1270
            .|  . ||.|  .||  .||    |.   | ||.|...            .|..|||| .
Sbjct: 1459 QKGYSKLKIYNCELENVAEFEGLTDFSDTFKLYRGKSDENEDPS-----VVGEFKGSFRI 1513

Query: 1271 YPIDEDDTDETKCEITKGIPINSAIKVLARVYIIKATNLAPSDPNGKADPYLVLRVGQQI 1330
            ||. .| .        . .| .   .   |.||..   | | | ||  |||. . .|...
Sbjct: 1514 YPLPDDPSVPAPPRQFRELPDSVPQECTVRIYIVRGLELQPQDNNGLCDPYIKITLGKKV 1573

Query: 1331 LDTKDRYIPKQLNPTFGEVFEFTVSFPLDTELVIRVMDHDLVGTDDIIGETRIDLENRFY 1390
            .. .| |||  ||| || ..| .   | . .| | | |.|    |. .||| ||||||| 
Sbjct: 1574 IEDRDHYIPNTLNPVFGRMYELSCYLPQEKDLKISVYDYDTFTRDEKVGETIIDLENRFL 1633

Query: 1391 SSHRASCGLALYYDVDGYNKWRDAKKPTTILAELCRSNGIAPPEYRPSEVKVLNKIFKIP 1450
            |   . ||.   | | | | |||  .|| .|  . |  |   |       ..        
Sbjct: 1634 SRFGSHCGIPEEYCVSGVNTWRDQLRPTQLLQNVARFKGFPQPILSEDGSRIRYGGRDYS 1693

Query: 1451 PDAVPEGKSQLGKIL*MEEHAALSVLHRWGDMNEFLSGAIPLVPEHVEIRPLQSYSNPGL 1510
             |     |     .   ||  || .|   |           ||||||| | | |   | .
Sbjct: 1694 LDEFEANKILHQHLGAPEERLALHILRTQG-----------LVPEHVETRTLHSTFQPNI 1742

Query: 1511 PQGYLHMWVDLFPTDV-PAPPTVDIKPRQPVQYELRVIIWNTDDVFLEDVNPFTGNPSSD 1569
             || | ||||.||  . |  |  .| ||.  .| |||||||| || | |    ||   ||
Sbjct: 1743 SQGKLQMWVDVFPKSLGPPGPPFNITPRKAKKYYLRVIIWNTKDVIL-DEKSITGEEMSD 1801

Query: 1570 IYVKGWIKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEKEVVYKKKESFFSLEE 1629
            ||||||| | | .||.||||. || ||||||||||| ||||| |.  .  ||| |.|...
Sbjct: 1802 IYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFDYLPAEQLCIVAKKEHFWSIDQ 1861

Query: 1630 TTFRQPGVLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQASKCTIELAKD------WA 1683
            | || |  |..|.|| |.   .|.|| .||.|   .  ||   || ...  |        
Sbjct: 1862 TEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDMIPDLKAMNPLK 1921

Query: 1684 SPRFSIFRAKKMKGWWPLTRQK 1705
            .   |.|  | ||||||   .|
Sbjct: 1922 AKTASLFEQKSMKGWWPCYAEK 1943

>hg18||uc002sws
        |2|AL133022|A0AVI2|A0AVI2_HUMAN|LOC90342|NM_001077400|NP_001070868|hypo
        thetical protein LOC90342

          Length = 802

 Score =  342 bits (877), Expect = 3e-093
 Identities = 200/510 (39%), Positives = 281/510 (55%), Gaps = 49/510 (9%)

Query: 1212 KRKMIATLKLYGYDLES--EFSQFQDWLKNFPLYKGRANAXXXXXXXXXRFMGKYKGSFL 1269
            | |   |||.|  .||.   |   ||. . | ||. .              .|..|| | 
Sbjct:  149 KYKDYHTLKVYECELEAVPAFQGLQDFCQTFKLYQEQPK-------LDSPVVGEFKGLFR 201

Query: 1270 VYPIDEDDTDETKCEITKGIPINSAI---------KVLARVYIIKATNLAPSDPNGKADP 1320
            .||  |.       |  |  |.   .           | |||...| || | | ||  ||
Sbjct:  202 IYPFPENP------EAPKP-PLQFLVWPEREDFPQPCLVRVYMVRAINLQPQDYNGLCDP 254

Query: 1321 YLVLRVGQQILDTKDRYIPKQLNPTFGEVFEFTVSFPLDTELVIRVMDHDLVGTDDIIGE 1380
            |..|..|.  |  .| | |  |.| || .|| | . ||. .| |.. | ||   || || 
Sbjct:  255 YVILKLGKTELGNRDMYQPNTLDPIFGMMFELTCNIPLEKDLEIQLYDFDLFSPDDKIGT 314

Query: 1381 TRIDLENRFYSSHRASCGLALYYDVDGYNKWRDAKKPTTILAELCRSNGIAPPEYRPSEV 1440
            | ||||||  |   | |||.  |   |  .|||   |. .|    .  |. || . | | 
Sbjct:  315 TVIDLENRLLSGFGAHCGLSKSYCQSGPFRWRDQMPPSYLLERYAKRKGLPPPLFSPEED 374

Query: 1441 KVLNKIFKIPPDAVPEGKSQLGKIL*MEEHAALSVLHRWGDMNEFLSGAIPLVPEHVEIR 1500
             |     |    .       .  .   .|  || .||  |           ||||||| |
Sbjct:  375 AVFYNGKKFKLQSFEPKTPTVHGLGPKKERLALYLLHTQG-----------LVPEHVETR 423

Query: 1501 PLQSYSNPGLPQGYLHMWVDLFPTDV-PAPPTVDIKPRQPVQYELRVIIWNTDDVFLEDV 1559
             | |.| ||. || . ||||.||  . |  | |.| ||.| .|||| ||| | .| | | 
Sbjct:  424 TLYSHSQPGIDQGKVQMWVDIFPKKLGPPGPQVNINPRKPKRYELRCIIWKTANVDLVDD 483

Query: 1560 NPFTGNPSSDIYVKGWIKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEKEVVYK 1619
            |  .   .||||.|||. ||| | |.||.|..||||| .|||||.|  |||  |.  |  
Sbjct:  484 N-LSREKTSDIYIKGWLYGLEKDMQKTDIHYHSLTGEADFNWRFIFTMDYLAAERTCVQS 542

Query: 1620 KKESFFSLEETTFRQPGVLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQASKCTIELA 1679
            .|.  .||. |. . |  |..|||| |    .|||| .||.||||   |. | .|.| . 
Sbjct:  543 QKDYIWSLDATSMKFPARLIIQVWDNDIFSPDDFLGVLELDLSDMPLPARHAKQCSIRMM 602

Query: 1680 KDWASPR---------FSIFRAKKMKGWWP 1700
               | |.         ||.|. | . ||||
Sbjct:  603 D--ADPKWPYFIQYKHFSLFKKKTVTGWWP 630

>hg18||uc002swt
        |2|NM_001077400|A0AVI2|A0AVI2_HUMAN|LOC90342|NM_001077400|NP_001070868|
        hypothetical protein LOC90342

          Length = 802

 Score =  342 bits (877), Expect = 3e-093
 Identities = 200/510 (39%), Positives = 281/510 (55%), Gaps = 49/510 (9%)

Query: 1212 KRKMIATLKLYGYDLES--EFSQFQDWLKNFPLYKGRANAXXXXXXXXXRFMGKYKGSFL 1269
            | |   |||.|  .||.   |   ||. . | ||. .              .|..|| | 
Sbjct:  149 KYKDYHTLKVYECELEAVPAFQGLQDFCQTFKLYQEQPK-------LDSPVVGEFKGLFR 201

Query: 1270 VYPIDEDDTDETKCEITKGIPINSAI---------KVLARVYIIKATNLAPSDPNGKADP 1320
            .||  |.       |  |  |.   .           | |||...| || | | ||  ||
Sbjct:  202 IYPFPENP------EAPKP-PLQFLVWPEREDFPQPCLVRVYMVRAINLQPQDYNGLCDP 254

Query: 1321 YLVLRVGQQILDTKDRYIPKQLNPTFGEVFEFTVSFPLDTELVIRVMDHDLVGTDDIIGE 1380
            |..|..|.  |  .| | |  |.| || .|| | . ||. .| |.. | ||   || || 
Sbjct:  255 YVILKLGKTELGNRDMYQPNTLDPIFGMMFELTCNIPLEKDLEIQLYDFDLFSPDDKIGT 314

Query: 1381 TRIDLENRFYSSHRASCGLALYYDVDGYNKWRDAKKPTTILAELCRSNGIAPPEYRPSEV 1440
            | ||||||  |   | |||.  |   |  .|||   |. .|    .  |. || . | | 
Sbjct:  315 TVIDLENRLLSGFGAHCGLSKSYCQSGPFRWRDQMPPSYLLERYAKRKGLPPPLFSPEED 374

Query: 1441 KVLNKIFKIPPDAVPEGKSQLGKIL*MEEHAALSVLHRWGDMNEFLSGAIPLVPEHVEIR 1500
             |     |    .       .  .   .|  || .||  |           ||||||| |
Sbjct:  375 AVFYNGKKFKLQSFEPKTPTVHGLGPKKERLALYLLHTQG-----------LVPEHVETR 423

Query: 1501 PLQSYSNPGLPQGYLHMWVDLFPTDV-PAPPTVDIKPRQPVQYELRVIIWNTDDVFLEDV 1559
             | |.| ||. || . ||||.||  . |  | |.| ||.| .|||| ||| | .| | | 
Sbjct:  424 TLYSHSQPGIDQGKVQMWVDIFPKKLGPPGPQVNINPRKPKRYELRCIIWKTANVDLVDD 483

Query: 1560 NPFTGNPSSDIYVKGWIKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEKEVVYK 1619
            |  .   .||||.|||. ||| | |.||.|..||||| .|||||.|  |||  |.  |  
Sbjct:  484 N-LSREKTSDIYIKGWLYGLEKDMQKTDIHYHSLTGEADFNWRFIFTMDYLAAERTCVQS 542

Query: 1620 KKESFFSLEETTFRQPGVLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQASKCTIELA 1679
            .|.  .||. |. . |  |..|||| |    .|||| .||.||||   |. | .|.| . 
Sbjct:  543 QKDYIWSLDATSMKFPARLIIQVWDNDIFSPDDFLGVLELDLSDMPLPARHAKQCSIRMM 602

Query: 1680 KDWASPR---------FSIFRAKKMKGWWP 1700
               | |.         ||.|. | . ||||
Sbjct:  603 D--ADPKWPYFIQYKHFSLFKKKTVTGWWP 630

>hg18||uc002rhk
        |2|NM_194248|Q9HC10|OTOF_HUMAN|OTOF|NM_194248|NP_919224|otoferlin
        isoform a

          Length = 1997

 Score =  310 bits (794), Expect = 1e-083
 Identities = 167/399 (41%), Positives = 237/399 (59%), Gaps = 25/399 (6%)

Query: 166 QVNVNVLEARKLVGVNINPAVFIRVENQKKNTMTQKSTNCXXXXXXXXXXXXXXXXILFD 225
           ||.. |.|||.|||.|..| | . | . || |  ..||||                ..||
Sbjct: 255 QVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFD 314

Query: 226 KVIETKVCHRRILAFLLSHIGSFKIDLSTVYKQPGTVSTRTALHHRFYQKWAPLTDPADT 285
           |.|.  | | . |    . .||||.|. ||| ||          |.|. ||| |.|| | 
Sbjct: 315 KIIKISVIHSKNLLRSGTLVGSFKMDVGTVYSQP---------EHQFHHKWAILSDPDDI 365

Query: 286 RSGIKGYVKMSVNVLMKGDXXXXXXXXXXXTSGAQDHIEKNLMLPRGMVSERPWARFQIR 345
            ||.|||||  | |. |||               .| || ||.|| |.  || |||| ..
Sbjct: 366 SSGLKGYVKCDVAVVGKGDNIKTPHKANETD---EDDIEGNLLLPEGVPPERQWARFYVK 422

Query: 346 IYKAEGLPTMDSGLMAKV--AMVTDRTVFIDPYVRVTFAGQQGETSVVTASSAPVWNEEI 403
           ||.||||| |.. ||| |  | . .    .||||.| ||||.|.|||  .|  |.|||..
Sbjct: 423 IYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQV 482

Query: 404 SFIEQFPPLAQRIRVQILDDAKMGDIILATHFLDLQQISDPTRNGNNCFSIGFNPVFGPS 463
            | . |||| .|..||| |  |. |. . |||.||..||.   .|.     || |  ||.
Sbjct: 483 VFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISN---DGDK----GFLPTLGPA 535

Query: 464 WINLYGSPQNSTLRDVHQALNEGLGEGIFYRGRILLALXXXXXXXX----XXXXXXXXXX 519
           |.|.||| .| || | || ||||||||. .| |.|| |                      
Sbjct: 536 WVNMYGSTRNYTLLDEHQDLNEGLGEGVSFRARLLLGLAVEIVDTSNPELTSSTEVQVEQ 595

Query: 520 XHPLPEGFLGEKEDFLLFASVFEITMMDPSVGTKPVRFE 558
             |. |   |. |.| || .  | .|.|   | ||. ||
Sbjct: 596 ATPISESCAGKMEEFFLFGAFLEASMIDRRNGDKPITFE 634

>hg18||uc003yqw
        |8|NM_001039112|Q2WGJ9|Q2WGJ9_HUMAN|C8ORFK23|NM_001039112|NP_001034201|
        hypothetical protein LOC654463

          Length = 1857

 Score =  299 bits (765), Expect = 2e-080
 Identities = 154/338 (45%), Positives = 217/338 (64%), Gaps = 22/338 (6%)

Query: 166 QVNVNVLEARKLVGVNINPAVFIRVENQKKNTMTQKSTNCXXXXXXXXXXXXXXXXILFD 225
           |. . . |||.||| ||.| | | . ..|| .  .. ||                  |||
Sbjct:  84 QIAITITEARQLVGENIDPVVTIEIGDEKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFD 143

Query: 226 KVIETKVCHRRILAFLLSHIGSFKIDLSTVYKQPGTVSTRTALHHRFYQKWAPLTDPADT 285
           |.|.  | | ...  .|  |||||.|| ||| |||         |.|  ||| |||| | 
Sbjct: 144 KIIKISVFHHKLIGSVL--IGSFKVDLGTVYNQPG---------HQFCNKWALLTDPGDI 192

Query: 286 RSGIKGYVKMSVNVLMKGDXXXXXXXXXXXTSGAQDHIEKNLMLPRGMVSERPWARFQIR 345
           |.| |||.|  ..|. |||           ||  .. |||||..| |   ||||||| .|
Sbjct: 193 RTGTKGYLKCDISVMGKGD----VLKTSPKTSDTEEPIEKNLLIPNGFPLERPWARFYVR 248

Query: 346 IYKAEGLPTMDSGLMAKV--AMVTDRTVFIDPYVRVTFAGQQGETSVVTASSAPVWNEEI 403
           .||||||| |.| .|| |  | | |    .||.| |.|||| | |.|    . |||.|..
Sbjct: 249 LYKAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQMGRTTVQKNCADPVWHEQV 308

Query: 404 SFIEQFPPLAQRIRVQILDDAKMGDIILATHFLDLQQISDPTRNGNNCFSIGFNPVFGPS 463
            | | |||| .|...|. |.  | |. |||||.||..||.  ..|.     || | |||.
Sbjct: 309 IFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISN-EQDGDK----GFLPTFGPA 363

Query: 464 WINLYGSPQNSTLRDVHQALNEGLGEGIFYRGRILLAL 501
           ||||||||.| .| | .| .||| |||. .|||||. .
Sbjct: 364 WINLYGSPRNHSLMDDYQEMNEGFGEGVSFRGRILVEI 401

>hg18||uc002xda |20|BC029951|Q5JX50|Q5JX50_HUMAN|C20orf124|NA|NA|Chromosome 20
        open reading frame 124 (Fragment)

          Length = 372

 Score =  240 bits (610), Expect = 2e-062
 Identities = 117/232 (50%), Positives = 164/232 (70%), Gaps = 10/232 (4%)

Query: 271 RFYQKWAPLTDPADTRSGIKGYVKMSVNVLMKGDXXXXXXXXXXXTSGAQDHIEKNLMLP 330
           .|||.| || || |||.| ||..|....|  .||             |    |||||.||
Sbjct: 123 QFYQRWVPLHDPRDTRAGTKGFIKVTLSVRARGD---LPPPMLPPAPGHCSDIEKNLLLP 179

Query: 331 RGMVSERPWARFQIRIYKAEGLPTMDSGLMAK-VAMVTDRTVFIDPYVRVTFAGQQGETS 389
           ||. .|||||| ..|.|.||||| .  ||.   |  . |. | ..|||||.| ||.||||
Sbjct: 180 RGVPAERPWARLRVRLYRAEGLPALRLGLLGSLVRALHDQRVLVEPYVRVSFLGQEGETS 239

Query: 390 VVTASSAPVWNEEISFIEQFPPLAQRIRVQILDDAKMGDIILATHFLDLQQISDPTRNGN 449
           |   ..|| |||..||.| |||| . .|.|. ||| . |  ||||  ||..|| | |   
Sbjct: 240 VSAEAAAPEWNEQLSFVELFPPLTRSLRLQLRDDAPLVDAALATHVPDLRRISHPGR--- 296

Query: 450 NCFSIGFNPVFGPSWINLYGSPQNSTLRDVHQALNEGLGEGIFYRGRILLAL 501
              . |||| |||.|. |||||  . |||  | ||||.|.||..|||.|||.
Sbjct: 297 ---AAGFNPTFGPAWVPLYGSPPGAGLRDSLQGLNEGVGQGIWFRGRLLLAV 345

>hg18||uc003yqw
        |8|NM_001039112|Q2WGJ9|Q2WGJ9_HUMAN|C8ORFK23|NM_001039112|NP_001034201|
        hypothetical protein LOC654463

          Length = 1857

 Score =  223 bits (566), Expect = 3e-057
 Identities = 140/453 (30%), Positives = 227/453 (50%), Gaps = 25/453 (5%)

Query: 524 PEGFLGEKEDFLLFASVFEITMMDPSVGTKPVRFEXXXXXXXXXXXXXXXXXXXXNEEG- 582
           ||    . |.|||| . || ||.|  .| ||. ||                    . |  
Sbjct: 469 PEIVPEKNEEFLLFGAFFEATMIDRKIGDKPISFEVSIGNFGNLIDGGSHHGSKKSAESA 528

Query: 583 -KSLLESEDELDKMDMLNPEP-EIRSVSDAMRPEPTQYDRSFHCIPLQPASVRQKPCLFI 640
            . ||    |  . |. .  |  . | .   .|  |. .|... .| .     .|||.. 
Sbjct: 529 EEDLLPLLHE-GQGDVAHDVPIPMASTTHPEKPLVTEGNRNYNYLPFE----AKKPCVYF 583

Query: 641 WTQFEDHNFRLYQANWLTKMADRLEIGLDEVDRLFRRPRSKAKERXXXXXXXXXATCKQF 700
            . . |  |||. .| | |||| ||  ..||  | .  .   .|.         .    |
Sbjct: 584 ISSWGDQTFRLHWSNMLEKMADFLEESIEEVRELIKISQEAPEEKMKTVLSDFISRSSAF 643

Query: 701 SVLTERRSHS-RPNKLDRCRRNFIKKNL-ILLXXXXXXXXXXXXXXXXXXXSTETRKFLK 758
               |..        ||. |     . |  .                      | . |..
Sbjct: 644 ISEAEKKPKMLNQTTLDKKRLTLCWQELEAMCKEAKGIIQQQKKKLSVDEMIHEAQNFVE 703

Query: 759 TLRLLAKEPQSTIPDVFLWLLRGTKRLAYVRIPAHSILFSLVEEQRGCNCGRVSTLYIKS 818
            .| |  ||| ||||||.|.|   .|.|| || .  .|.| |  | | .||.. | ..| 
Sbjct: 704 KIRFLVDEPQHTIPDVFIWMLSNNRRVAYARIASKDLLYSPVAGQMGKHCGKIKTHFLKP 763

Query: 819 PGGSVS--EIFAKLEVYMWLGLAKYSKEALNNLPDEFLPVYXXXXXXQKKLVPTGLRKLP 876
           ||   .   . ||..||.|||  |..   |.|||  .          .      |    |
Sbjct: 764 PGKRPAGWSVQAKVDVYLWLGSIKHASAILDNLPVGY--------EAEMSSKGAGTNHPP 815

Query: 877 FSLRY-----FQLRCHLYQGRGLMAAEDNGLSSPFAKVVFSTQCLVTRVLHETLSPAWCE 931
            .| |     |||| |.|| |||.||. |||| ||||| | . |  |... .|||| | .
Sbjct: 816 SNLLYQEQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQ 875

Query: 932 TLLFDRVLLEGTPEQLRQDPPLIIVNIYSHSSM 964
            |||. ..| |  ..| . |||..| .|   ..
Sbjct: 876 MLLFNDLVLHGDVKELAESPPLVVVELYDSDAV 908

>hg18||uc002sie
        |2|NM_003494|O75923|DYSF_HUMAN|DYSF|NM_003494|NP_003485|dysferlin

          Length = 2080

 Score =  217 bits (552), Expect = 1e-055
 Identities = 107/217 (49%), Positives = 144/217 (66%), Gaps = 4/217 (1%)

Query: 1492 LVPEHVEIRPLQSYSNPGLPQGYLHMWVDLFPTDVPAP-PTVDIKPRQPVQYELRVIIWN 1550
            ||||||| ||| |   | . || | |||||||  .  | |  .| ||.  .. || ||||
Sbjct: 1760 LVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWN 1819

Query: 1551 TDDVFLEDVNPFTGNPSSDIYVKGWIKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYL 1610
            | || |.|..  ||   ||||||||. | |  ||.||||. || |||||||||.| ||||
Sbjct: 1820 TRDVILDDLS-LTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYL 1878

Query: 1611 PTEKEVVYKKKESFFSLEETTFRQPGVLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQ 1670
            | |.     ||..|. |..|  . |  .| |.|| |.   .|||| ..|.|. | . || 
Sbjct: 1879 PAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKT 1938

Query: 1671 ASKCTIELAKDWASPRF--SIFRAKKMKGWWPLTRQK 1705
            | ||...   |   | .  |.|  | .|||||   ..
Sbjct: 1939 AKKCSLDQLDDAFHPEWFVSLFEQKTVKGWWPCVAEE 1975

>hg18||uc002sif
        |2|DQ267935|Q0H395|Q0H395_HUMAN|DYSF|NM_003494|NP_003485|dysferlin

          Length = 2081

 Score =  217 bits (552), Expect = 1e-055
 Identities = 107/217 (49%), Positives = 144/217 (66%), Gaps = 4/217 (1%)

Query: 1492 LVPEHVEIRPLQSYSNPGLPQGYLHMWVDLFPTDVPAP-PTVDIKPRQPVQYELRVIIWN 1550
            ||||||| ||| |   | . || | |||||||  .  | |  .| ||.  .. || ||||
Sbjct: 1761 LVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWN 1820

Query: 1551 TDDVFLEDVNPFTGNPSSDIYVKGWIKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYL 1610
            | || |.|..  ||   ||||||||. | |  ||.||||. || |||||||||.| ||||
Sbjct: 1821 TRDVILDDLS-LTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYL 1879

Query: 1611 PTEKEVVYKKKESFFSLEETTFRQPGVLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQ 1670
            | |.     ||..|. |..|  . |  .| |.|| |.   .|||| ..|.|. | . || 
Sbjct: 1880 PAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKT 1939

Query: 1671 ASKCTIELAKDWASPRF--SIFRAKKMKGWWPLTRQK 1705
            | ||...   |   | .  |.|  | .|||||   ..
Sbjct: 1940 AKKCSLDQLDDAFHPEWFVSLFEQKTVKGWWPCVAEE 1976

>hg18||uc002sig
        |2|AK074104|Q8TEL8|Q8TEL8_HUMAN|DYSF|NM_003494|NP_003485|dysferlin

          Length = 1518

 Score =  217 bits (552), Expect = 1e-055
 Identities = 107/217 (49%), Positives = 144/217 (66%), Gaps = 4/217 (1%)

Query: 1492 LVPEHVEIRPLQSYSNPGLPQGYLHMWVDLFPTDVPAP-PTVDIKPRQPVQYELRVIIWN 1550
            ||||||| ||| |   | . || | |||||||  .  | |  .| ||.  .. || ||||
Sbjct: 1296 LVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWN 1355

Query: 1551 TDDVFLEDVNPFTGNPSSDIYVKGWIKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYL 1610
            | || |.|..  ||   ||||||||. | |  ||.||||. || |||||||||.| ||||
Sbjct: 1356 TRDVILDDLS-LTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYL 1414

Query: 1611 PTEKEVVYKKKESFFSLEETTFRQPGVLVLQVWDYDRIGANDFLGCIELNLSDMVRGAKQ 1670
            | |.     ||..|. |..|  . |  .| |.|| |.   .|||| ..|.|. | . || 
Sbjct: 1415 PAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKT 1474

Query: 1671 ASKCTIELAKDWASPRF--SIFRAKKMKGWWPLTRQK 1705
            | ||...   |   | .  |.|  | .|||||   ..
Sbjct: 1475 AKKCSLDQLDDAFHPEWFVSLFEQKTVKGWWPCVAEE 1511

>hg18||uc002rhi
        |2|NM_194322|Q9HC10-3|Q9HC10-3|OTOF|NM_194322|NP_919303|otoferlin
        isoform c

          Length = 1307

 Score =  199 bits (504), Expect = 4e-050
 Identities = 114/314 (36%), Positives = 165/314 (52%), Gaps = 8/314 (2%)

Query: 657 LTKMADRLEIGLDEVDRLFRRPRSKAKERXXXXXXXXXATCKQFSVLTER-RSHSRPNKL 715
           .|   |  | ||...  . .  .|  . |           | .|  | .. . ||   .|
Sbjct:  41 ITHTPDSQEEGLNDIQEMIKTEKSYPERRLRGVLEELSCGCCRFLSLADKDQGHSSRTRL 100

Query: 716 DRCRRNFIKKNLILLXXXXXXXXXXXXXXXXXXXSTETRKFLKTLRLLAKEPQSTIPDVF 775
           || |     . |  .                       . ||. || || ||| .|||.|
Sbjct: 101 DRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIF 160

Query: 776 LWLLRGTKRLAYVRIPAHSILFSLVEEQRGCNCGRVSTLYIKSPG----GSVS-EIFAKL 830
           .|..   ||.|| |.|.  .|||.|||. | .| .| ||..| ||    ||    . ||.
Sbjct: 161 IWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKV 220

Query: 831 EVYMWLGLAKYSKEALNNLPDEFLPVYXXXXXXQKKLVPTGLRKLPFSLRYFQLRCHLYQ 890
           |.|.||||.|  || |  ||  |  |            |  |  .    . |||| |.||
Sbjct: 221 ELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSL--VYTKKQAFQLRAHMYQ 278

Query: 891 GRGLMAAEDNGLSSPFAKVVFSTQCLVTRVLHETLSPAWCETLLFDRVLLEGTPEQLRQD 950
            | | ||. .||| |||.| |  |   | ||.||| | | . |.|| . | |   .|| |
Sbjct: 279 ARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDD 338

Query: 951 PPLIIVNIYSHSSM 964
           ||.|.. ||   ||
Sbjct: 339 PPIIVIEIYDQDSM 352

>hg18||uc002rhh
        |2|NM_004802|Q9HC10-4|Q9HC10-4|OTOF|NM_004802|NP_004793|otoferlin
        isoform b

          Length = 1230

 Score =  191 bits (483), Expect = 1e-047
 Identities = 106/273 (38%), Positives = 149/273 (54%), Gaps = 7/273 (2%)

Query: 697 CKQFSVLTERRSHSRPNKLDRCRRNFIKKNLILLXXXXXXXXXXXXXXXXXXXSTETRKF 756
           |.  |.  . . ||   .||| |     . |  .                       . |
Sbjct:  25 CRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNF 84

Query: 757 LKTLRLLAKEPQSTIPDVFLWLLRGTKRLAYVRIPAHSILFSLVEEQRGCNCGRVSTLYI 816
           |. || || ||| .|||.|.|..   ||.|| |.|.  .|||.|||. | .| .| ||..
Sbjct:  85 LQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFL 144

Query: 817 KSPG----GSVS-EIFAKLEVYMWLGLAKYSKEALNNLPDEFLPVYXXXXXXQKKLVPTG 871
           | ||    ||    . ||.|.|.||||.|  || |  ||  |  |            |  
Sbjct: 145 KLPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVS 204

Query: 872 LRKLPFSLRYFQLRCHLYQGRGLMAAEDNGLSSPFAKVVFSTQCLVTRVLHETLSPAWCE 931
           |  .    . |||| |.|| | | ||. .||| |||.| |  |   | ||.||| | | .
Sbjct: 205 L--VYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQ 262

Query: 932 TLLFDRVLLEGTPEQLRQDPPLIIVNIYSHSSM 964
            |.|| . | |   .|| |||.|.. ||   ||
Sbjct: 263 MLVFDNLELYGEAHELRDDPPIIVIEIYDQDSM 295

>hg18||uc002rhj
        |2|NM_194323|Q9HC10-2|Q9HC10-2|OTOF|NM_194323|NP_919304|otoferlin
        isoform d

          Length = 1230

 Score =  191 bits (483), Expect = 1e-047
 Identities = 106/273 (38%), Positives = 149/273 (54%), Gaps = 7/273 (2%)

Query: 697 CKQFSVLTERRSHSRPNKLDRCRRNFIKKNLILLXXXXXXXXXXXXXXXXXXXSTETRKF 756
           |.  |.  . . ||   .||| |     . |  .                       . |
Sbjct:  25 CRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNF 84

Query: 757 LKTLRLLAKEPQSTIPDVFLWLLRGTKRLAYVRIPAHSILFSLVEEQRGCNCGRVSTLYI 816
           |. || || ||| .|||.|.|..   ||.|| |.|.  .|||.|||. | .| .| ||..
Sbjct:  85 LQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFL 144

Query: 817 KSPG----GSVS-EIFAKLEVYMWLGLAKYSKEALNNLPDEFLPVYXXXXXXQKKLVPTG 871
           | ||    ||    . ||.|.|.||||.|  || |  ||  |  |            |  
Sbjct: 145 KLPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVS 204

Query: 872 LRKLPFSLRYFQLRCHLYQGRGLMAAEDNGLSSPFAKVVFSTQCLVTRVLHETLSPAWCE 931
           |  .    . |||| |.|| | | ||. .||| |||.| |  |   | ||.||| | | .
Sbjct: 205 L--VYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQ 262

Query: 932 TLLFDRVLLEGTPEQLRQDPPLIIVNIYSHSSM 964
            |.|| . | |   .|| |||.|.. ||   ||
Sbjct: 263 MLVFDNLELYGEAHELRDDPPIIVIEIYDQDSM 295

>hg18||uc002sie
        |2|NM_003494|O75923|DYSF_HUMAN|DYSF|NM_003494|NP_003485|dysferlin

          Length = 2080

 Score =  168 bits (423), Expect = 1e-040
 Identities = 97/283 (34%), Positives = 147/283 (51%), Gaps = 11/283 (3%)

Query: 1218 TLKLYGYDLES--EFSQFQDWLKNFPLYKGRANAXXXXXXXXXRFMGKYKGSFLVYPIDE 1275
            |||.|   ||.   |    |.   | ||.|.              .|..|| | .||. |
Sbjct: 1501 TLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPS----VIGEFKGLFKIYPLPE 1556

Query: 1276 DDTDETKCEITKGIPINSAIKVLARVYIIKATNLAPSDPNGKADPYLVLRVGQQILDTKD 1335
            |            .      . | |.||..|  | | ||||| |||. . .|.. .  .|
Sbjct: 1557 DPAIPMPPRQFHQLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQD 1616

Query: 1336 RYIPKQLNPTFGEVFEFTVSFPLDTELVIRVMDHDLVGTDDIIGETRIDLENRFYSSHRA 1395
             |||  | | ||..|| | . ||. .| | . |.||.  |. |||| .|||||  |   |
Sbjct: 1617 NYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGA 1676

Query: 1396 SCGLALYYDVDGYNKWRDAKKPTTILAELCRSNGIAPPEYRPSEVKVLNKIFKIPPDAVP 1455
             |||   | | | |.|||  .|. .|   |. . .  | ||   |   .| . |  . . 
Sbjct: 1677 RCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSI--EEIE 1734

Query: 1456 EGKSQLGKIL*MEEHAALSVLHRWGDMNEFLSGA---IPLVPE 1495
             |.     .  .||  || || . | . | .       || |.
Sbjct: 1735 AGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPD 1777

>hg18||uc002sif
        |2|DQ267935|Q0H395|Q0H395_HUMAN|DYSF|NM_003494|NP_003485|dysferlin

          Length = 2081

 Score =  168 bits (423), Expect = 1e-040
 Identities = 97/283 (34%), Positives = 147/283 (51%), Gaps = 11/283 (3%)

Query: 1218 TLKLYGYDLES--EFSQFQDWLKNFPLYKGRANAXXXXXXXXXRFMGKYKGSFLVYPIDE 1275
            |||.|   ||.   |    |.   | ||.|.              .|..|| | .||. |
Sbjct: 1502 TLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPS----VIGEFKGLFKIYPLPE 1557

Query: 1276 DDTDETKCEITKGIPINSAIKVLARVYIIKATNLAPSDPNGKADPYLVLRVGQQILDTKD 1335
            |            .      . | |.||..|  | | ||||| |||. . .|.. .  .|
Sbjct: 1558 DPAIPMPPRQFHQLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQD 1617

Query: 1336 RYIPKQLNPTFGEVFEFTVSFPLDTELVIRVMDHDLVGTDDIIGETRIDLENRFYSSHRA 1395
             |||  | | ||..|| | . ||. .| | . |.||.  |. |||| .|||||  |   |
Sbjct: 1618 NYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGA 1677

Query: 1396 SCGLALYYDVDGYNKWRDAKKPTTILAELCRSNGIAPPEYRPSEVKVLNKIFKIPPDAVP 1455
             |||   | | | |.|||  .|. .|   |. . .  | ||   |   .| . |  . . 
Sbjct: 1678 RCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSI--EEIE 1735

Query: 1456 EGKSQLGKIL*MEEHAALSVLHRWGDMNEFLSGA---IPLVPE 1495
             |.     .  .||  || || . | . | .       || |.
Sbjct: 1736 AGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPD 1778

>hg18||uc002sig
        |2|AK074104|Q8TEL8|Q8TEL8_HUMAN|DYSF|NM_003494|NP_003485|dysferlin

          Length = 1518

 Score =  168 bits (423), Expect = 1e-040
 Identities = 97/283 (34%), Positives = 147/283 (51%), Gaps = 11/283 (3%)

Query: 1218 TLKLYGYDLES--EFSQFQDWLKNFPLYKGRANAXXXXXXXXXRFMGKYKGSFLVYPIDE 1275
            |||.|   ||.   |    |.   | ||.|.              .|..|| | .||. |
Sbjct: 1037 TLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPS----VIGEFKGLFKIYPLPE 1092

Query: 1276 DDTDETKCEITKGIPINSAIKVLARVYIIKATNLAPSDPNGKADPYLVLRVGQQILDTKD 1335
            |            .      . | |.||..|  | | ||||| |||. . .|.. .  .|
Sbjct: 1093 DPAIPMPPRQFHQLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQD 1152

Query: 1336 RYIPKQLNPTFGEVFEFTVSFPLDTELVIRVMDHDLVGTDDIIGETRIDLENRFYSSHRA 1395
             |||  | | ||..|| | . ||. .| | . |.||.  |. |||| .|||||  |   |
Sbjct: 1153 NYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGA 1212

Query: 1396 SCGLALYYDVDGYNKWRDAKKPTTILAELCRSNGIAPPEYRPSEVKVLNKIFKIPPDAVP 1455
             |||   | | | |.|||  .|. .|   |. . .  | ||   |   .| . |  . . 
Sbjct: 1213 RCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSI--EEIE 1270

Query: 1456 EGKSQLGKIL*MEEHAALSVLHRWGDMNEFLSGA---IPLVPE 1495
             |.     .  .||  || || . | . | .       || |.
Sbjct: 1271 AGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPD 1313

>hg18||uc002rhh
        |2|NM_004802|Q9HC10-4|Q9HC10-4|OTOF|NM_004802|NP_004793|otoferlin
        isoform b

          Length = 1230

 Score =  127 bits (317), Expect = 2e-028
 Identities = 59/105 (56%), Positives = 78/105 (74%)

Query:  987 IPDGVRPVLKTFRIEVLFWGLRELKRVELFEVSRPFMRMECAGHQLESEEIENFKLHPNF 1046
            .| |.||||  .|.||||||||.|||| | .| || . .||||  ..|  | |.| .|||
Sbjct:  375 VPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNF 434

Query: 1047 KEMVRFMDVELPEQAYLHPPLTIFVLEQRAFGRLALVGSHVVQSL 1091
              .|.. .|.|||   ||||| | |.. |||||  ||||| | ||
Sbjct:  435 NTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 479

>hg18||uc002rhi
        |2|NM_194322|Q9HC10-3|Q9HC10-3|OTOF|NM_194322|NP_919303|otoferlin
        isoform c

          Length = 1307

 Score =  127 bits (317), Expect = 2e-028
 Identities = 59/105 (56%), Positives = 78/105 (74%)

Query:  987 IPDGVRPVLKTFRIEVLFWGLRELKRVELFEVSRPFMRMECAGHQLESEEIENFKLHPNF 1046
            .| |.||||  .|.||||||||.|||| | .| || . .||||  ..|  | |.| .|||
Sbjct:  432 VPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNF 491

Query: 1047 KEMVRFMDVELPEQAYLHPPLTIFVLEQRAFGRLALVGSHVVQSL 1091
              .|.. .|.|||   ||||| | |.. |||||  ||||| | ||
Sbjct:  492 NTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 536

>hg18||uc002rhj
        |2|NM_194323|Q9HC10-2|Q9HC10-2|OTOF|NM_194323|NP_919304|otoferlin
        isoform d

          Length = 1230

 Score =  127 bits (317), Expect = 2e-028
 Identities = 59/105 (56%), Positives = 78/105 (74%)

Query:  987 IPDGVRPVLKTFRIEVLFWGLRELKRVELFEVSRPFMRMECAGHQLESEEIENFKLHPNF 1046
            .| |.||||  .|.||||||||.|||| | .| || . .||||  ..|  | |.| .|||
Sbjct:  375 VPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNF 434

Query: 1047 KEMVRFMDVELPEQAYLHPPLTIFVLEQRAFGRLALVGSHVVQSL 1091
              .|.. .|.|||   ||||| | |.. |||||  ||||| | ||
Sbjct:  435 NTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 479

>hg18||uc002rhk
        |2|NM_194248|Q9HC10|OTOF_HUMAN|OTOF|NM_194248|NP_919224|otoferlin
        isoform a

          Length = 1997

 Score =  127 bits (317), Expect = 2e-028
 Identities = 59/105 (56%), Positives = 78/105 (74%)

Query:  987 IPDGVRPVLKTFRIEVLFWGLRELKRVELFEVSRPFMRMECAGHQLESEEIENFKLHPNF 1046
            .| |.||||  .|.||||||||.|||| | .| || . .||||  ..|  | |.| .|||
Sbjct: 1122 VPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNF 1181

Query: 1047 KEMVRFMDVELPEQAYLHPPLTIFVLEQRAFGRLALVGSHVVQSL 1091
              .|.. .|.|||   ||||| | |.. |||||  ||||| | ||
Sbjct: 1182 NTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 1226

>hg18||uc003yqw
        |8|NM_001039112|Q2WGJ9|Q2WGJ9_HUMAN|C8ORFK23|NM_001039112|NP_001034201|
        hypothetical protein LOC654463

          Length = 1857

 Score =  114 bits (283), Expect = 2e-024
 Identities = 58/133 (43%), Positives = 85/133 (63%), Gaps = 6/133 (4%)

Query:  962 SSMPRLPKSVDPQELTFIEDERYYIIPDGVRPVLKTFRIEVLFWGLRELKRVELFEVSRP 1021
            | .  ||  |.| ..| |     | .|  .||||  .|.||||||.||.|.|.|  | ||
Sbjct:  962 SGLQGLP-PVEPPDITQI-----YPVPANIRPVLSKYRVEVLFWGVREMKKVQLLSVDRP 1015

Query: 1022 FMRMECAGHQLESEEIENFKLHPNFKEMVRFMDVELPEQAYLHPPLTIFVLEQRAFGRLA 1081
               .|| |  ..|  |...| .|||       .|||||   |||||.| |.. |||||  
Sbjct: 1016 QALIECGGQGVKSCVIQSYKNNPNFSIQADAFEVELPENELLHPPLSICVVDWRAFGRST 1075

Query: 1082 LVGSHVVQSLMDY 1094
            |||.. .  |  .
Sbjct: 1076 LVGTYTINYLKQF 1088

>hg18||uc003yqw
        |8|NM_001039112|Q2WGJ9|Q2WGJ9_HUMAN|C8ORFK23|NM_001039112|NP_001034201|
        hypothetical protein LOC654463

          Length = 1857

 Score =  101 bits (249), Expect = 2e-020
 Identities = 48/95 (50%), Positives = 59/95 (62%)

Query: 1755 LMGKVEAELQLVTLQQAEANPVGRARKEPEALEKPNRPTTSFNWFVNPMKTFIFLIWKKF 1814
            | ||||||  ||| ..|| ||||.|||||| | ||||| |||.||..| |   .|||| .
Sbjct: 1762 LTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFMSPFKCLYYLIWKNY 1821

Query: 1815 KKYXXXXXXXXXXXXXXXXXXYTLPQQITAMLIRG 1849
            |||                  ||||  |.  .. |
Sbjct: 1822 KKYIIIAFILIILIIFLVLFIYTLPGAISRRIVVG 1856

>hg18||uc001kin
        |10|NM_013451|Q9NZM1|MYOF_HUMAN|FER1L3|NM_013451|NP_038479|myoferlin
        isoform a

          Length = 2061

 Score =  96 bits (236), Expect = 5e-019
 Identities = 44/107 (41%), Positives = 67/107 (62%)

Query:  985 YIIPDGVRPVLKTFRIEVLFWGLRELKRVELFEVSRPFMRMECAGHQLESEEIENFKLHP 1044
            |..| |.|||..   ||.| |||| .|  ..  .. | . .|| | ..||  |.| |  |
Sbjct: 1291 YMVPQGIRPVVQLTAIEILAWGLRNMKNFQMASITSPSLVVECGGERVESVVIKNLKKTP 1350

Query: 1045 NFKEMVRFMDVELPEQAYLHPPLTIFVLEQRAFGRLALVGSHVVQSL 1091
            ||   | || | ||..    ||| | |.. | |||  .||   .. |
Sbjct: 1351 NFPSSVLFMKVFLPKEELYMPPLVIKVIDHRQFGRKPVVGQCTIERL 1397

>hg18||uc001kio
        |10|NM_133337|Q5VWW4|Q5VWW4_HUMAN|FER1L3|NM_133337|NP_579899|myoferlin
        isoform b

          Length = 2048

 Score =  96 bits (236), Expect = 5e-019
 Identities = 44/107 (41%), Positives = 67/107 (62%)

Query:  985 YIIPDGVRPVLKTFRIEVLFWGLRELKRVELFEVSRPFMRMECAGHQLESEEIENFKLHP 1044
            |..| |.|||..   ||.| |||| .|  ..  .. | . .|| | ..||  |.| |  |
Sbjct: 1278 YMVPQGIRPVVQLTAIEILAWGLRNMKNFQMASITSPSLVVECGGERVESVVIKNLKKTP 1337

Query: 1045 NFKEMVRFMDVELPEQAYLHPPLTIFVLEQRAFGRLALVGSHVVQSL 1091
            ||   | || | ||..    ||| | |.. | |||  .||   .. |
Sbjct: 1338 NFPSSVLFMKVFLPKEELYMPPLVIKVIDHRQFGRKPVVGQCTIERL 1384

>hg18||uc002sie
        |2|NM_003494|O75923|DYSF_HUMAN|DYSF|NM_003494|NP_003485|dysferlin

          Length = 2080

 Score =  91 bits (224), Expect = 1e-017
 Identities = 41/110 (37%), Positives = 66/110 (60%)

Query:  985 YIIPDGVRPVLKTFRIEVLFWGLRELKRVELFEVSRPFMRMECAGHQLESEEIENFKLHP 1044
            |..|  ..| |.   ||.| |||| .|  .|  .| | . .|| |  ..|  | | . .|
Sbjct: 1319 YMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNP 1378

Query: 1045 NFKEMVRFMDVELPEQAYLHPPLTIFVLEQRAFGRLALVGSHVVQSLMDY 1094
            ||     ||.| || .    ||.|. |.. | |||  .||   ..||  .
Sbjct: 1379 NFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESF 1428

>hg18||uc002sif
        |2|DQ267935|Q0H395|Q0H395_HUMAN|DYSF|NM_003494|NP_003485|dysferlin

          Length = 2081

 Score =  91 bits (224), Expect = 1e-017
 Identities = 41/110 (37%), Positives = 66/110 (60%)

Query:  985 YIIPDGVRPVLKTFRIEVLFWGLRELKRVELFEVSRPFMRMECAGHQLESEEIENFKLHP 1044
            |..|  ..| |.   ||.| |||| .|  .|  .| | . .|| |  ..|  | | . .|
Sbjct: 1320 YMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNP 1379

Query: 1045 NFKEMVRFMDVELPEQAYLHPPLTIFVLEQRAFGRLALVGSHVVQSLMDY 1094
            ||     ||.| || .    ||.|. |.. | |||  .||   ..||  .
Sbjct: 1380 NFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESF 1429

>hg18||uc002sig
        |2|AK074104|Q8TEL8|Q8TEL8_HUMAN|DYSF|NM_003494|NP_003485|dysferlin

          Length = 1518

 Score =  91 bits (224), Expect = 1e-017
 Identities = 41/110 (37%), Positives = 66/110 (60%)

Query:  985 YIIPDGVRPVLKTFRIEVLFWGLRELKRVELFEVSRPFMRMECAGHQLESEEIENFKLHP 1044
            |..|  ..| |.   ||.| |||| .|  .|  .| | . .|| |  ..|  | | . .|
Sbjct:  855 YMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNP 914

Query: 1045 NFKEMVRFMDVELPEQAYLHPPLTIFVLEQRAFGRLALVGSHVVQSLMDY 1094
            ||     ||.| || .    ||.|. |.. | |||  .||   ..||  .
Sbjct:  915 NFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESF 964

>hg18||uc002rhh
        |2|NM_004802|Q9HC10-4|Q9HC10-4|OTOF|NM_004802|NP_004793|otoferlin
        isoform b

          Length = 1230

 Score =  84 bits (206), Expect = 2e-015
 Identities = 37/63 (58%), Positives = 48/63 (76%)

Query: 1753 FLLMGKVEAELQLVTLQQAEANPVGRARKEPEALEKPNRPTTSFNWFVNPMKTFIFLIWK 1812
            | | ||||||| |.| ..|| |||| || ||. ||||||| ||| ||.||.|.  . .| 
Sbjct: 1134 FELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWH 1193

Query: 1813 KFK 1815
             ..
Sbjct: 1194 TYR 1196

>hg18||uc002rhi
        |2|NM_194322|Q9HC10-3|Q9HC10-3|OTOF|NM_194322|NP_919303|otoferlin
        isoform c

          Length = 1307

 Score =  84 bits (206), Expect = 2e-015
 Identities = 37/63 (58%), Positives = 48/63 (76%)

Query: 1753 FLLMGKVEAELQLVTLQQAEANPVGRARKEPEALEKPNRPTTSFNWFVNPMKTFIFLIWK 1812
            | | ||||||| |.| ..|| |||| || ||. ||||||| ||| ||.||.|.  . .| 
Sbjct: 1211 FELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWH 1270

Query: 1813 KFK 1815
             ..
Sbjct: 1271 TYR 1273

>hg18||uc002rhk
        |2|NM_194248|Q9HC10|OTOF_HUMAN|OTOF|NM_194248|NP_919224|otoferlin
        isoform a

          Length = 1997

 Score =  84 bits (206), Expect = 2e-015
 Identities = 37/63 (58%), Positives = 48/63 (76%)

Query: 1753 FLLMGKVEAELQLVTLQQAEANPVGRARKEPEALEKPNRPTTSFNWFVNPMKTFIFLIWK 1812
            | | ||||||| |.| ..|| |||| || ||. ||||||| ||| ||.||.|.  . .| 
Sbjct: 1901 FELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWH 1960

Query: 1813 KFK 1815
             ..
Sbjct: 1961 TYR 1963

>hg18||uc002rhj
        |2|NM_194323|Q9HC10-2|Q9HC10-2|OTOF|NM_194323|NP_919304|otoferlin
        isoform d

          Length = 1230

 Score =  83 bits (204), Expect = 3e-015
 Identities = 38/63 (60%), Positives = 49/63 (77%)

Query: 1753 FLLMGKVEAELQLVTLQQAEANPVGRARKEPEALEKPNRPTTSFNWFVNPMKTFIFLIWK 1812
            | | ||||||| |.| ..|| |||| || ||. ||||||| |.| ||.||.|.  .||  
Sbjct: 1134 FELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICT 1193

Query: 1813 KFK 1815
            ..|
Sbjct: 1194 RYK 1196

>hg18||uc001kin
        |10|NM_013451|Q9NZM1|MYOF_HUMAN|FER1L3|NM_013451|NP_038479|myoferlin
        isoform a

          Length = 2061

 Score =  78 bits (190), Expect = 1e-013
 Identities = 38/96 (39%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 752 ETRKFLKTLRLLAKEPQSTIPDVFLWLLRGTKRLAYVRIPAHSILFSLV-EEQRGCNCGR 810
           |   .|  |  | .|||...||. .|..|| ||||| ||||| .|.|   |   |  ||.
Sbjct: 753 EIEDWLDKLMQLTEEPQNSMPDIIIWMIRGEKRLAYARIPAHQVLYSTSGENASGKYCGK 812

Query: 811 VSTLYIKSP--GGSVSEIFAKLEVYMWLGLAKYSKE 844
             |...| |    .  ..  .| | .||||.   |.
Sbjct: 813 TQTIFLKYPQEKNNGPKVPVELRVNIWLGLSAVEKK 848

>hg18||uc001kio
        |10|NM_133337|Q5VWW4|Q5VWW4_HUMAN|FER1L3|NM_133337|NP_579899|myoferlin
        isoform b

          Length = 2048

 Score =  78 bits (190), Expect = 1e-013
 Identities = 38/96 (39%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 752 ETRKFLKTLRLLAKEPQSTIPDVFLWLLRGTKRLAYVRIPAHSILFSLV-EEQRGCNCGR 810
           |   .|  |  | .|||...||. .|..|| ||||| ||||| .|.|   |   |  ||.
Sbjct: 740 EIEDWLDKLMQLTEEPQNSMPDIIIWMIRGEKRLAYARIPAHQVLYSTSGENASGKYCGK 799

Query: 811 VSTLYIKSP--GGSVSEIFAKLEVYMWLGLAKYSKE 844
             |...| |    .  ..  .| | .||||.   |.
Sbjct: 800 TQTIFLKYPQEKNNGPKVPVELRVNIWLGLSAVEKK 835

>hg18||uc002sig
        |2|AK074104|Q8TEL8|Q8TEL8_HUMAN|DYSF|NM_003494|NP_003485|dysferlin

          Length = 1518

 Score =  75 bits (182), Expect = 1e-012
 Identities = 48/140 (34%), Positives = 73/140 (52%), Gaps = 3/140 (2%)

Query: 409 FPPLAQRIRVQILD-DAKMGDIILATHFLDLQQISDPTRNGNNCFSIGFNPVFGPSWINL 467
           || . ...|..|.| |    . |.|| .| . .|| |         .|| | ||| .|||
Sbjct:   2 FPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEVDDYLGFLPTFGPCYINL 61

Query: 468 YGSPQNST-LRDVHQALNEGLGEGIFYRGRILLALXXXXXXXXXXXXXXXXXXXHPLPEG 526
           ||||.  |   | .  || | |||. ||||.||.|                       | 
Sbjct:  62 YGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLPADDILRVEK 121

Query: 527 FLGEKEDFLLFASVFEITMM 546
           .|  .  . |||. .  ||.
Sbjct: 122 YL-RRRKYSLFAAFYSATML 140

>hg18||uc002xda |20|BC029951|Q5JX50|Q5JX50_HUMAN|C20orf124|NA|NA|Chromosome 20
        open reading frame 124 (Fragment)

          Length = 372

 Score =  70 bits (170), Expect = 2e-011
 Identities = 37/94 (39%), Positives = 53/94 (56%)

Query: 166 QVNVNVLEARKLVGVNINPAVFIRVENQKKNTMTQKSTNCXXXXXXXXXXXXXXXXILFD 225
           || | ||||.||||||||| | ..|  |.. | ||. |.|                 | |
Sbjct:  27 QVGVTVLEAQKLVGVNINPYVAVQVGGQRRVTATQRGTSCPFYNEYFLFEFHDTRLRLQD 86

Query: 226 KVIETKVCHRRILAFLLSHIGSFKIDLSTVYKQP 259
            ..|    | . | |. . ||.|..||  .  ||
Sbjct:  87 LLLEITAFHSQTLPFMATRIGTFRMDLGIILDQP 120

>hg18||uc001kin
        |10|NM_013451|Q9NZM1|MYOF_HUMAN|FER1L3|NM_013451|NP_038479|myoferlin
        isoform a

          Length = 2061

 Score =  69 bits (168), Expect = 4e-011
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 3/98 (3%)

Query: 1754 LLMGKVEAELQLVTLQQAEANPVGRARKEPE---ALEKPNRPTTSFNWFVNPMKTFIFLI 1810
            .. ||||  |...  ..|.  | |. | ||     |. |||| ||| || || ||  |..
Sbjct: 1961 VMAGKVEMTLEILNEKEADERPAGKGRDEPNMNPKLDLPNRPETSFLWFTNPCKTMKFIV 2020

Query: 1811 WKKFKKYXXXXXXXXXXXXXXXXXXYTLPQQITAMLIR 1848
            |..||                    |.||  ..  ...
Sbjct: 2021 WRRFKWVIIGLLFLLILLLFVAVLLYSLPNYLSMKIVK 2058

>hg18||uc001kio
        |10|NM_133337|Q5VWW4|Q5VWW4_HUMAN|FER1L3|NM_133337|NP_579899|myoferlin
        isoform b

          Length = 2048

 Score =  69 bits (168), Expect = 4e-011
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 3/98 (3%)

Query: 1754 LLMGKVEAELQLVTLQQAEANPVGRARKEPE---ALEKPNRPTTSFNWFVNPMKTFIFLI 1810
            .. ||||  |...  ..|.  | |. | ||     |. |||| ||| || || ||  |..
Sbjct: 1948 VMAGKVEMTLEILNEKEADERPAGKGRDEPNMNPKLDLPNRPETSFLWFTNPCKTMKFIV 2007

Query: 1811 WKKFKKYXXXXXXXXXXXXXXXXXXYTLPQQITAMLIR 1848
            |..||                    |.||  ..  ...
Sbjct: 2008 WRRFKWVIIGLLFLLILLLFVAVLLYSLPNYLSMKIVK 2045

>hg18||uc002sie
        |2|NM_003494|O75923|DYSF_HUMAN|DYSF|NM_003494|NP_003485|dysferlin

          Length = 2080

 Score =  59 bits (140), Expect = 7e-008
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 454 IGFNPVFGPSWINLYGSPQNST-LRDVHQALNEGLGEGIFYRGRILLALXXXXXXXXXXX 512
           .|| | ||| .|||||||.  |   | .  || | |||. ||||.||.|           
Sbjct: 512 LGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQK 571

Query: 513 XXXXXXXXHPLPEGFLGEKEDFLLFASVFEITMM 546
                       | .|  .  . |||. .  ||.
Sbjct: 572 VEDLPADDILRVEKYL-RRRKYSLFAAFYSATML 604

>hg18||uc002sif
        |2|DQ267935|Q0H395|Q0H395_HUMAN|DYSF|NM_003494|NP_003485|dysferlin

          Length = 2081

 Score =  59 bits (140), Expect = 7e-008
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 454 IGFNPVFGPSWINLYGSPQNST-LRDVHQALNEGLGEGIFYRGRILLALXXXXXXXXXXX 512
           .|| | ||| .|||||||.  |   | .  || | |||. ||||.||.|           
Sbjct: 513 LGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQK 572

Query: 513 XXXXXXXXHPLPEGFLGEKEDFLLFASVFEITMM 546
                       | .|  .  . |||. .  ||.
Sbjct: 573 VEDLPADDILRVEKYL-RRRKYSLFAAFYSATML 605

>hg18||uc001kin
        |10|NM_013451|Q9NZM1|MYOF_HUMAN|FER1L3|NM_013451|NP_038479|myoferlin
        isoform a

          Length = 2061

 Score =  57 bits (136), Expect = 2e-007
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 454 IGFNPVFGPSWINLYGSPQNST-LRDVHQALNEGLGEGIFYRGRILLAL 501
           .|| | ||| ..||||||.  |   | .  || | |||. ||||||. |
Sbjct: 493 VGFVPTFGPCYLNLYGSPREYTGFPDPYDELNTGKGEGVAYRGRILVEL 541

>hg18||uc001kio
        |10|NM_133337|Q5VWW4|Q5VWW4_HUMAN|FER1L3|NM_133337|NP_579899|myoferlin
        isoform b

          Length = 2048

 Score =  57 bits (136), Expect = 2e-007
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 454 IGFNPVFGPSWINLYGSPQNST-LRDVHQALNEGLGEGIFYRGRILLAL 501
           .|| | ||| ..||||||.  |   | .  || | |||. ||||||. |
Sbjct: 480 VGFVPTFGPCYLNLYGSPREYTGFPDPYDELNTGKGEGVAYRGRILVEL 528

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0