BLASTP 7.6.0


Query=fugu4_572111 |jgi|Takru4|572111|e_gw2.119.62.1
        (875 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001lth |11|AF533878|Q8IWQ3-2|Q8IWQ3-2|BRSK2|NA|NA|BR ser...    650   3e-186
hg18||uc001lti |11|AF533879|Q8IWQ3|BRSK2_HUMAN|BRSK2|NM_003957|N...    650   3e-186
hg18||uc001ltj |11|NM_003957|Q8IWQ3-3|Q8IWQ3-3|BRSK2|NM_003957|N...    650   3e-186
hg18||uc001ltl |11|AF533877|Q8IWQ3-2|Q8IWQ3-2|BRSK2|NM_003957|NP...    650   3e-186
hg18||uc001ltm |11|AK131534|Q8IWQ3-5|Q8IWQ3-5|BRSK2|NA|NA|BR ser...    650   3e-186
hg18||uc002qkf |19|AF479826|Q8TDC3|BRSK1_HUMAN|BRSK1|NM_032430|N...    599   7e-171
hg18||uc002qkg |19|NM_032430|Q8TDC3-2|Q8TDC3-2|BRSK1|NM_032430|N...    599   7e-171
hg18||uc001ppy |11|NM_025164|Q9Y2K2|QSK_HUMAN|KIAA0999|NM_025164...    248   4e-065
hg18||uc001plt |11|NM_015191|Q9H0K1|SN1L2_HUMAN|SNF1LK2|NM_01519...    245   2e-064
hg18||uc001pqa |11|BC128510|A1A5A8|A1A5A8_HUMAN|KIAA0999|NM_0251...    245   3e-064
hg18||uc003jmc |5|NM_006251|Q13131|AAPK1_HUMAN|PRKAA1|NM_006251|...    238   4e-062
hg18||uc001cyk |1|NM_006252|P54646|AAPK2_HUMAN|PRKAA2|NM_006252|...    236   9e-062
hg18||uc002zdf |21|NM_173354|P57059|SN1L1_HUMAN|SNF1LK|NM_173354...    236   1e-061
hg18||uc001ymw |14|NM_002376|P27448-3|P27448-3|MARK3|NM_002376|N...    235   3e-061
hg18||uc001ymx |14|AF387637|P27448-4|P27448-4|MARK3|NM_002376|NP...    235   3e-061
hg18||uc001nxv |11|NM_001039468|Q7KZI7-4|Q7KZI7-4|MARK2|NM_00103...    233   1e-060
hg18||uc001nxw |11|BC008771|Q7KZI7|MARK2_HUMAN|MARK2|NM_00103946...    233   1e-060
hg18||uc001nxx |11|AB188493|Q7KZI7-5|Q7KZI7-5|MARK2|NM_001039468...    233   1e-060
hg18||uc001nxy |11|AK225766|Q7KZI7-5|Q7KZI7-5|MARK2|NM_001039468...    233   1e-060
hg18||uc001nxz |11|NM_017490|Q7KZI7-3|Q7KZI7-3|MARK2|NM_017490|N...    233   1e-060
hg18||uc001nya |11|NM_004954|Q7KZI7-7|Q7KZI7-7|MARK2|NM_004954|N...    233   1e-060
hg18||uc001nyb |11|NM_001039469|Q7KZI7-6|Q7KZI7-6|MARK2|NM_00103...    233   1e-060
hg18||uc001hmn |1|BC114478|Q9P0L2|MARK1_HUMAN|MARK1|NM_018650|NP...    232   2e-060
hg18||uc001lth |11|AF533878|Q8IWQ3-2|Q8IWQ3-2|BRSK2|NA|NA|BR ser...    229   1e-059
hg18||uc001lti |11|AF533879|Q8IWQ3|BRSK2_HUMAN|BRSK2|NM_003957|N...    229   1e-059
hg18||uc001ltj |11|NM_003957|Q8IWQ3-3|Q8IWQ3-3|BRSK2|NM_003957|N...    229   1e-059
hg18||uc001ltl |11|AF533877|Q8IWQ3-2|Q8IWQ3-2|BRSK2|NM_003957|NP...    229   1e-059
hg18||uc001ltm |11|AK131534|Q8IWQ3-5|Q8IWQ3-5|BRSK2|NA|NA|BR ser...    229   1e-059
hg18||uc002pba |19|NM_031417|Q96L34-2|Q96L34-2|MARK4|NM_031417|N...    229   1e-059
hg18||uc002pbb |19|AY120867|Q96L34|MARK4_HUMAN|MARK4|NA|NA|MAP/m...    229   1e-059
hg18||uc001tlj |12|NM_014840|O60285|NUAK1_HUMAN|NUAK1|NM_014840|...    203   1e-051
hg18||uc003zzn |9|NM_014791|Q14680|MELK_HUMAN|MELK|NM_014791|NP_...    202   2e-051
hg18||uc001hce |1|NM_030952|Q9H093|NUAK2_HUMAN|NUAK2|NM_030952|N...    199   2e-050
hg18||uc002pbc |19|AK074578|Q8N2N5|Q8N2N5_HUMAN|MARKL1|NA|NA|CDN...    195   3e-049
hg18||uc001hmo |1|AK027493|Q9P0L2-2|Q9P0L2-2|MARK1|NM_018650|NP_...    194   5e-049
hg18||uc001hmm |1|NM_018650|Q9P0L2-3|Q9P0L2-3|MARK1|NM_018650|NP...    191   5e-048
hg18||uc001ppz |11|BC128511|A1A5A9|A1A5A9_HUMAN|KIAA0999|NA|NA|K...    190   1e-047
hg18||uc002qkf |19|AF479826|Q8TDC3|BRSK1_HUMAN|BRSK1|NM_032430|N...    184   5e-046
hg18||uc002qkg |19|NM_032430|Q8TDC3-2|Q8TDC3-2|BRSK1|NM_032430|N...    184   5e-046
hg18||uc002qkh |19|AK124999|NA|NA|BRSK1|NM_032430|NP_115806|BR s...    184   5e-046
hg18||uc003jmb |5|NM_206907|Q86VS1|Q86VS1_HUMAN|PRKAA1|NM_206907...    180   1e-044
hg18||uc002qkh |19|AK124999|NA|NA|BRSK1|NM_032430|NP_115806|BR s...    175   2e-043
hg18||uc001iln |10|NM_020397|Q8IU85-2|Q8IU85-2|CAMK1D|NM_020397|...    172   2e-042
hg18||uc001ilo |10|NM_153498|Q8IU85|KCC1D_HUMAN|CAMK1D|NM_153498...    172   2e-042
hg18||uc001ymz |14|AF465413|P27448-5|P27448-5|MARK3|NM_002376|NP...    171   4e-042
hg18||uc001yna |14|M80359|P27448-6|P27448-6|MARK3|NM_002376|NP_0...    171   4e-042
hg18||uc003bst |3|NM_003656|Q14012|KCC1A_HUMAN|CAMK1|NM_003656|N...    171   4e-042
hg18||uc003cmt |3|CR749621|Q9NRH2|SNRK_HUMAN|SNRK|NM_017719|NP_0...    169   1e-041
hg18||uc003cms |3|NM_017719|Q9NRH2|SNRK_HUMAN|SNRK|NM_017719|NP_...    164   4e-040
hg18||uc001jvm |10|NM_172171|Q13555|KCC2G_HUMAN|CAMK2G|NM_172171...    161   6e-039
hg18||uc001jvn |10|NM_172172|NA|NA|CAMK2G|NM_172172|NP_751912|ca...    161   6e-039
hg18||uc001jvo |10|NM_172169|Q5SQZ3|Q5SQZ3_HUMAN|CAMK2G|NM_17216...    161   6e-039
hg18||uc001jvp |10|NM_172170|Q13555-4|Q13555-4|CAMK2G|NM_172170|...    161   6e-039
hg18||uc001jvq |10|NM_172173|Q5SWX4|Q5SWX4_HUMAN|CAMK2G|NM_17217...    161   6e-039
hg18||uc001jvr |10|NM_001222|Q5SWX4|Q5SWX4_HUMAN|CAMK2G|NM_00122...    161   6e-039
hg18||uc001jvs |10|AK225771|Q13555-4|Q13555-4|CAMK2G|NM_172170|N...    161   6e-039
hg18||uc001jvv |10|AK131199|NA|NA|CAMK2G|NA|NA|Homo sapiens mRNA...    161   6e-039
hg18||uc003ibi |4|NM_001221|Q13557|KCC2D_HUMAN|CAMK2D|NM_001221|...    160   1e-038
hg18||uc003ibj |4|NM_172128|Q8N553|Q8N553_HUMAN|CAMK2D|NM_172128...    160   1e-038
hg18||uc003ibk |4|NM_172127|Q8N553|Q8N553_HUMAN|CAMK2D|NM_172127...    160   1e-038
hg18||uc003ibl |4|NM_172115|Q8N553|Q8N553_HUMAN|CAMK2D|NM_172115...    160   1e-038
hg18||uc003ibm |4|AB209288|Q59G21|Q59G21_HUMAN|CAMK2D|NM_172127|...    160   1e-038
hg18||uc003ibn |4|AY987011|Q52PK4|Q52PK4_HUMAN|CAMK2D|NM_172128|...    160   1e-038
hg18||uc001hhd |1|NM_020439|Q96NX5|KCC1G_HUMAN|CAMK1G|NM_020439|...    159   2e-038
hg18||uc001hhe |1|AK095713|Q96NX5|KCC1G_HUMAN|CAMK1G|NM_020439|N...    159   2e-038
hg18||uc001hhf |1|AY212935|Q96NX5-2|Q96NX5-2|CAMK1G|NM_020439|NP...    159   2e-038
hg18||uc003ibo |4|BC022558|Q4G1A8|Q4G1A8_HUMAN|CAMK2D|NM_172128|...    158   3e-038
hg18||uc003jno |5|NM_153361|Q8IY84|NIM1_HUMAN|MGC42105|NM_153361...    158   3e-038
hg18||uc002yph |21|NM_014586|P57058|HUNK_HUMAN|HUNK|NM_014586|NP...    154   4e-037
hg18||uc004apc |9|AB208871|Q1W5W0|Q1W5W0_HUMAN|DAPK1|NM_004938|N...    152   3e-036
hg18||uc004apd |9|NM_004938|Q1W5W0|Q1W5W0_HUMAN|DAPK1|NM_004938|...    152   3e-036
hg18||uc002lzc |19|NM_001348|O43293|DAPK3_HUMAN|DAPK3|NM_001348|...    149   1e-035
hg18||uc002lzd |19|AK027590|O43293|DAPK3_HUMAN|DAPK3|NM_001348|N...    149   1e-035
hg18||uc003kpe |5|L24959|Q16566|KCC4_HUMAN|CAMK4|NM_001744|NP_00...    148   4e-035
hg18||uc003kpf |5|NM_001744|Q16566|KCC4_HUMAN|CAMK4|NM_001744|NP...    148   4e-035
hg18||uc004cri |X|NM_005044|P51817|PRKX_HUMAN|PRKX|NM_005044|NP_...    148   4e-035
hg18||uc002amr |15|NM_014326|Q9UIK4|DAPK2_HUMAN|DAPK2|NM_014326|...    147   7e-035
hg18||uc003cgi |3|AK122988|Q9C098|DCAK3_HUMAN|DCAMKL3|NA|NA|Seri...    147   7e-035
hg18||uc004agy |9|NM_002732|P22612|KAPCG_HUMAN|PRKACG|NM_002732|...    144   8e-034
hg18||uc001qcf |11|BC004202|O14757|CHK1_HUMAN|CHEK1|NM_001274|NP...    140   8e-033
hg18||uc001qcg |11|NM_001274|O14757|CHK1_HUMAN|CHEK1|NM_001274|N...    140   8e-033
hg18||uc002dzk |16|NM_000294|P15735|PHKG2_HUMAN|PHKG2|NM_000294|...    140   8e-033
hg18||uc002myb |19|NM_207518|P17612-2|P17612-2|PRKACA|NM_207518|...    140   1e-032
hg18||uc002myc |19|NM_002730|P17612|KAPCA_HUMAN|PRKACA|NM_002730...    140   1e-032
hg18||uc004czu |X|NM_004586|P51812|KS6A3_HUMAN|RPS6KA3|NM_004586...    140   1e-032
hg18||uc004czv |X|AB208933|P51812|KS6A3_HUMAN|RPS6KA3|NM_004586|...    140   1e-032
hg18||uc001bmr |1|NM_002953|Q15418|KS6A1_HUMAN|RPS6KA1|NM_002953...    139   2e-032
hg18||uc001bms |1|NM_001006665|Q15418|KS6A1_HUMAN|RPS6KA1|NM_001...    139   2e-032
hg18||uc003qvb |6|NM_021135|Q15349|KS6A2_HUMAN|RPS6KA2|NM_021135...    139   2e-032
hg18||uc003qvc |6|NM_001006932|Q15349|KS6A2_HUMAN|RPS6KA2|NM_001...    139   2e-032
hg18||uc003qvd |6|AB209116|Q15349-2|Q15349-2|RPS6KA2|NM_021135|N...    139   2e-032
hg18||uc001djj |1|NM_002731|P22694|KAPCB_HUMAN|PRKACB|NM_002731|...    138   3e-032
hg18||uc001djl |1|NM_182948|Q14VH1|Q14VH1_HUMAN|PRKACB|NM_182948...    138   3e-032
hg18||uc001djn |1|CR936631|P22694-7|P22694-7|PRKACB|NM_002731|NP...    138   3e-032
hg18||uc001djp |1|AB209189|P22694-6|P22694-6|PRKACB|NM_002731|NP...    138   3e-032
hg18||uc002xxd |20|NM_198433|O14965|STK6_HUMAN|AURKA|NM_198433|N...    138   3e-032
hg18||uc002xxe |20|NM_198434|O14965|STK6_HUMAN|AURKA|NM_198434|N...    138   3e-032
hg18||uc002xxf |20|NM_198436|O14965|STK6_HUMAN|AURKA|NM_198436|N...    138   3e-032
hg18||uc002qoc |19|NM_001015879|Q9UQB9-2|Q9UQB9-2|AURKC|NM_00101...    138   4e-032
hg18||uc002qod |19|NM_003160|Q9UQB9-2|Q9UQB9-2|AURKC|NM_003160|N...    138   4e-032

>hg18||uc001lth |11|AF533878|Q8IWQ3-2|Q8IWQ3-2|BRSK2|NA|NA|BR
        serine/threonine-protein kinase 2 (EC 2.7.11.1) (Serine/threonine-
        protein kinase 29) (Serine/threonine kinase SAD-A)

          Length = 674

 Score =  650 bits (1676), Expect = 3e-186
 Identities = 325/421 (77%), Positives = 344/421 (81%), Gaps = 5/421 (1%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |..| . . . | .||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  47 IKIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 106

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           |||||||||||||||||||.||||||||||||||||||||||||||||||||||||||||
Sbjct: 107 LVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 166

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||
Sbjct: 167 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRQLLE 226

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVPRK 367
           ||| ||||||||||||||.||||||||||..||||| |||| ||||||||||||||.|||
Sbjct: 227 KVKRGVFHMPHFIPPDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPEQPIPRK 286

Query: 368 VTIRSLPSADDIDPDVLDSMHSLGCFRXXXXXXXXXXXXXXXQEKMIYFLLLDRKERYPS 427
           | |||||| .|||||||||||||||||               ||||||||||||||||||
Sbjct: 287 VQIRSLPSLEDIDPDVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPS 346

Query: 428 QEDQNLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIDMTQH 487
           |||..||||||||||||||||||||||||||||||||||||||||||||||||||.| ||
Sbjct: 347 QEDEDLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQH 406

Query: 488 XXXXXXXXXXXXXXXXXXXXXXXXV-----RKFCVPPLSPDLSQSPNTSPCPSPEPIPSR 542
                                         |   .|        .|  ||  .| | |  
Sbjct: 407 GQRSRSISGASSGLSTSPLSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPS 466

Query: 543 S 543
           |
Sbjct: 467 S 467

>hg18||uc001lti |11|AF533879|Q8IWQ3|BRSK2_HUMAN|BRSK2|NM_003957|NP_003948|BR
        serine/threonine kinase 2

          Length = 736

 Score =  650 bits (1676), Expect = 3e-186
 Identities = 325/421 (77%), Positives = 344/421 (81%), Gaps = 5/421 (1%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |..| . . . | .||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  47 IKIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 106

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           |||||||||||||||||||.||||||||||||||||||||||||||||||||||||||||
Sbjct: 107 LVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 166

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||
Sbjct: 167 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRQLLE 226

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVPRK 367
           ||| ||||||||||||||.||||||||||..||||| |||| ||||||||||||||.|||
Sbjct: 227 KVKRGVFHMPHFIPPDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPEQPIPRK 286

Query: 368 VTIRSLPSADDIDPDVLDSMHSLGCFRXXXXXXXXXXXXXXXQEKMIYFLLLDRKERYPS 427
           | |||||| .|||||||||||||||||               ||||||||||||||||||
Sbjct: 287 VQIRSLPSLEDIDPDVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPS 346

Query: 428 QEDQNLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIDMTQH 487
           |||..||||||||||||||||||||||||||||||||||||||||||||||||||.| ||
Sbjct: 347 QEDEDLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQH 406

Query: 488 XXXXXXXXXXXXXXXXXXXXXXXXV-----RKFCVPPLSPDLSQSPNTSPCPSPEPIPSR 542
                                         |   .|        .|  ||  .| | |  
Sbjct: 407 GQRSRSISGASSGLSTSPLSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPS 466

Query: 543 S 543
           |
Sbjct: 467 S 467

>hg18||uc001ltj |11|NM_003957|Q8IWQ3-3|Q8IWQ3-3|BRSK2|NM_003957|NP_003948|BR
        serine/threonine kinase 2

          Length = 668

 Score =  650 bits (1676), Expect = 3e-186
 Identities = 325/421 (77%), Positives = 344/421 (81%), Gaps = 5/421 (1%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |..| . . . | .||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  47 IKIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 106

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           |||||||||||||||||||.||||||||||||||||||||||||||||||||||||||||
Sbjct: 107 LVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 166

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||
Sbjct: 167 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRQLLE 226

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVPRK 367
           ||| ||||||||||||||.||||||||||..||||| |||| ||||||||||||||.|||
Sbjct: 227 KVKRGVFHMPHFIPPDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPEQPIPRK 286

Query: 368 VTIRSLPSADDIDPDVLDSMHSLGCFRXXXXXXXXXXXXXXXQEKMIYFLLLDRKERYPS 427
           | |||||| .|||||||||||||||||               ||||||||||||||||||
Sbjct: 287 VQIRSLPSLEDIDPDVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPS 346

Query: 428 QEDQNLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIDMTQH 487
           |||..||||||||||||||||||||||||||||||||||||||||||||||||||.| ||
Sbjct: 347 QEDEDLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQH 406

Query: 488 XXXXXXXXXXXXXXXXXXXXXXXXV-----RKFCVPPLSPDLSQSPNTSPCPSPEPIPSR 542
                                         |   .|        .|  ||  .| | |  
Sbjct: 407 GQRSRSISGASSGLSTSPLSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPS 466

Query: 543 S 543
           |
Sbjct: 467 S 467

>hg18||uc001ltl |11|AF533877|Q8IWQ3-2|Q8IWQ3-2|BRSK2|NM_003957|NP_003948|BR
        serine/threonine kinase 2

          Length = 674

 Score =  650 bits (1676), Expect = 3e-186
 Identities = 325/421 (77%), Positives = 344/421 (81%), Gaps = 5/421 (1%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |..| . . . | .||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  47 IKIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 106

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           |||||||||||||||||||.||||||||||||||||||||||||||||||||||||||||
Sbjct: 107 LVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 166

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||
Sbjct: 167 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRQLLE 226

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVPRK 367
           ||| ||||||||||||||.||||||||||..||||| |||| ||||||||||||||.|||
Sbjct: 227 KVKRGVFHMPHFIPPDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPEQPIPRK 286

Query: 368 VTIRSLPSADDIDPDVLDSMHSLGCFRXXXXXXXXXXXXXXXQEKMIYFLLLDRKERYPS 427
           | |||||| .|||||||||||||||||               ||||||||||||||||||
Sbjct: 287 VQIRSLPSLEDIDPDVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPS 346

Query: 428 QEDQNLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIDMTQH 487
           |||..||||||||||||||||||||||||||||||||||||||||||||||||||.| ||
Sbjct: 347 QEDEDLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQH 406

Query: 488 XXXXXXXXXXXXXXXXXXXXXXXXV-----RKFCVPPLSPDLSQSPNTSPCPSPEPIPSR 542
                                         |   .|        .|  ||  .| | |  
Sbjct: 407 GQRSRSISGASSGLSTSPLSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPS 466

Query: 543 S 543
           |
Sbjct: 467 S 467

>hg18||uc001ltm |11|AK131534|Q8IWQ3-5|Q8IWQ3-5|BRSK2|NA|NA|BR
        serine/threonine-protein kinase 2 (EC 2.7.11.1) (Serine/threonine-
        protein kinase 29) (Serine/threonine kinase SAD-A)

          Length = 766

 Score =  650 bits (1676), Expect = 3e-186
 Identities = 325/421 (77%), Positives = 344/421 (81%), Gaps = 5/421 (1%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |..| . . . | .||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  93 IKIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 152

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           |||||||||||||||||||.||||||||||||||||||||||||||||||||||||||||
Sbjct: 153 LVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 212

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||
Sbjct: 213 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRQLLE 272

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVPRK 367
           ||| ||||||||||||||.||||||||||..||||| |||| ||||||||||||||.|||
Sbjct: 273 KVKRGVFHMPHFIPPDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPEQPIPRK 332

Query: 368 VTIRSLPSADDIDPDVLDSMHSLGCFRXXXXXXXXXXXXXXXQEKMIYFLLLDRKERYPS 427
           | |||||| .|||||||||||||||||               ||||||||||||||||||
Sbjct: 333 VQIRSLPSLEDIDPDVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPS 392

Query: 428 QEDQNLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIDMTQH 487
           |||..||||||||||||||||||||||||||||||||||||||||||||||||||.| ||
Sbjct: 393 QEDEDLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQH 452

Query: 488 XXXXXXXXXXXXXXXXXXXXXXXXV-----RKFCVPPLSPDLSQSPNTSPCPSPEPIPSR 542
                                         |   .|        .|  ||  .| | |  
Sbjct: 453 GQRSRSISGASSGLSTSPLSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPS 512

Query: 543 S 543
           |
Sbjct: 513 S 513

>hg18||uc002qkf |19|AF479826|Q8TDC3|BRSK1_HUMAN|BRSK1|NM_032430|NP_115806|BR
        serine/threonine kinase 1

          Length = 794

 Score =  599 bits (1543), Expect = 7e-171
 Identities = 307/434 (70%), Positives = 341/434 (78%), Gaps = 26/434 (5%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |..| . . . | .||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  78 IKIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 137

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           |||||||||||||||||||.||||||||.|||||||||||||||||||||||||||||||
Sbjct: 138 LVKKGRLTPKEARKFFRQIVSALDFCHSYSICHRDLKPENLLLDEKNNIRIADFGMASLQ 197

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
           |||||||||||||||||||||.|||||||.||.||||||||||||||||||||||| |||
Sbjct: 198 VGDSLLETSCGSPHYACPEVIKGEKYDGRRADMWSCGVILFALLVGALPFDDDNLRQLLE 257

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEP-EQPVP- 365
           ||| ||||||||||||||.||||||||.  |||.||||||| ||.|||.||.|  .| | 
Sbjct: 258 KVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPG 317

Query: 366 RKVTIRSLPSADDIDPDVLDSMHSLGCFRXXXXXXXXXXXXXXXQEKMIYFLLLDRKERY 425
           |.| .|||||  ..|||||.|| ||||||               ||||||.|||||||||
Sbjct: 318 RRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKERY 377

Query: 426 PSQEDQNLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTD---GGSPVPARRAI 482
           || |||.|||||..||||||||||||.||||||||||||||||.||   |||||| |||.
Sbjct: 378 PSCEDQDLPPRNDVDPPRKRVDSPMLSRHGKRRPERKSMEVLSITDAGGGGSPVPTRRAL 437

Query: 483 DMTQHXXXXXXXXXXXXXXXXXXXXXXXXVRKFCVPPLSPDLSQSPNT----------SP 532
           .| ||                               | ||  | ||            ||
Sbjct: 438 EMAQHSQRSRSVSGASTGLSSSPLSS----------PRSPVFSFSPEPGAGDEARGGGSP 487

Query: 533 CPSPEPIPSRSGPR 546
               . .||| |||
Sbjct: 488 TSKTQTLPSR-GPR 500

>hg18||uc002qkg |19|NM_032430|Q8TDC3-2|Q8TDC3-2|BRSK1|NM_032430|NP_115806|BR
        serine/threonine kinase 1

          Length = 778

 Score =  599 bits (1543), Expect = 7e-171
 Identities = 307/434 (70%), Positives = 341/434 (78%), Gaps = 26/434 (5%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |..| . . . | .||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  62 IKIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 121

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           |||||||||||||||||||.||||||||.|||||||||||||||||||||||||||||||
Sbjct: 122 LVKKGRLTPKEARKFFRQIVSALDFCHSYSICHRDLKPENLLLDEKNNIRIADFGMASLQ 181

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
           |||||||||||||||||||||.|||||||.||.||||||||||||||||||||||| |||
Sbjct: 182 VGDSLLETSCGSPHYACPEVIKGEKYDGRRADMWSCGVILFALLVGALPFDDDNLRQLLE 241

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEP-EQPVP- 365
           ||| ||||||||||||||.||||||||.  |||.||||||| ||.|||.||.|  .| | 
Sbjct: 242 KVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPG 301

Query: 366 RKVTIRSLPSADDIDPDVLDSMHSLGCFRXXXXXXXXXXXXXXXQEKMIYFLLLDRKERY 425
           |.| .|||||  ..|||||.|| ||||||               ||||||.|||||||||
Sbjct: 302 RRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKERY 361

Query: 426 PSQEDQNLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTD---GGSPVPARRAI 482
           || |||.|||||..||||||||||||.||||||||||||||||.||   |||||| |||.
Sbjct: 362 PSCEDQDLPPRNDVDPPRKRVDSPMLSRHGKRRPERKSMEVLSITDAGGGGSPVPTRRAL 421

Query: 483 DMTQHXXXXXXXXXXXXXXXXXXXXXXXXVRKFCVPPLSPDLSQSPNT----------SP 532
           .| ||                               | ||  | ||            ||
Sbjct: 422 EMAQHSQRSRSVSGASTGLSSSPLSS----------PRSPVFSFSPEPGAGDEARGGGSP 471

Query: 533 CPSPEPIPSRSGPR 546
               . .||| |||
Sbjct: 472 TSKTQTLPSR-GPR 484

>hg18||uc001ppy
        |11|NM_025164|Q9Y2K2|QSK_HUMAN|KIAA0999|NM_025164|NP_079440|KIAA0999
        protein

          Length = 1263

 Score =  248 bits (631), Expect = 4e-065
 Identities = 125/307 (40%), Positives = 190/307 (61%), Gaps = 2/307 (0%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |. . .     | .. ||. |.|.. |||...|. | | .. .||| |. ||||.||.
Sbjct:  36 IKIIDKTQLDEENLKKIFREVQIMKMLCHPHIIRLYQVMETERMIYLVTEYASGGEIFDH 95

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           ||  ||.  ||||. |.||..|. |||  .| ||||| ||||||   ||.||||| ..| 
Sbjct:  96 LVAHGRMAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDANLNIKIADFGFSNLF 155

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
               ||.| |||| || ||.  |..||| | |.|| ||.|. |. ||||||   |.||  
Sbjct: 156 TPGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTLQNLRA 215

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVPRK 367
           .|  | | .| |.  .|..|.| |. .| .|||..||| || |   |  .|  .. .   
Sbjct: 216 RVLSGKFRIPFFMSTECEHLIRHMLVLDPNKRLSMEQICKHKWMKLGDADPNFDRLIAEC 275

Query: 368 VTIRSLPSADDIDPDVLDSMHSLGCFRXXXXXXXXXXXXXXXQEKMIYFLLLDRKERYPS 427
             ..     | .. ||| .|  .|  .                   || || || .|. .
Sbjct: 276 QQLKEERQVDPLNEDVLLAMEDMGLDK--EQTLQSLRSDAYDHYSAIYSLLCDRHKRHKT 333

Query: 428 QEDQNLP 434
                ||
Sbjct: 334 LRLGALP 340

>hg18||uc001plt
        |11|NM_015191|Q9H0K1|SN1L2_HUMAN|SNF1LK2|NM_015191|NP_056006|SNF1-like
        kinase 2

          Length = 926

 Score =  245 bits (624), Expect = 2e-064
 Identities = 127/300 (42%), Positives = 181/300 (60%), Gaps = 5/300 (1%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |. . .     | .. ||. |.|...|||..||. | | |  |||| |.   ||.|||
Sbjct:  48 IKIIDKSQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDY 107

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           |   |||   |||. | ||.||.|.||   | ||||| ||||||   ||.|||||  .  
Sbjct: 108 LANHGRLNESEARRKFWQILSAVDYCHGRKIVHRDLKAENLLLDNNMNIKIADFGFGNFF 167

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
               || | |||| || |||  |..|.| . |.|| ||.|. |. ||||||   |  | .
Sbjct: 168 KSGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQ 227

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVPRK 367
           .|  | | .|.|.  ||..|.| |. .| |||||. ||..| | .    |   ..||   
Sbjct: 228 RVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLTIAQIKEHKWML---IEVPVQRPVLYP 284

Query: 368 VTIRSLPSADDIDPDVLDSMHSLGCFRXXXXXXXXXXXXXXXQEKMIYFLLLDRKERYPS 427
               . ||  . .  ||  |||||  .                   |||||..| . . |
Sbjct: 285 QEQENEPSIGEFNEQVLRLMHSLGIDQQKTIESLQNKSYNHF--AAIYFLLVERLKSHRS 342

>hg18||uc001pqa
        |11|BC128510|A1A5A8|A1A5A8_HUMAN|KIAA0999|NM_025164|NP_079440|KIAA0999
        protein

          Length = 1203

 Score =  245 bits (623), Expect = 3e-064
 Identities = 116/264 (43%), Positives = 177/264 (67%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |. . .     | .. ||. |.|.. |||...|. | | .. .||| |. ||||.||.
Sbjct:  36 IKIIDKTQLDEENLKKIFREVQIMKMLCHPHIIRLYQVMETERMIYLVTEYASGGEIFDH 95

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           ||  ||.  ||||. |.||..|. |||  .| ||||| ||||||   ||.||||| ..| 
Sbjct:  96 LVAHGRMAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDANLNIKIADFGFSNLF 155

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
               ||.| |||| || ||.  |..||| | |.|| ||.|. |. ||||||   |.||  
Sbjct: 156 TPGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTLQNLRA 215

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVPRK 367
           .|  | | .| |.  .|..|.| |. .| .|||..||| || |   |  .|  .. .   
Sbjct: 216 RVLSGKFRIPFFMSTECEHLIRHMLVLDPNKRLSMEQICKHKWMKLGDADPNFDRLIAEC 275

Query: 368 VTIRSLPSADDIDPDVLDSMHSLG 391
             ..     | .. ||| .|  .|
Sbjct: 276 QQLKEERQVDPLNEDVLLAMEDMG 299

>hg18||uc003jmc
        |5|NM_006251|Q13131|AAPK1_HUMAN|PRKAA1|NM_006251|NP_006242|protein
        kinase, AMP-activated, alpha 1 catalytic

          Length = 559

 Score =  238 bits (605), Expect = 4e-062
 Identities = 108/223 (48%), Positives = 158/223 (70%), Gaps = 1/223 (0%)

Query: 130 ILHRLRF-TITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYL 188
           ||.| .  ..  . .. |||  |||  |||..||. |      ...|.|.|||||||||.
Sbjct:  57 ILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYI 116

Query: 189 VKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQV 248
            | |||  ||.|. |.||.| .|.|| | . ||||||||.|||   | .|||||....  
Sbjct: 117 CKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMS 176

Query: 249 GDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEK 308
               | ||||||.|| |||| |  | | . |.|| ||||.||| | ||||||..  | .|
Sbjct: 177 DGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKK 236

Query: 309 VKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWY 351
           .  |.|. | .. |   .||. |..||  || |.. |..| |.
Sbjct: 237 ICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWF 279

>hg18||uc001cyk
        |1|NM_006252|P54646|AAPK2_HUMAN|PRKAA2|NM_006252|NP_006243|AMP-activate
        d protein kinase alpha 2 catalytic

          Length = 552

 Score =  236 bits (602), Expect = 9e-062
 Identities = 108/223 (48%), Positives = 158/223 (70%), Gaps = 1/223 (0%)

Query: 130 ILHRLRF-TITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYL 188
           ||.| .  ..  . ...|||  |||  |||..||. |       ..|.|.|||||||||.
Sbjct:  46 ILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYI 105

Query: 189 VKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQV 248
            | ||.   |||. |.||.||.|.|| | . ||||||||.|||   | .|||||....  
Sbjct: 106 CKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMS 165

Query: 249 GDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEK 308
               | ||||||.|| |||| |  | | . |.|||||||.||| | |||||...  | .|
Sbjct: 166 DGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKK 225

Query: 309 VKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWY 351
           .. |||..| ..      ||  |..||  || |.. |..| |.
Sbjct: 226 IRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWF 268

>hg18||uc002zdf
        |21|NM_173354|P57059|SN1L1_HUMAN|SNF1LK|NM_173354|NP_775490|SNF1-like
        kinase

          Length = 783

 Score =  236 bits (601), Expect = 1e-061
 Identities = 123/314 (39%), Positives = 179/314 (57%), Gaps = 4/314 (1%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |. . |   . | .. ||. ..||. |||..||. | | |  ||.| |    ||.|||
Sbjct:  55 IKIIDKTRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDY 114

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           |   | |.  |||| | ||.||...|| | | ||||| ||||||   .|..||||  .  
Sbjct: 115 LTSNGHLSENEARKKFWQILSAVEYCHDHHIVHRDLKTENLLLDGNMDIKLADFGFGNFY 174

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
                | | |||| || |||  |..|.| . |.|| ||.|. |. |.||||  ||  | .
Sbjct: 175 KSGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQ 234

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVPRK 367
           .|  | | .| |.  ||..|.| |. || ..|.|. ||..| |       | |  |    
Sbjct: 235 RVLEGRFRIPFFMSQDCESLIRRMLVVDPARRITIAQIRQHRWMRAEPCLPGPACPAFSA 294

Query: 368 VTIRSLPSADDIDPDVLDSMHSLGCFRXXXXXXXXXXXXXXXQEKMIYFLLLDRKERYPS 427
            .  |  .  | |   |  | .||  |                   ||.|||.| . | .
Sbjct: 295 HSYTS--NLGDYDEQALGIMQTLGVDRQRTVESLQNSSYNHF--AAIYYLLLERLKEYRN 350

Query: 428 QEDQNLPPRNEIDP 441
            .     |  .  |
Sbjct: 351 AQCARPGPARQPRP 364

>hg18||uc001ymw
        |14|NM_002376|P27448-3|P27448-3|MARK3|NM_002376|NP_002367|MAP/microtubu
        le affinity-regulating kinase 3

          Length = 729

 Score =  235 bits (597), Expect = 3e-061
 Identities = 113/232 (48%), Positives = 158/232 (68%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |. . .   | | .. ||. |.|.. ||...|| .| | .| |||..|. ||||.|||
Sbjct:  84 IKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDY 143

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           ||  ||.  ||||  ||||.||. .||   | ||||| ||||||   ||.||||| ..  
Sbjct: 144 LVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEF 203

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
                |.| |||| || ||. .|.|||| . |||| ||||. |. |.||||  ||. | |
Sbjct: 204 TVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRE 263

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPE 359
           .|  | . .| ..  ||.|||.  . ..  || ||||| |  |   |  | |
Sbjct: 264 RVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDE 315

>hg18||uc001ymx
        |14|AF387637|P27448-4|P27448-4|MARK3|NM_002376|NP_002367|MAP/microtubul
        e affinity-regulating kinase 3

          Length = 744

 Score =  235 bits (597), Expect = 3e-061
 Identities = 113/232 (48%), Positives = 158/232 (68%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |. . .   | | .. ||. |.|.. ||...|| .| | .| |||..|. ||||.|||
Sbjct:  84 IKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDY 143

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           ||  ||.  ||||  ||||.||. .||   | ||||| ||||||   ||.||||| ..  
Sbjct: 144 LVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEF 203

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
                |.| |||| || ||. .|.|||| . |||| ||||. |. |.||||  ||. | |
Sbjct: 204 TVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRE 263

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPE 359
           .|  | . .| ..  ||.|||.  . ..  || ||||| |  |   |  | |
Sbjct: 264 RVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDE 315

>hg18||uc001nxv
        |11|NM_001039468|Q7KZI7-4|Q7KZI7-4|MARK2|NM_001039468|NP_001034557|MAP/
        microtubule affinity-regulating kinase 2

          Length = 724

 Score =  233 bits (592), Expect = 1e-060
 Identities = 115/239 (48%), Positives = 164/239 (68%), Gaps = 3/239 (1%)

Query: 130 ILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLV 189
           |. . .   . | .. ||. |.|.. ||...|| .| | .| ||||.|. ||||.|||||
Sbjct:  83 IIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLV 142

Query: 190 KKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVG 249
             ||.  ||||  ||||.||. .||   | ||||| ||||||   ||.||||| ..    
Sbjct: 143 AHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTF 202

Query: 250 DSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKV 309
            . |.| |||| || ||. .|.|||| . |||| ||||. |. |.||||  ||. | |.|
Sbjct: 203 GNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV 262

Query: 310 KLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPE---QPVP 365
             | . .| ..  ||.|||.  . .. ||| ||||| |  |   |  . | .   .|.|
Sbjct: 263 LRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLP 321

>hg18||uc001nxw
        |11|BC008771|Q7KZI7|MARK2_HUMAN|MARK2|NM_001039469|NP_001034558|MAP/mic
        rotubule affinity-regulating kinase 2

          Length = 788

 Score =  233 bits (592), Expect = 1e-060
 Identities = 115/239 (48%), Positives = 164/239 (68%), Gaps = 3/239 (1%)

Query: 130 ILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLV 189
           |. . .   . | .. ||. |.|.. ||...|| .| | .| ||||.|. ||||.|||||
Sbjct:  83 IIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLV 142

Query: 190 KKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVG 249
             ||.  ||||  ||||.||. .||   | ||||| ||||||   ||.||||| ..    
Sbjct: 143 AHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTF 202

Query: 250 DSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKV 309
            . |.| |||| || ||. .|.|||| . |||| ||||. |. |.||||  ||. | |.|
Sbjct: 203 GNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV 262

Query: 310 KLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPE---QPVP 365
             | . .| ..  ||.|||.  . .. ||| ||||| |  |   |  . | .   .|.|
Sbjct: 263 LRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLP 321

>hg18||uc001nxx
        |11|AB188493|Q7KZI7-5|Q7KZI7-5|MARK2|NM_001039468|NP_001034557|MAP/micr
        otubule affinity-regulating kinase 2

          Length = 719

 Score =  233 bits (592), Expect = 1e-060
 Identities = 115/239 (48%), Positives = 164/239 (68%), Gaps = 3/239 (1%)

Query: 130 ILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLV 189
           |. . .   . | .. ||. |.|.. ||...|| .| | .| ||||.|. ||||.|||||
Sbjct:  83 IIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLV 142

Query: 190 KKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVG 249
             ||.  ||||  ||||.||. .||   | ||||| ||||||   ||.||||| ..    
Sbjct: 143 AHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTF 202

Query: 250 DSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKV 309
            . |.| |||| || ||. .|.|||| . |||| ||||. |. |.||||  ||. | |.|
Sbjct: 203 GNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV 262

Query: 310 KLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPE---QPVP 365
             | . .| ..  ||.|||.  . .. ||| ||||| |  |   |  . | .   .|.|
Sbjct: 263 LRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLP 321

>hg18||uc001nxy
        |11|AK225766|Q7KZI7-5|Q7KZI7-5|MARK2|NM_001039468|NP_001034557|MAP/micr
        otubule affinity-regulating kinase 2

          Length = 709

 Score =  233 bits (592), Expect = 1e-060
 Identities = 115/239 (48%), Positives = 164/239 (68%), Gaps = 3/239 (1%)

Query: 130 ILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLV 189
           |. . .   . | .. ||. |.|.. ||...|| .| | .| ||||.|. ||||.|||||
Sbjct:  83 IIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLV 142

Query: 190 KKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVG 249
             ||.  ||||  ||||.||. .||   | ||||| ||||||   ||.||||| ..    
Sbjct: 143 AHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTF 202

Query: 250 DSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKV 309
            . |.| |||| || ||. .|.|||| . |||| ||||. |. |.||||  ||. | |.|
Sbjct: 203 GNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV 262

Query: 310 KLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPE---QPVP 365
             | . .| ..  ||.|||.  . .. ||| ||||| |  |   |  . | .   .|.|
Sbjct: 263 LRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLP 321

>hg18||uc001nxz
        |11|NM_017490|Q7KZI7-3|Q7KZI7-3|MARK2|NM_017490|NP_059672|MAP/microtubu
        le affinity-regulating kinase 2

          Length = 745

 Score =  233 bits (592), Expect = 1e-060
 Identities = 115/239 (48%), Positives = 164/239 (68%), Gaps = 3/239 (1%)

Query: 130 ILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLV 189
           |. . .   . | .. ||. |.|.. ||...|| .| | .| ||||.|. ||||.|||||
Sbjct:  50 IIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLV 109

Query: 190 KKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVG 249
             ||.  ||||  ||||.||. .||   | ||||| ||||||   ||.||||| ..    
Sbjct: 110 AHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTF 169

Query: 250 DSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKV 309
            . |.| |||| || ||. .|.|||| . |||| ||||. |. |.||||  ||. | |.|
Sbjct: 170 GNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV 229

Query: 310 KLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPE---QPVP 365
             | . .| ..  ||.|||.  . .. ||| ||||| |  |   |  . | .   .|.|
Sbjct: 230 LRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLP 288

>hg18||uc001nya
        |11|NM_004954|Q7KZI7-7|Q7KZI7-7|MARK2|NM_004954|NP_004945|MAP/microtubu
        le affinity-regulating kinase 2

          Length = 691

 Score =  233 bits (592), Expect = 1e-060
 Identities = 115/239 (48%), Positives = 164/239 (68%), Gaps = 3/239 (1%)

Query: 130 ILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLV 189
           |. . .   . | .. ||. |.|.. ||...|| .| | .| ||||.|. ||||.|||||
Sbjct:  50 IIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLV 109

Query: 190 KKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVG 249
             ||.  ||||  ||||.||. .||   | ||||| ||||||   ||.||||| ..    
Sbjct: 110 AHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTF 169

Query: 250 DSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKV 309
            . |.| |||| || ||. .|.|||| . |||| ||||. |. |.||||  ||. | |.|
Sbjct: 170 GNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV 229

Query: 310 KLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPE---QPVP 365
             | . .| ..  ||.|||.  . .. ||| ||||| |  |   |  . | .   .|.|
Sbjct: 230 LRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLP 288

>hg18||uc001nyb
        |11|NM_001039469|Q7KZI7-6|Q7KZI7-6|MARK2|NM_001039469|NP_001034558|MAP/
        microtubule affinity-regulating kinase 2

          Length = 755

 Score =  233 bits (592), Expect = 1e-060
 Identities = 115/239 (48%), Positives = 164/239 (68%), Gaps = 3/239 (1%)

Query: 130 ILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLV 189
           |. . .   . | .. ||. |.|.. ||...|| .| | .| ||||.|. ||||.|||||
Sbjct:  50 IIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLV 109

Query: 190 KKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVG 249
             ||.  ||||  ||||.||. .||   | ||||| ||||||   ||.||||| ..    
Sbjct: 110 AHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTF 169

Query: 250 DSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKV 309
            . |.| |||| || ||. .|.|||| . |||| ||||. |. |.||||  ||. | |.|
Sbjct: 170 GNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV 229

Query: 310 KLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPE---QPVP 365
             | . .| ..  ||.|||.  . .. ||| ||||| |  |   |  . | .   .|.|
Sbjct: 230 LRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLP 288

>hg18||uc001hmn
        |1|BC114478|Q9P0L2|MARK1_HUMAN|MARK1|NM_018650|NP_061120|MAP/microtubul
        e affinity-regulating kinase 1

          Length = 795

 Score =  232 bits (590), Expect = 2e-060
 Identities = 113/230 (49%), Positives = 159/230 (69%)

Query: 130 ILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLV 189
           |. . .   | | .. ||. |.|.. ||...|| .| | .| ||||.|. ||||.|||||
Sbjct:  90 IIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLV 149

Query: 190 KKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVG 249
             ||.  ||||  ||||.||. .||   | ||||| ||||||   ||.||||| ..    
Sbjct: 150 AHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTV 209

Query: 250 DSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKV 309
            . |.| |||| || ||. .|.|||| . |||| ||||. |. |.||||  ||. | |.|
Sbjct: 210 GNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV 269

Query: 310 KLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPE 359
             | . .| ..  ||.|||. .. ..  || .|||| |  |   |  | |
Sbjct: 270 LRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEE 319

>hg18||uc001lth |11|AF533878|Q8IWQ3-2|Q8IWQ3-2|BRSK2|NA|NA|BR
        serine/threonine-protein kinase 2 (EC 2.7.11.1) (Serine/threonine-
        protein kinase 29) (Serine/threonine kinase SAD-A)

          Length = 674

 Score =  229 bits (583), Expect = 1e-059
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 2/146 (1%)

Query: 683 SSFTDHPPKSIPLIQVTPHPSPRGSPLPTPKGTPVHTPKDSPAGXXXXXXXXXXXIGGMP 742
           ||     | | |  .||||||||||||||||||||||||.||||           .||.|
Sbjct: 417 SSGLSTSPLSSP--RVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVP 474

Query: 743 WRTRLNSIKNSFLGSPRFHRRKLQVPTQEEMSSLTPESSPELAKKSWFGNFINLEKEEQI 802
           || |||||||||||||||||||||||| ||||.|||||||||||||||||||.|||||||
Sbjct: 475 WRARLNSIKNSFLGSPRFHRRKLQVPTPEEMSNLTPESSPELAKKSWFGNFISLEKEEQI 534

Query: 803 FIVIKDKPLSSIKADIVHAFLSVGTL 828
           |.||||||||||||||||||||. .|
Sbjct: 535 FVVIKDKPLSSIKADIVHAFLSIPSL 560

>hg18||uc001lti |11|AF533879|Q8IWQ3|BRSK2_HUMAN|BRSK2|NM_003957|NP_003948|BR
        serine/threonine kinase 2

          Length = 736

 Score =  229 bits (583), Expect = 1e-059
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 2/146 (1%)

Query: 683 SSFTDHPPKSIPLIQVTPHPSPRGSPLPTPKGTPVHTPKDSPAGXXXXXXXXXXXIGGMP 742
           ||     | | |  .||||||||||||||||||||||||.||||           .||.|
Sbjct: 417 SSGLSTSPLSSP--RVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVP 474

Query: 743 WRTRLNSIKNSFLGSPRFHRRKLQVPTQEEMSSLTPESSPELAKKSWFGNFINLEKEEQI 802
           || |||||||||||||||||||||||| ||||.|||||||||||||||||||.|||||||
Sbjct: 475 WRARLNSIKNSFLGSPRFHRRKLQVPTPEEMSNLTPESSPELAKKSWFGNFISLEKEEQI 534

Query: 803 FIVIKDKPLSSIKADIVHAFLSVGTL 828
           |.||||||||||||||||||||. .|
Sbjct: 535 FVVIKDKPLSSIKADIVHAFLSIPSL 560

>hg18||uc001ltj |11|NM_003957|Q8IWQ3-3|Q8IWQ3-3|BRSK2|NM_003957|NP_003948|BR
        serine/threonine kinase 2

          Length = 668

 Score =  229 bits (583), Expect = 1e-059
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 2/146 (1%)

Query: 683 SSFTDHPPKSIPLIQVTPHPSPRGSPLPTPKGTPVHTPKDSPAGXXXXXXXXXXXIGGMP 742
           ||     | | |  .||||||||||||||||||||||||.||||           .||.|
Sbjct: 417 SSGLSTSPLSSP--RVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVP 474

Query: 743 WRTRLNSIKNSFLGSPRFHRRKLQVPTQEEMSSLTPESSPELAKKSWFGNFINLEKEEQI 802
           || |||||||||||||||||||||||| ||||.|||||||||||||||||||.|||||||
Sbjct: 475 WRARLNSIKNSFLGSPRFHRRKLQVPTPEEMSNLTPESSPELAKKSWFGNFISLEKEEQI 534

Query: 803 FIVIKDKPLSSIKADIVHAFLSVGTL 828
           |.||||||||||||||||||||. .|
Sbjct: 535 FVVIKDKPLSSIKADIVHAFLSIPSL 560

>hg18||uc001ltl |11|AF533877|Q8IWQ3-2|Q8IWQ3-2|BRSK2|NM_003957|NP_003948|BR
        serine/threonine kinase 2

          Length = 674

 Score =  229 bits (583), Expect = 1e-059
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 2/146 (1%)

Query: 683 SSFTDHPPKSIPLIQVTPHPSPRGSPLPTPKGTPVHTPKDSPAGXXXXXXXXXXXIGGMP 742
           ||     | | |  .||||||||||||||||||||||||.||||           .||.|
Sbjct: 417 SSGLSTSPLSSP--RVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVP 474

Query: 743 WRTRLNSIKNSFLGSPRFHRRKLQVPTQEEMSSLTPESSPELAKKSWFGNFINLEKEEQI 802
           || |||||||||||||||||||||||| ||||.|||||||||||||||||||.|||||||
Sbjct: 475 WRARLNSIKNSFLGSPRFHRRKLQVPTPEEMSNLTPESSPELAKKSWFGNFISLEKEEQI 534

Query: 803 FIVIKDKPLSSIKADIVHAFLSVGTL 828
           |.||||||||||||||||||||. .|
Sbjct: 535 FVVIKDKPLSSIKADIVHAFLSIPSL 560

>hg18||uc001ltm |11|AK131534|Q8IWQ3-5|Q8IWQ3-5|BRSK2|NA|NA|BR
        serine/threonine-protein kinase 2 (EC 2.7.11.1) (Serine/threonine-
        protein kinase 29) (Serine/threonine kinase SAD-A)

          Length = 766

 Score =  229 bits (583), Expect = 1e-059
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 2/146 (1%)

Query: 683 SSFTDHPPKSIPLIQVTPHPSPRGSPLPTPKGTPVHTPKDSPAGXXXXXXXXXXXIGGMP 742
           ||     | | |  .||||||||||||||||||||||||.||||           .||.|
Sbjct: 463 SSGLSTSPLSSP--RVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVP 520

Query: 743 WRTRLNSIKNSFLGSPRFHRRKLQVPTQEEMSSLTPESSPELAKKSWFGNFINLEKEEQI 802
           || |||||||||||||||||||||||| ||||.|||||||||||||||||||.|||||||
Sbjct: 521 WRARLNSIKNSFLGSPRFHRRKLQVPTPEEMSNLTPESSPELAKKSWFGNFISLEKEEQI 580

Query: 803 FIVIKDKPLSSIKADIVHAFLSVGTL 828
           |.||||||||||||||||||||. .|
Sbjct: 581 FVVIKDKPLSSIKADIVHAFLSIPSL 606

>hg18||uc002pba
        |19|NM_031417|Q96L34-2|Q96L34-2|MARK4|NM_031417|NP_113605|MAP/microtubu
        le affinity-regulating kinase 4

          Length = 688

 Score =  229 bits (583), Expect = 1e-059
 Identities = 114/241 (47%), Positives = 166/241 (68%), Gaps = 6/241 (2%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |. . .   . | .. ||. |.| . ||...|| .| | .| ||||.|. | ||.|||
Sbjct:  87 IKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVKLFEVIETEKTLYLVMEYASAGEVFDY 146

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           ||  ||.  ||||  ||||.||. .||  .| ||||| |||||| . ||.||||| ..  
Sbjct: 147 LVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDAEANIKIADFGFSNEF 206

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
              | |.| |||| || ||. .|.|||| . |.|| ||||. |. |.||||  ||. | |
Sbjct: 207 TLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGHNLKELRE 266

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTW----YIGGKNEP--EPE 361
           .|  | . .| ..  ||...||  . .. .|| ||||| |  |    | | . .|  |||
Sbjct: 267 RVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCTLEQIMKDKWINIGYEGEELKPYTEPE 326

Query: 362 Q 362
           .
Sbjct: 327 E 327

>hg18||uc002pbb |19|AY120867|Q96L34|MARK4_HUMAN|MARK4|NA|NA|MAP/microtubule
        affinity-regulating kinase 4 (EC 2.7.11.1) (MAP/microtubule
        affinity-regulating kinase-like 1)

          Length = 752

 Score =  229 bits (583), Expect = 1e-059
 Identities = 114/241 (47%), Positives = 166/241 (68%), Gaps = 6/241 (2%)

Query: 128 LPILHRLRFTITPLPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDY 187
           . |. . .   . | .. ||. |.| . ||...|| .| | .| ||||.|. | ||.|||
Sbjct:  87 IKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVKLFEVIETEKTLYLVMEYASAGEVFDY 146

Query: 188 LVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQ 247
           ||  ||.  ||||  ||||.||. .||  .| ||||| |||||| . ||.||||| ..  
Sbjct: 147 LVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDAEANIKIADFGFSNEF 206

Query: 248 VGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLE 307
              | |.| |||| || ||. .|.|||| . |.|| ||||. |. |.||||  ||. | |
Sbjct: 207 TLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGHNLKELRE 266

Query: 308 KVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTW----YIGGKNEP--EPE 361
           .|  | . .| ..  ||...||  . .. .|| ||||| |  |    | | . .|  |||
Sbjct: 267 RVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCTLEQIMKDKWINIGYEGEELKPYTEPE 326

Query: 362 Q 362
           .
Sbjct: 327 E 327

>hg18||uc001tlj
        |12|NM_014840|O60285|NUAK1_HUMAN|NUAK1|NM_014840|NP_055655|AMPK-related
        protein kinase 5

          Length = 661

 Score =  203 bits (515), Expect = 1e-051
 Identities = 89/207 (42%), Positives = 141/207 (68%), Gaps = 1/207 (0%)

Query: 144 VEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFF 203
           . ||| |.  . |||.. ...|.|||  . ...|. | |||.||. .. ||. .| | ||
Sbjct: 100 IRREIEIMSSLNHPHIISIYEVFENKDKIVIIMEYASKGELYDYISERRRLSERETRHFF 159

Query: 204 RQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCGSPHYA 263
           |||.||. .|| . . ||||| ||.|||.  ||.|||||...|   |  |.| |||| ||
Sbjct: 160 RQIVSAVHYCHKNGVVHRDLKLENILLDDNCNIKIADFGLSNLYQKDKFLQTFCGSPLYA 219

Query: 264 CPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKVKLGVFHMPHFIPPD 323
            ||.. |  | | . | |. ||.|. |. | .|||  . .||. ..  | .  |   | |
Sbjct: 220 SPEIVNGRPYRGPEVDSWALGVLLYTLVYGTMPFDGFDHKNLIRQISSGEYREP-TQPSD 278

Query: 324 CQNLLRGMIEVDASKRLTLEQIQKHTW 350
            . |.| |. |.  .| |.| |  | |
Sbjct: 279 ARGLIRWMLMVNPDRRATIEDIANHWW 305

>hg18||uc003zzn |9|NM_014791|Q14680|MELK_HUMAN|MELK|NM_014791|NP_055606|maternal
        embryonic leucine zipper kinase

          Length = 651

 Score =  202 bits (512), Expect = 2e-051
 Identities = 95/220 (43%), Positives = 145/220 (65%), Gaps = 2/220 (0%)

Query: 141 LPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEAR 200
           ||... ||  || . | |. .|. | |    ...|||.  |||||||.. . ||. .| |
Sbjct:  51 LPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETR 110

Query: 201 KFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVG--DSLLETSCG 258
             ||||.||. . ||    |||||||||| || . ... |||. .   |  |  |.| ||
Sbjct: 111 VVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCG 170

Query: 259 SPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKVKLGVFHMPH 318
           |  || ||.|.|. | | .||||| |..|. |. | |||||||.  | .|.  | . .| 
Sbjct: 171 SLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPK 230

Query: 319 FIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEP 358
           .. |    ||. |..||  ||.... .  | | .   | |
Sbjct: 231 WLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYP 270

>hg18||uc001hce |1|NM_030952|Q9H093|NUAK2_HUMAN|NUAK2|NM_030952|NP_112214|NUAK
        family, SNF1-like kinase, 2

          Length = 628

 Score =  199 bits (504), Expect = 2e-050
 Identities = 92/227 (40%), Positives = 146/227 (64%), Gaps = 1/227 (0%)

Query: 141 LPQVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEAR 200
           |  . ||| |.  . |||.. .|.|.||   . .|.|. | |.|.||. .. .|. .|||
Sbjct:  94 LMHIRREIEIMSSLNHPHIIAIHEVFENSSKIVIVMEYASRGDLYDYISERQQLSEREAR 153

Query: 201 KFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCGSP 260
            |||||.||. .|| . . ||||| ||.|||   ||.|||||...|      |.| ||||
Sbjct: 154 HFFRQIVSAVHYCHQNRVVHRDLKLENILLDANGNIKIADFGLSNLYHQGKFLQTFCGSP 213

Query: 261 HYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKVKLGVFHMPHFI 320
            || ||.. |. | | . | || ||.|. |. | .|||  . . |....  | .  |   
Sbjct: 214 LYASPEIVNGKPYTGPEVDSWSLGVLLYILVHGTMPFDGHDHKILVKQISNGAYREPP-K 272

Query: 321 PPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVPRK 367
           | |   |.| .. |. ..| ||| .  | |   |      ||  | .
Sbjct: 273 PSDACGLIRWLLMVNPTRRATLEDVASHWWVNWGYATRVGEQEAPHE 319

>hg18||uc002pbc |19|AK074578|Q8N2N5|Q8N2N5_HUMAN|MARKL1|NA|NA|CDNA FLJ90097 fis,
        clone HEMBA1005929, weakly similar to H.sapiens serine/threonine
        protein kinase EMK

          Length = 426

 Score =  195 bits (494), Expect = 3e-049
 Identities = 97/193 (50%), Positives = 134/193 (69%), Gaps = 6/193 (3%)

Query: 176 LEHVSGGELFDYLVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNN 235
           .|. | ||.|||||  ||.  ||||  ||||.||. .||  .| ||||| |||||| . |
Sbjct:   1 MEYASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDAEAN 60

Query: 236 IRIADFGMASLQVGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGAL 295
           |.||||| ..     | |.| |||| || ||. .|.|||| . |.|| ||||. |. |.|
Sbjct:  61 IKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSL 120

Query: 296 PFDDDNLRNLLEKVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTW----Y 351
           |||  ||. | |.|  | . .| ..  ||...||  . .. .|| ||||| |  |    |
Sbjct: 121 PFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCTLEQIMKDKWINIGY 180

Query: 352 IGGKNEP--EPEQ 362
            | . .|  |||.
Sbjct: 181 EGEELKPYTEPEE 193

>hg18||uc001hmo
        |1|AK027493|Q9P0L2-2|Q9P0L2-2|MARK1|NM_018650|NP_061120|MAP/microtubule
        affinity-regulating kinase 1

          Length = 645

 Score =  194 bits (492), Expect = 5e-049
 Identities = 95/184 (51%), Positives = 127/184 (69%)

Query: 176 LEHVSGGELFDYLVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNN 235
           .|. ||||.|||||  ||.  ||||  ||||.||. .||   | ||||| ||||||   |
Sbjct:   1 MEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMN 60

Query: 236 IRIADFGMASLQVGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGAL 295
           |.||||| ..     . |.| |||| || ||. .|.|||| . |||| ||||. |. |.|
Sbjct:  61 IKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSL 120

Query: 296 PFDDDNLRNLLEKVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGK 355
           |||  ||. | |.|  | . .| ..  ||.|||. .. ..  || .|||| |  |   | 
Sbjct: 121 PFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGH 180

Query: 356 NEPE 359
            | |
Sbjct: 181 EEEE 184

>hg18||uc001hmm
        |1|NM_018650|Q9P0L2-3|Q9P0L2-3|MARK1|NM_018650|NP_061120|MAP/microtubul
        e affinity-regulating kinase 1

          Length = 758

 Score =  191 bits (483), Expect = 5e-048
 Identities = 94/185 (50%), Positives = 126/185 (68%)

Query: 175 VLEHVSGGELFDYLVKKGRLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKN 234
           .| | . ||.|||||  ||.  ||||  ||||.||. .||   | ||||| ||||||   
Sbjct: 113 ILNHPNIGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDM 172

Query: 235 NIRIADFGMASLQVGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGA 294
           ||.||||| ..     . |.| |||| || ||. .|.|||| . |||| ||||. |. |.
Sbjct: 173 NIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGS 232

Query: 295 LPFDDDNLRNLLEKVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGG 354
           ||||  ||. | |.|  | . .| ..  ||.|||. .. ..  || .|||| |  |   |
Sbjct: 233 LPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVG 292

Query: 355 KNEPE 359
             | |
Sbjct: 293 HEEEE 297

>hg18||uc001ppz |11|BC128511|A1A5A9|A1A5A9_HUMAN|KIAA0999|NA|NA|KIAA0999
        protein

          Length = 1102

 Score =  190 bits (480), Expect = 1e-047
 Identities = 99/241 (41%), Positives = 144/241 (59%), Gaps = 2/241 (0%)

Query: 194 LTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLL 253
           .  ||||. |.||..|. |||  .| ||||| ||||||   ||.||||| ..|     ||
Sbjct:   1 MAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDANLNIKIADFGFSNLFTPGQLL 60

Query: 254 ETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKVKLGV 313
           .| |||| || ||.  |..||| | |.|| ||.|. |. ||||||   |.||  .|  | 
Sbjct:  61 KTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTLQNLRARVLSGK 120

Query: 314 FHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVPRKVTIRSL 373
           | .| |.  .|..|.| |. .| .|||..||| || |   |  .|  .. .     ..  
Sbjct: 121 FRIPFFMSTECEHLIRHMLVLDPNKRLSMEQICKHKWMKLGDADPNFDRLIAECQQLKEE 180

Query: 374 PSADDIDPDVLDSMHSLGCFRXXXXXXXXXXXXXXXQEKMIYFLLLDRKERYPSQEDQNL 433
              | .. ||| .|  .|  .                   || || || .|. .     |
Sbjct: 181 RQVDPLNEDVLLAMEDMGLDK--EQTLQSLRSDAYDHYSAIYSLLCDRHKRHKTLRLGAL 238

Query: 434 P 434
           |
Sbjct: 239 P 239

>hg18||uc002qkf |19|AF479826|Q8TDC3|BRSK1_HUMAN|BRSK1|NM_032430|NP_115806|BR
        serine/threonine kinase 1

          Length = 794

 Score =  184 bits (466), Expect = 5e-046
 Identities = 95/147 (64%), Positives = 111/147 (75%), Gaps = 7/147 (4%)

Query: 687 DHPPKSIPLIQVTPHPSPRGSPLP---TPKGTPVHTPKDSPAGXXXXX--XXXXXXIGGM 741
           . ||   |  . || | | |||     ||  .|.|||. || |             .|| 
Sbjct: 506 EQPPP--PSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGA 563

Query: 742 PWRTRLNSIKNSFLGSPRFHRRKLQVPTQEEMSSLTPESSPELAKKSWFGNFINLEKEEQ 801
            ||.|||||.|||||||||||||.|||| ||||||||||||||||.|||||||.|.||||
Sbjct: 564 AWRSRLNSIRNSFLGSPRFHRRKMQVPTAEEMSSLTPESSPELAKRSWFGNFISLDKEEQ 623

Query: 802 IFIVIKDKPLSSIKADIVHAFLSVGTL 828
           ||.|.||||||||||||||||||. .|
Sbjct: 624 IFLVLKDKPLSSIKADIVHAFLSIPSL 650

>hg18||uc002qkg |19|NM_032430|Q8TDC3-2|Q8TDC3-2|BRSK1|NM_032430|NP_115806|BR
        serine/threonine kinase 1

          Length = 778

 Score =  184 bits (466), Expect = 5e-046
 Identities = 95/147 (64%), Positives = 111/147 (75%), Gaps = 7/147 (4%)

Query: 687 DHPPKSIPLIQVTPHPSPRGSPLP---TPKGTPVHTPKDSPAGXXXXX--XXXXXXIGGM 741
           . ||   |  . || | | |||     ||  .|.|||. || |             .|| 
Sbjct: 490 EQPPP--PSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGA 547

Query: 742 PWRTRLNSIKNSFLGSPRFHRRKLQVPTQEEMSSLTPESSPELAKKSWFGNFINLEKEEQ 801
            ||.|||||.|||||||||||||.|||| ||||||||||||||||.|||||||.|.||||
Sbjct: 548 AWRSRLNSIRNSFLGSPRFHRRKMQVPTAEEMSSLTPESSPELAKRSWFGNFISLDKEEQ 607

Query: 802 IFIVIKDKPLSSIKADIVHAFLSVGTL 828
           ||.|.||||||||||||||||||. .|
Sbjct: 608 IFLVLKDKPLSSIKADIVHAFLSIPSL 634

>hg18||uc002qkh |19|AK124999|NA|NA|BRSK1|NM_032430|NP_115806|BR serine/threonine
        kinase 1

          Length = 473

 Score =  184 bits (466), Expect = 5e-046
 Identities = 95/147 (64%), Positives = 111/147 (75%), Gaps = 7/147 (4%)

Query: 687 DHPPKSIPLIQVTPHPSPRGSPLP---TPKGTPVHTPKDSPAGXXXXX--XXXXXXIGGM 741
           . ||   |  . || | | |||     ||  .|.|||. || |             .|| 
Sbjct: 185 EQPPP--PSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGA 242

Query: 742 PWRTRLNSIKNSFLGSPRFHRRKLQVPTQEEMSSLTPESSPELAKKSWFGNFINLEKEEQ 801
            ||.|||||.|||||||||||||.|||| ||||||||||||||||.|||||||.|.||||
Sbjct: 243 AWRSRLNSIRNSFLGSPRFHRRKMQVPTAEEMSSLTPESSPELAKRSWFGNFISLDKEEQ 302

Query: 802 IFIVIKDKPLSSIKADIVHAFLSVGTL 828
           ||.|.||||||||||||||||||. .|
Sbjct: 303 IFLVLKDKPLSSIKADIVHAFLSIPSL 329

>hg18||uc003jmb
        |5|NM_206907|Q86VS1|Q86VS1_HUMAN|PRKAA1|NM_206907|NP_996790|protein
        kinase, AMP-activated, alpha 1 catalytic

          Length = 574

 Score =  180 bits (455), Expect = 1e-044
 Identities = 82/167 (49%), Positives = 117/167 (70%), Gaps = 3/167 (1%)

Query: 188 LVKKG---RLTPKEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMA 244
           .|| |    |  ||.|. |.||.| .|.|| | . ||||||||.|||   | .|||||..
Sbjct: 128 VVKTGSTKELDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLS 187

Query: 245 SLQVGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRN 304
           ..      | ||||||.|| |||| |  | | . |.|| ||||.||| | ||||||..  
Sbjct: 188 NMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPT 247

Query: 305 LLEKVKLGVFHMPHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWY 351
           | .|.  |.|. | .. |   .||. |..||  || |.. |..| |.
Sbjct: 248 LFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWF 294

>hg18||uc002qkh |19|AK124999|NA|NA|BRSK1|NM_032430|NP_115806|BR serine/threonine
        kinase 1

          Length = 473

 Score =  175 bits (443), Expect = 2e-043
 Identities = 99/190 (52%), Positives = 113/190 (59%), Gaps = 24/190 (12%)

Query: 370 IRSLPSADDIDPDVLDSMHSLGCFRXXXXXXXXXXXXXXXQEKMIYFLLLDRKERYPSQE 429
           .|||||  ..|||||.|| ||||||               ||||||.||||||||||| |
Sbjct:   1 MRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKERYPSCE 60

Query: 430 DQNLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTD---GGSPVPARRAIDMTQ 486
           ||.|||||..||||||||||||.||||||||||||||||.||   |||||| |||..| |
Sbjct:  61 DQDLPPRNDVDPPRKRVDSPMLSRHGKRRPERKSMEVLSITDAGGGGSPVPTRRALEMAQ 120

Query: 487 HXXXXXXXXXXXXXXXXXXXXXXXXVRKFCVPPLSPDLSQSPNT----------SPCPSP 536
           |                               | ||  | ||            ||    
Sbjct: 121 HSQRSRSVSGASTGLSSSPLSS----------PRSPVFSFSPEPGAGDEARGGGSPTSKT 170

Query: 537 EPIPSRSGPR 546
           . .||| |||
Sbjct: 171 QTLPSR-GPR 179

>hg18||uc001iln
        |10|NM_020397|Q8IU85-2|Q8IU85-2|CAMK1D|NM_020397|NP_065130|calcium/calm
        odulin-dependent protein kinase ID

          Length = 357

 Score =  172 bits (435), Expect = 2e-042
 Identities = 89/217 (41%), Positives = 135/217 (62%), Gaps = 8/217 (3%)

Query: 144 VEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFF 203
           .| |||.|. |.| ... | |.||.  .||||.. |||||||| .|.||  | |.|    
Sbjct:  66 IENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLI 125

Query: 204 RQIMSALDFCHSHSICHRDLKPENLLL---DEKNNIRIADFGMASLQVGDSLLETSCGSP 260
           ||.. |. . |   | ||||||||||    ||.. | |.|||.. ..    .. |.||.|
Sbjct: 126 RQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTP 185

Query: 261 HYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKVKLG--VFHMPH 318
            |  |||.  . |  .  | || ||| . || |  || |.|   | |..      |  |.
Sbjct: 186 GYVAPEVLAQKPY-SKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPY 244

Query: 319 F--IPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIG 353
           .  |    .. .| ..| | .|| | ||  .| |  |
Sbjct: 245 WDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAG 281

>hg18||uc001ilo
        |10|NM_153498|Q8IU85|KCC1D_HUMAN|CAMK1D|NM_153498|NP_705718|calcium/cal
        modulin-dependent protein kinase ID

          Length = 385

 Score =  172 bits (435), Expect = 2e-042
 Identities = 89/217 (41%), Positives = 135/217 (62%), Gaps = 8/217 (3%)

Query: 144 VEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFF 203
           .| |||.|. |.| ... | |.||.  .||||.. |||||||| .|.||  | |.|    
Sbjct:  66 IENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLI 125

Query: 204 RQIMSALDFCHSHSICHRDLKPENLLL---DEKNNIRIADFGMASLQVGDSLLETSCGSP 260
           ||.. |. . |   | ||||||||||    ||.. | |.|||.. ..    .. |.||.|
Sbjct: 126 RQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTP 185

Query: 261 HYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKVKLG--VFHMPH 318
            |  |||.  . |  .  | || ||| . || |  || |.|   | |..      |  |.
Sbjct: 186 GYVAPEVLAQKPY-SKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPY 244

Query: 319 F--IPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIG 353
           .  |    .. .| ..| | .|| | ||  .| |  |
Sbjct: 245 WDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAG 281

>hg18||uc001ymz
        |14|AF465413|P27448-5|P27448-5|MARK3|NM_002376|NP_002367|MAP/microtubul
        e affinity-regulating kinase 3

          Length = 604

 Score =  171 bits (432), Expect = 4e-042
 Identities = 84/163 (51%), Positives = 109/163 (66%)

Query: 197 KEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETS 256
           ||||  ||||.||. .||   | ||||| ||||||   ||.||||| ..       |.| 
Sbjct:   4 KEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLDTF 63

Query: 257 CGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKVKLGVFHM 316
           |||| || ||. .|.|||| . |||| ||||. |. |.||||  ||. | |.|  | . .
Sbjct:  64 CGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRI 123

Query: 317 PHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPE 359
           | ..  ||.|||.  . ..  || ||||| |  |   |  | |
Sbjct: 124 PFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDE 166

>hg18||uc001yna
        |14|M80359|P27448-6|P27448-6|MARK3|NM_002376|NP_002367|MAP/microtubule
        affinity-regulating kinase 3

          Length = 564

 Score =  171 bits (432), Expect = 4e-042
 Identities = 84/163 (51%), Positives = 109/163 (66%)

Query: 197 KEARKFFRQIMSALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETS 256
           ||||  ||||.||. .||   | ||||| ||||||   ||.||||| ..       |.| 
Sbjct:   4 KEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLDTF 63

Query: 257 CGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKVKLGVFHM 316
           |||| || ||. .|.|||| . |||| ||||. |. |.||||  ||. | |.|  | . .
Sbjct:  64 CGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRI 123

Query: 317 PHFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPE 359
           | ..  ||.|||.  . ..  || ||||| |  |   |  | |
Sbjct: 124 PFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDE 166

>hg18||uc003bst
        |3|NM_003656|Q14012|KCC1A_HUMAN|CAMK1|NM_003656|NP_003647|calcium/calmo
        dulin-dependent protein kinase I

          Length = 370

 Score =  171 bits (432), Expect = 4e-042
 Identities = 90/217 (41%), Positives = 135/217 (62%), Gaps = 8/217 (3%)

Query: 144 VEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFF 203
           .| |||.|  |.||... | |.||.  .|||... |||||||| .|.||  | ..| .  
Sbjct:  63 MENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLI 122

Query: 204 RQIMSALDFCHSHSICHRDLKPENLL---LDEKNNIRIADFGMASLQVGDSLLETSCGSP 260
            |.. |. . |   | ||||||||||   ||| . | |.|||.. ..   |.| |.||.|
Sbjct: 123 FQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTP 182

Query: 261 HYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKVKLG--VFHMPH 318
            |  |||.  . |  .  | || ||| . || |  || |.|   | |..      |  |.
Sbjct: 183 GYVAPEVLAQKPY-SKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPY 241

Query: 319 F--IPPDCQNLLRGMIEVDASKRLTLEQIQKHTWYIG 353
           .  |    .. .| ..| |  || | ||  .| |  |
Sbjct: 242 WDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAG 278

>hg18||uc003cmt |3|CR749621|Q9NRH2|SNRK_HUMAN|SNRK|NM_017719|NP_060189|SNF
        related kinase

          Length = 765

 Score =  169 bits (428), Expect = 1e-041
 Identities = 80/222 (36%), Positives = 136/222 (61%), Gaps = 2/222 (0%)

Query: 146 REIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVK-KGRLTPKEARKFFR 204
           .|.  .||..||....|..| . .  |||.||   ||..|||..| .  |    |.|.| 
Sbjct:  62 QEVRCMKLVQHPNIVRLYEVIDTQTKLYLILELGDGGDMFDYIMKHEEGLNEDLAKKYFA 121

Query: 205 QIMSALDFCHSHSICHRDLKPENLLLDEKNN-IRIADFGMASLQVGDSLLETSCGSPHYA 263
           ||. |. .||   . ||||||||..  ||   ... ||| ..       | |||||  |.
Sbjct: 122 QIVHAISYCHKLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNKFQPGKKLTTSCGSLAYS 181

Query: 264 CPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKVKLGVFHMPHFIPPD 323
            ||.. |..||    |.|| ||||| |. |  || . |    |  .    . .|  .  .
Sbjct: 182 APEILLGDEYDAPAVDIWSLGVILFMLVCGQPPFQEANDSETLTMIMDCKYTVPSHVSKE 241

Query: 324 CQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVP 365
           |..|.  |.. |  .| .||.|. | |  |    |  .  .|
Sbjct: 242 CKDLITRMLQRDPKRRASLEEIENHPWLQGVDPSPATKYNIP 283

>hg18||uc003cms |3|NM_017719|Q9NRH2|SNRK_HUMAN|SNRK|NM_017719|NP_060189|SNF
        related kinase

          Length = 765

 Score =  164 bits (415), Expect = 4e-040
 Identities = 78/222 (35%), Positives = 134/222 (60%), Gaps = 2/222 (0%)

Query: 146 REIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVK-KGRLTPKEARKFFR 204
           .|.  .||..||....|..| . .  |||.||    |..|||..| .  |     .|.| 
Sbjct:  62 QEVRCMKLVQHPNIVRLYEVIDTQTKLYLILELGDEGDMFDYIMKHEEGLNEDLPKKYFA 121

Query: 205 QIMSALDFCHSHSICHRDLKPENLLLDEKNN-IRIADFGMASLQVGDSLLETSCGSPHYA 263
           ||. |. .||   . ||||||||..  ||   ... ||| ..       | |||||  |.
Sbjct: 122 QIVHAISYCHKLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNKFQPGKKLTTSCGSLAYS 181

Query: 264 CPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKVKLGVFHMPHFIPPD 323
            ||.. |..||    |.|| ||||| |. |  || . |    |  .    . .|  .  .
Sbjct: 182 APEILLGDEYDAPAVDIWSLGVILFMLVCGQPPFQEANDSETLTMIMDCKYTVPSHVSKE 241

Query: 324 CQNLLRGMIEVDASKRLTLEQIQKHTWYIGGKNEPEPEQPVP 365
           |..|.  |.. |  .| .||.|. | |  |    |  .  .|
Sbjct: 242 CKDLITRMLQRDPKRRASLEEIENHPWLQGVDPSPATKYNIP 283

>hg18||uc001jvm
        |10|NM_172171|Q13555|KCC2G_HUMAN|CAMK2G|NM_172171|NP_751911|calcium/cal
        modulin-dependent protein kinase II

          Length = 556

 Score =  161 bits (405), Expect = 6e-039
 Identities = 82/216 (37%), Positives = 132/216 (61%), Gaps = 9/216 (4%)

Query: 143 QVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKF 202
           ..|||  | .|..||....|||    . . ||| . |.|||||. .| .   .  .|   
Sbjct:  57 KLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHC 116

Query: 203 FRQIMSALDFCHSHSICHRDLKPENLLLDEKNN---IRIADFGMA-SLQVGDSLLETSCG 258
             ||. ...  | | | |||||||||||  |     ...||||.|  .|          |
Sbjct: 117 IHQILESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAG 176

Query: 259 SPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRNLLEKVKLGVFHMP- 317
           .| |  |||.| . | |.  |.|.|||||. ||||  || |..   | ...| | .  | 
Sbjct: 177 TPGYLSPEVLRKDPY-GKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPS 235

Query: 318 ---HFIPPDCQNLLRGMIEVDASKRLTLEQIQKHTW 350
                . |. .||.  |. .. .||.| .|  || |
Sbjct: 236 PEWDTVTPEAKNLINQMLTINPAKRITADQALKHPW 271

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0