BLASTP 7.6.0


Query=fugu4_571936 |jgi|Takru4|571936|e_gw2.196.60.1
        (512 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001cqm |1|NM_000779|Q5SXC1|Q5SXC1_HUMAN|CYP4B1|NM_000779...    520   2e-147
hg18||uc001cqn |1|AY151048|Q8WWF2|Q8WWF2_HUMAN|CYP4B1|NM_000779|...    518   1e-146
hg18||uc001cqp |1|NM_000778|Q5VSP8|Q5VSP8_HUMAN|CYP4A11|NM_00077...    497   1e-140
hg18||uc001cqv |1|NM_001010969|Q5TCH4|Q5TCH4_HUMAN|CYP4A22|NM_00...    473   4e-133
hg18||uc001cqt |1|NM_178033|Q8N118|CP4X1_HUMAN|CYP4X1|NM_178033|...    456   5e-128
hg18||uc001cqu |1|NM_178134|Q86W10|CP4Z1_HUMAN|CYP4Z1|NM_178134|...    442   6e-124
hg18||uc002nbs |19|NM_001082|P78329|CP4F2_HUMAN|CYP4F2|NM_001082...    441   1e-123
hg18||uc001cqq |1|BC041158|Q86SU6|Q86SU6_HUMAN|CYP4A11|NM_000778...    433   3e-121
hg18||uc002nbk |19|AF054821|Q08477|CP4F3_HUMAN|CYP4F3|NM_000896|...    433   3e-121
hg18||uc002nbh |19|NM_173483|Q6NT55|Q6NT55_HUMAN|FLJ39501|NM_173...    432   8e-121
hg18||uc002nbj |19|NM_000896|Q08477|CP4F3_HUMAN|CYP4F3|NM_000896...    428   8e-120
hg18||uc002nbt |19|NM_021187|Q9HBI6|CP4FB_HUMAN|CYP4F11|NM_02118...    427   2e-119
hg18||uc002nbu |19|BC016853|Q9HBI6|CP4FB_HUMAN|CYP4F11|NM_021187...    426   3e-119
hg18||uc001cqr |1|AK131355|Q6ZN67|Q6ZN67_HUMAN|CYP4X1|NA|NA|CDNA...    422   8e-118
hg18||uc002nbi |19|NM_007253|NA|NA|CYP4F8|NM_007253|NP_009184|cy...    419   4e-117
hg18||uc001cqs |1|AX747195|Q8NAZ3|Q8NAZ3_HUMAN|CYP4X1|NM_178033|...    419   5e-117
hg18||uc002nbl |19|NM_023944|Q8IV39|Q8IV39_HUMAN|CYP4F12|NM_0239...    415   1e-115
hg18||uc003iyw |4|NM_207352|Q6ZWL3|CP4V2_HUMAN|CYP4V2|NM_207352|...    250   4e-066
hg18||uc003urw |7|J04449|Q6GRK0|Q6GRK0_HUMAN|CYP3A4|NM_017460|NP...    143   9e-034
hg18||uc003urv |7|NM_017460|P08684|CP3A4_HUMAN|CYP3A4|NM_017460|...    118   2e-026
hg18||uc003uru |7|NM_000765|P24462|CP3A7_HUMAN|CYP3A7|NM_000765|...    117   4e-026
hg18||uc003urp |7|CR620792|NA|NA|CYP3A5|NM_000777|NP_000768|cyto...    114   3e-025
hg18||uc003urq |7|NM_000777|P20815|CP3A5_HUMAN|CYP3A5|NM_000777|...    114   3e-025
hg18||uc003urr |7|BC025176|NA|NA|CYP3A43|NA|NA|Homo sapiens CYP3...    114   3e-025
hg18||uc003urx |7|NM_057095|Q9HB55|CP343_HUMAN|CYP3A43|NM_057095...    111   2e-024
hg18||uc001ygo |14|NM_006668|Q9Y6A2|CP46A_HUMAN|CYP46A1|NM_00666...    110   7e-024
hg18||uc003ury |7|NM_022820|Q9HB55-2|Q9HB55-2|CYP3A43|NM_022820|...    107   4e-023
hg18||uc003vvh |7|AK223466|Q53F23|Q53F23_HUMAN|TBXAS1|NM_001061|...     94   5e-019
hg18||uc003vvi |7|NM_001061|Q53F23|Q53F23_HUMAN|TBXAS1|NM_001061...     94   5e-019
hg18||uc001mlo |11|CR600246|NA|NA|CYP2R1|NA|NA|Homo sapiens cDNA...     93   6e-019
hg18||uc001mlp |11|BC052580|Q2M3H3|Q2M3H3_HUMAN|CYP2R1|NM_024514...     93   6e-019
hg18||uc001mlr |11|NM_024514|Q6VVX0|CP2R1_HUMAN|CYP2R1|NM_024514...     93   6e-019
hg18||uc002xwu |20|AY858838|Q5I2W7|Q5I2W7_HUMAN|CYP24A1|NM_00078...     89   1e-017
hg18||uc002xwv |20|NM_000782|Q07973|CP24A_HUMAN|CYP24A1|NM_00078...     89   1e-017
hg18||uc001kik |10|NM_057157|Q5VXH9|Q5VXH9_HUMAN|CYP26A1|NM_0571...     87   6e-017
hg18||uc001kil |10|NM_000783|Q5VXI0|Q5VXI0_HUMAN|CYP26A1|NM_0007...     87   6e-017
hg18||uc001kim |10|CR604765|NA|NA|CYP26A1|NA|NA|Homo sapiens ret...     87   6e-017
hg18||uc003ulm |7|NM_000786|Q16850|CP51A_HUMAN|CYP51A1|NM_000786...     82   2e-015
hg18||uc003uln |7|AK091323|Q16850|CP51A_HUMAN|CYP51A1|NM_000786|...     82   2e-015
hg18||uc002sih |2|NM_019885|Q9NR63|CP26B_HUMAN|CYP26B1|NM_019885...     81   3e-015
hg18||uc003bce |22|NM_000106|Q6NWU0|Q6NWU0_HUMAN|CYP2D6|NM_00010...     80   7e-015
hg18||uc003bcf |22|NM_001025161|Q6NXU8|Q6NXU8_HUMAN|CYP2D6|NM_00...     80   7e-015
hg18||uc003sjq |7|NM_017781|Q8TAV3|CP2W1_HUMAN|CYP2W1|NM_017781|...     77   4e-014
hg18||uc001kkb |10|NM_000770|P10632|CP2C8_HUMAN|CYP2C8|NM_000770...     75   2e-013
hg18||uc002opl |19|NM_000762|P11509|CP2A6_HUMAN|CYP2A6|NM_000762...     75   2e-013
hg18||uc002opm |19|NM_000764|P20853|CP2A7_HUMAN|CYP2A7|NM_000764...     75   2e-013
hg18||uc002opn |19|NM_030589|P20853|CP2A7_HUMAN|CYP2A7|NM_030589...     75   2e-013
hg18||uc002opo |19|U22029|P20853|CP2A7_HUMAN|CYP2A7|NM_000764|NP...     75   2e-013
hg18||uc001kjy |10|NM_000769|P33261|CP2CJ_HUMAN|CYP2C19|NM_00076...     73   7e-013
hg18||uc001kjx |10|L07093|P33261|CP2CJ_HUMAN|CYP2C19|NM_000769|N...     73   9e-013
hg18||uc002opt |19|NM_000766|Q16696|CP2AD_HUMAN|CYP2A13|NM_00076...     71   3e-012
hg18||uc003bci |22|NR_002570|NA|NA|NR_002570|NA|NA|Homo sapiens ...     69   1e-011
hg18||uc001kjv |10|NM_000772|P33260|CP2CI_HUMAN|CYP2C18|NM_00077...     69   2e-011
hg18||uc002opu |19|NM_000774|Q8WWJ2|Q8WWJ2_HUMAN|CYP2F1|NM_00077...     67   6e-011
hg18||uc001kjw |10|BC096260|Q4VAT5|Q4VAT5_HUMAN|CYP2C18|NM_00077...     66   1e-010
hg18||uc003urs |7|AJ563378|Q7Z447|Q7Z447_HUMAN|CYP3A5|NA|NA|Cyto...     66   1e-010
hg18||uc001kka |10|NM_000771|P11712|CP2C9_HUMAN|CYP2C9|NM_000771...     65   2e-010
hg18||uc001ygp |14|AK090886|Q8N2B0|Q8N2B0_HUMAN|CYP46A1|NM_00666...     62   2e-009
hg18||uc002xww |20|BC109084|Q32ML3|Q32ML3_HUMAN|CYP24A1|NM_00078...     62   2e-009
hg18||uc003bcg |22|X16866|NA|NA|X16866|NA|NA|Homo sapiens cytoch...     56   1e-007
hg18||uc003bch |22|CR622160|NA|NA|CR622160|NA|NA|Homo sapiens cy...     56   1e-007
hg18||uc001kwg |10|NM_000102|P05093|CP17A_HUMAN|CYP17A1|NM_00010...     53   7e-007
hg18||uc001ygp |14|AK090886|Q8N2B0|Q8N2B0_HUMAN|CYP46A1|NM_00666...     53   1e-006

>hg18||uc001cqm
        |1|NM_000779|Q5SXC1|Q5SXC1_HUMAN|CYP4B1|NM_000779|NP_000770|cytochrome
        P450, family 4, subfamily B,

          Length = 511

 Score =  520 bits (1338), Expect = 2e-147
 Identities = 247/483 (51%), Positives = 329/483 (68%), Gaps = 1/483 (0%)

Query:  24 LAIVLYKLTVLLMLKRALIRNFESFPGPPGHWLFGNILEFKQDGNDLDKLVKFGQKYPYC 83
           | .   ||  ||. .| | .  . ||||| |||||. || .. |. |||.| .  ..|| 
Sbjct:  22 LVLGFLKLIHLLLRRRTLAKAMDKFPGPPTHWLFGHALEIQETGS-LDKVVSWAHQFPYA 80

Query:  84 FPLWFGPFVCFLNIHHPEYVKTILASTEPKDDLAYSFIQNWIGNGLLVSQGQKWFRHRRL 143
            ||||| |. ||||. |.| | . .  .||    | |   ||| |||| .| || .||.|
Sbjct:  81 HPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQWIGRGLLVLEGPKWLQHRKL 140

Query: 144 LTPGFHYDVLKPYVKLMAHSTKTMLDKWESYAKTNKPLEVFEYVSLMTLDTILNCAFSYD 203
           |||||||||||||| .   ||. ||||||  |.  |  ..|  |  | |.|.. | |   
Sbjct: 141 LTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRG 200

Query: 204 SNCQTERKNTYIKAVYELSNLINLRFRIFPYHNDLIFYLSPHGFRYRKACMVAHSHTEEV 263
                 | ..|  || .|. |.  |   | |||| |..|.||| |. .|| ||| ||..|
Sbjct: 201 DTGLGHRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQV 260

Query: 264 IXXXXXXXXXXXXXXXIQAKRNLDFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTT 323
           |               || .|.|||||||| |.||.   | | |.|||||||||||||||
Sbjct: 261 IRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTT 320

Query: 324 ASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPV 383
            ||||. || .| .|.||  ||.|. ..|  .|   |.|| |. | ||||||| |..|||
Sbjct: 321 TSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPV 380

Query: 384 PGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPP 443
           | . |. .||.|| |||.||||  |   .. .|||...| .| ||| |||  || ||| |
Sbjct: 381 PQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWPDPEVFDSLRFSTENASKRHP 440

Query: 444 HAFVPFSAGPRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSLNGIHI 503
            ||.|||||||||||| |||.||||| || ||..|   .|.  |  .|.||||| || |.
Sbjct: 441 FAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQLVLRSKNGFHL 500

Query: 504 KIK 506
            .|
Sbjct: 501 HLK 503

>hg18||uc001cqn
        |1|AY151048|Q8WWF2|Q8WWF2_HUMAN|CYP4B1|NM_000779|NP_000770|cytochrome
        P450, family 4, subfamily B,

          Length = 512

 Score =  518 bits (1332), Expect = 1e-146
 Identities = 247/484 (51%), Positives = 331/484 (68%), Gaps = 2/484 (0%)

Query:  24 LAIVLYKLTVLLMLKRALIRNFESFPGPPGHWLFGNILEFKQDGNDLDKLVKFGQKYPYC 83
           | .   ||  ||. .. | .  . ||||| |||||. || .. |. |||.| .  ..|| 
Sbjct:  22 LVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGS-LDKVVSWAHQFPYA 80

Query:  84 FPLWFGPFVCFLNIHHPEYVKTILASTEPKDDLAYSFIQNWIGNGLLVSQGQKWFRHRRL 143
            ||||| |. ||||. |.| | . .  .||    | |   ||| |||| .| || .||.|
Sbjct:  81 HPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQWIGRGLLVLEGPKWLQHRKL 140

Query: 144 LTPGFHYDVLKPYVKLMAHSTKTMLDKWESYAKTNKPLEVFEYVSLMTLDTILNCAFSY- 202
           |||||||||||||| .   ||. ||||||  |.  |  ..|  |  | |.|.. | |   
Sbjct: 141 LTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRG 200

Query: 203 DSNCQTERKNTYIKAVYELSNLINLRFRIFPYHNDLIFYLSPHGFRYRKACMVAHSHTEE 262
           |.     | ..|  || .|. |.  |   | |||| |..|.||| |. .|| ||| ||..
Sbjct: 201 DTGLGHSRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQ 260

Query: 263 VIXXXXXXXXXXXXXXXIQAKRNLDFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDT 322
           ||               || .|.|||||||| |.||.   | | |.||||||||||||||
Sbjct: 261 VIRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDT 320

Query: 323 TASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPP 382
           | ||||. || .| .|.||  ||.|. ..|  .|   |.|| |. | ||||||| |..||
Sbjct: 321 TTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPP 380

Query: 383 VPGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRP 442
           || . |. .||.|| |||.||||  |   .. .|||...| .| ||| |||  || ||| 
Sbjct: 381 VPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWPDPEVFDSLRFSTENASKRH 440

Query: 443 PHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSLNGIH 502
           | ||.|||||||||||| |||.||||| || ||..|   .|.  |  .|.||||| || |
Sbjct: 441 PFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQLVLRSKNGFH 500

Query: 503 IKIK 506
           . .|
Sbjct: 501 LHLK 504

>hg18||uc001cqp
        |1|NM_000778|Q5VSP8|Q5VSP8_HUMAN|CYP4A11|NM_000778|NP_000769|cytochrome
        P450, family 4, subfamily A,

          Length = 519

 Score =  497 bits (1279), Expect = 1e-140
 Identities = 246/495 (49%), Positives = 337/495 (68%), Gaps = 4/495 (0%)

Query:  13 SHFYQLLALFCLAIVLYKLTVLLMLKRALIRNFESFPGPPGHWLFGNILEFKQDGNDLDK 72
           |   |  .|  | ..| |   | . .. |..  . || || |||||.| | .||  .| .
Sbjct:  16 SGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQD-QELQR 74

Query:  73 LVKFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTILASTEPKDDLAYSFIQNWIGNGLLVS 132
           . |. . .|   | |       . .. |.|.| ||  ..||   .| |.  ||| |||. 
Sbjct:  75 IQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLL 134

Query: 133 QGQKWFRHRRLLTPGFHYDVLKPYVKLMAHSTKTMLDKWESYAKTNKPLEVFEYVSLMTL 192
            || ||.|||.||| ||||.||||| ||| | . ||||||     . |||||..||||||
Sbjct: 135 NGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTL 194

Query: 193 DTILNCAFSYDSNCQTERKN-TYIKAVYELSNLINLRFRIFPYHNDLIFYLSPHGFRYRK 251
           |||. ||||.  . | .| . .||.|. .|.||.  | |   . || |. |.  |    .
Sbjct: 195 DTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHR 254

Query: 252 ACMVAHSHTEEVIXXXXXXXXXXXXXXXIQAKRNLDFLDILLFAKDENQQGLLDEDIRAE 311
           || .|| ||..||               |. ||.|||||||| || ||   | |.|.|||
Sbjct: 255 ACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAE 314

Query: 312 VDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTM 371
           |||||||||||||||||..|| || |||||. ||.||  .|    .. |  |...|||||
Sbjct: 315 VDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGASITWNHLDQMPYTTM 374

Query: 372 CIKESLRMHPPVPGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPL 431
           ||||.||..|||||| |. . |.|| |||.|| |  .  |..|.| |  .| || |||| 
Sbjct: 375 CIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPS 434

Query: 432 RFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIP 491
           || |   | .  |||.||| | |||||. |||||.||  |.|||..||| .||  |  | 
Sbjct: 435 RFAPG--SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPIA 492

Query: 492 RLVLRSLNGIHIKIK 506
           ||||.| ||||....
Sbjct: 493 RLVLKSKNGIHLRLR 507

>hg18||uc001cqv
        |1|NM_001010969|Q5TCH4|Q5TCH4_HUMAN|CYP4A22|NM_001010969|NP_001010969|c
        ytochrome P450, family 4, subfamily A,

          Length = 519

 Score =  473 bits (1215), Expect = 4e-133
 Identities = 238/497 (47%), Positives = 333/497 (67%), Gaps = 4/497 (0%)

Query:  11 GWSHFYQLLALFCLAIVLYKLTVLLMLKRALIRNFESFPGPPGHWLFGNILEFKQDGNDL 70
           | |   |. .|  | ..| |   | . .. |..  . || || |||||.| ||. |  .|
Sbjct:  14 GVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHD-QEL 72

Query:  71 DKLVKFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTILASTEPKDDLAYSFIQNWIGNGLL 130
            .. .  . .|   | |       . .. |.|.| ||  ..||   .| |.   || |||
Sbjct:  73 QRIQERVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSYKFLAPRIGYGLL 132

Query: 131 VSQGQKWFRHRRLLTPGFHYDVLKPYVKLMAHSTKTMLDKWESYAKTNKPLEVFEYVSLM 190
           .  || ||.|||.||| || |.||||| ||| | . ||||||     . |||||..||||
Sbjct: 133 LLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLM 192

Query: 191 TLDTILNCAFSYDSNCQTERKN-TYIKAVYELSNLINLRFRIFPYHNDLIFYLSPHGFRY 249
           |||||.  |||.  . | .| . .||.|. .|..|.    |   . || |. |.  |   
Sbjct: 193 TLDTIMKSAFSHQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHENDTIYSLTSAGRWT 252

Query: 250 RKACMVAHSHTEEVIXXXXXXXXXXXXXXXIQAKRNLDFLDILLFAKDENQQGLLDEDIR 309
            .|| .|| ||..||               |. ||.|||||||| || ||   | |.|.|
Sbjct: 253 HRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLR 312

Query: 310 AEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDWEDLNKIPYT 369
           |||||||||||||||||||..|| || |||||. ||.||  .|    .. |  |...|||
Sbjct: 313 AEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGDGASITWNHLDQMPYT 372

Query: 370 TMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFD 429
           ||||||.||..|||||| |. . |.|| |||.|| |  .  |..|.| |  .| |  |||
Sbjct: 373 TMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNLEVFD 432

Query: 430 PLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKI 489
           | || |   | .  |||.||| | |||||. ||||..||  |.|||..||| .||  |  
Sbjct: 433 PSRFAPG--SAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIP 490

Query: 490 IPRLVLRSLNGIHIKIK 506
           . ||||.| ||||....
Sbjct: 491 MARLVLKSKNGIHLRLR 507

>hg18||uc001cqt
        |1|NM_178033|Q8N118|CP4X1_HUMAN|CYP4X1|NM_178033|NP_828847|cytochrome
        P450, family 4, subfamily X,

          Length = 509

 Score =  456 bits (1171), Expect = 5e-128
 Identities = 222/502 (44%), Positives = 324/502 (64%), Gaps = 6/502 (1%)

Query:  12 WSHFYQLLALFCLAIVLYKLTVLLMLKRALIRNFESFPGPPGHWLFGNILEFKQDGNDLD 71
           |.  . |  .||||. | .   | . .. |.|.   || || ||  |.  .| || | ..
Sbjct:  10 WARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGH-QKFIQDDN-ME 67

Query:  72 KLVKFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTILASTEPKDDLAYSFIQNWIGNGLLV 131
           || .  .|||  || | |||  |  |. |.| ||.|. |.||      |    .| ||  
Sbjct:  68 KLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPLLGKGLAA 127

Query: 132 SQGQKWFRHRRLLTPGFHYDVLKPYVKLMAHSTKTMLDKWESYAKT-NKPLEVFEYVSLM 190
             | |||.||||||||||...|| |...|||| | ||||||    | .  .||.|... |
Sbjct: 128 LDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSM 187

Query: 191 TLDTILNCAFSYDSNCQT-ERKNTYIKAVYELSNLINLRFRIFPYHNDLIFYLSPHGFRY 249
           .|| |. |||| ..||||    . | ||..||| .|  |     ||.|.|| ||| |.|.
Sbjct: 188 SLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRF 247

Query: 250 RKACMVAHSHTEEVIXXXXXXXXXXXXXXXIQAKRNLDFLDILLFAKDENQQGLLDEDIR 309
           .|   | . .|. .|                  ..  |||||.| ||||.     | |. 
Sbjct: 248 QKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSSFSDIDVH 307

Query: 310 AEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDWEDLNKIPYT 369
           .|| ||.  |||| |. ||..|| || .|.||. ||.|.  .|    .. |. | .. ||
Sbjct: 308 SEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQLGEMSYT 367

Query: 370 TMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFD 429
           ||||||. |. | || |||  .||.|| || |||||  .  |..|.| | ..|.|| |||
Sbjct: 368 TMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVWKNPKVFD 427

Query: 430 PLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKI 489
           ||||  ||  .| |.|..||||| |||||| ||| |.|| ||. || . .  .|| .|  
Sbjct: 428 PLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPDPT-RPLT 486

Query: 490 IP-RLVLRSLNGIHIKIKNANQ 510
            |   .|.  ||... .|  ..
Sbjct: 487 FPNHFILKPKNGMYLHLKKLSE 508

>hg18||uc001cqu
        |1|NM_178134|Q86W10|CP4Z1_HUMAN|CYP4Z1|NM_178134|NP_835235|cytochrome
        P450 4Z1

          Length = 505

 Score =  442 bits (1136), Expect = 6e-124
 Identities = 217/495 (43%), Positives = 320/495 (64%), Gaps = 4/495 (0%)

Query:  13 SHFYQLLALFCLAIVLYKLTVLLMLKRALIRNFESFPGPPGHWLFGNILEFKQDGNDLDK 72
           .| . || | |....|...  |   .| .||    || || || .|.  ||     . . 
Sbjct:  11 AHPFLLLILLCMSLLLFQVIRLYQRRRWMIRALHLFPAPPAHWFYGH-KEF-YPVKEFEV 68

Query:  73 LVKFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTILASTEPKDDLAYSFIQNWIGNGLLVS 132
             |  .|||   ||| |||  | ..| |.| | .|   .||  ...  ...|.| ||.  
Sbjct:  69 YHKLMEKYPCAVPLWVGPFTMFFSVHDPDYAKILLKRQDPKSAVSHKILESWVGRGLVTL 128

Query: 133 QGQKWFRHRRLLTPGFHYDVLKPYVKLMAHSTKTMLDKWESYAKTNKPLEVFEYVSLMTL 192
            | || .||... |||.  .|| .. .|. | . ||.||| .   |  ||.|..||||||
Sbjct: 129 DGSKWKKHRQIVKPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELFQHVSLMTL 188

Query: 193 DTILNCAFSYDSNCQTERK-NTYIKAVYELSNLINLRFRIFPYHNDLIFYLSPHGFRYRK 251
           |.|. ||||.  . | .   ..|.|||. || . | |   | .||||.|  |  |  . |
Sbjct: 189 DSIMKCAFSHQGSIQLDSTLDSYLKAVFNLSKISNQRMNNFLHHNDLVFKFSSQGQIFSK 248

Query: 252 ACMVAHSHTEEVIXXXXXXXXXXXXXXXIQAKRNLDFLDILLFAKDENQQGLLDEDIRAE 311
                |  ||.||                | ||  ||||||| || || .   . |..||
Sbjct: 249 FNQELHQFTEKVIQDRKESLKDKLKQDTTQ-KRRWDFLDILLSAKSENTKDFSEADLQAE 307

Query: 312 VDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTM 371
           | |||| |||||.| ||..|| || .|.||. || || ..|    .. || |...|||||
Sbjct: 308 VKTFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGDGSSITWEHLSQMPYTTM 367

Query: 372 CIKESLRMHPPVPGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPL 431
           |||| ||.. ||  |||   ||||| |||.||||  .  ... .| |   ||.| ||.||
Sbjct: 368 CIKECLRLYAPVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWEDPQVFNPL 427

Query: 432 RFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIP 491
           ||  ||  |  |.||.||||| ||||||.||. | || .|.|||...|  . .  |. . 
Sbjct: 428 RFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAPDHSRPPQPVR 487

Query: 492 RLVLRSLNGIHIKIK 506
           ..||.| ||||.  |
Sbjct: 488 QVVLKSKNGIHVFAK 502

>hg18||uc002nbs
        |19|NM_001082|P78329|CP4F2_HUMAN|CYP4F2|NM_001082|NP_001073|cytochrome
        P450, family 4, subfamily F,

          Length = 520

 Score =  441 bits (1133), Expect = 1e-123
 Identities = 218/474 (45%), Positives = 314/474 (66%), Gaps = 12/474 (2%)

Query:  43 RNFESFPGPP-GHWLFGNILEFKQDGNDLDKLVKFGQKYPYCFPLWFGPFVCFLNIHHPE 101
           |    || ||  .| .|.          .  | .    ||  | .| ||    |.. ||.
Sbjct:  46 RRLRCFPQPPRRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD 105

Query: 102 YVKTIL---ASTEPKDDLAYSFIQNWIGNGLLVSQGQKWFRHRRLLTPGFHYDVLKPYVK 158
            .....   |.  |||   |||.. |.|.|||.| | || ||||.||| ||...||||.|
Sbjct: 106 IIRSVINASAAIAPKDKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMK 165

Query: 159 LMAHSTKTMLDKWESYAKTNKP-LEVFEYVSLMTLDTILNCAFSYDSNCQTERKNTYIKA 217
           .   |   |  ||.  |      |..||..||||||..  | ||.||.|| |. . || |
Sbjct: 166 IFNESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSFDSHCQ-EKPSEYIAA 224

Query: 218 VYELSNLINLRFRIFPYHNDLIFYLSPHGFRYRKACMVAHSHTEEVIXXXXXXXXXXXXX 277
           . ||| |.. |      | | ..||.| | |.|.|| . |  |. ||             
Sbjct: 225 ILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVD 284

Query: 278 XXIQAK---RNLDFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNL 334
             .|||   . |||.|.|| .|||. . | ||||||| ||||||||||||||.|..||.|
Sbjct: 285 DFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHL 344

Query: 335 ACHPKHQKLCRKEIMQVLHGKD--TMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTK 392
           | ||..|. ||.|. ..|  ..   ..|.||  .|. |||.|||||.||||| |||  |.
Sbjct: 345 AKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQ 404

Query: 393 PITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAG 452
            |   ||| .| |     |||| | | ..| .| |.|| || |||| .| | ||.|||||
Sbjct: 405 DIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAG 464

Query: 453 PRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSLNGIHIKIK 506
           ||||||| ||| |||||.|.|||.. .| . | .|.  | ||||.  |. ....
Sbjct: 465 PRNCIGQTFAMAEMKVVLALTLLRFRVLPDHT-EPRRKPELVLRAEGGLWLRVE 517

>hg18||uc001cqq
        |1|BC041158|Q86SU6|Q86SU6_HUMAN|CYP4A11|NM_000778|NP_000769|cytochrome
        P450, family 4, subfamily A,

          Length = 455

 Score =  433 bits (1113), Expect = 3e-121
 Identities = 214/441 (48%), Positives = 294/441 (66%), Gaps = 4/441 (0%)

Query:  13 SHFYQLLALFCLAIVLYKLTVLLMLKRALIRNFESFPGPPGHWLFGNILEFKQDGNDLDK 72
           |   |  .|  | ..| |   | . .. |..  . || || |||||.| | .||  .| .
Sbjct:  16 SGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQD-QELQR 74

Query:  73 LVKFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTILASTEPKDDLAYSFIQNWIGNGLLVS 132
           . |. . .|   | |       . .. |.|.| ||  ..||   .| |.  ||| |||. 
Sbjct:  75 IQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLL 134

Query: 133 QGQKWFRHRRLLTPGFHYDVLKPYVKLMAHSTKTMLDKWESYAKTNKPLEVFEYVSLMTL 192
            || ||.|||.||| ||||.||||| ||| | . ||||||     . |||||..||||||
Sbjct: 135 NGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTL 194

Query: 193 DTILNCAFSYDSNCQTERKN-TYIKAVYELSNLINLRFRIFPYHNDLIFYLSPHGFRYRK 251
           |||. ||||.  . | .| . .||.|. .|.||.  | |   . || |. |.  |    .
Sbjct: 195 DTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHR 254

Query: 252 ACMVAHSHTEEVIXXXXXXXXXXXXXXXIQAKRNLDFLDILLFAKDENQQGLLDEDIRAE 311
           || .|| ||..||               |. ||.|||||||| || ||   | |.|.|||
Sbjct: 255 ACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAE 314

Query: 312 VDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTM 371
           |||||||||||||||||..|| || |||||. ||.||  .|    .. |  |...|||||
Sbjct: 315 VDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGASITWNHLDQMPYTTM 374

Query: 372 CIKESLRMHPPVPGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPL 431
           ||||.||..|||||| |. . |.|| |||.|| |  .  |..|.| |  .| || |||| 
Sbjct: 375 CIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPF 434

Query: 432 RFLPENISKRPPHAFVPFSAG 452
           || |   | .  |||.||| |
Sbjct: 435 RFAPG--SAQHSHAFLPFSGG 453

>hg18||uc002nbk
        |19|AF054821|Q08477|CP4F3_HUMAN|CYP4F3|NM_000896|NP_000887|cytochrome
        P450, family 4, subfamily F,

          Length = 520

 Score =  433 bits (1113), Expect = 3e-121
 Identities = 213/469 (45%), Positives = 312/469 (66%), Gaps = 12/469 (2%)

Query:  48 FPGPP-GHWLFGNILEFKQDGNDLDKLVKFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTI 106
           || ||  .|  |..         .  | .    ||  | .| ||    .   ||  ....
Sbjct:  51 FPQPPKRNWFLGHLGLVTPTEQGMRVLTQLVATYPQGFKVWMGPIFPVIRFCHPNIIRSV 110

Query: 107 L---ASTEPKDDLAYSFIQNWIGNGLLVSQGQKWFRHRRLLTPGFHYDVLKPYVKLMAHS 163
           .   |.  ||| . |||.. |.|.|||.| |.|| ||||.||| ||...||||.|.   |
Sbjct: 111 INASAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNES 170

Query: 164 TKTMLDKWESYAKTNKP-LEVFEYVSLMTLDTILNCAFSYDSNCQTERKNTYIKAVYELS 222
              |  ||.  |      |..||..||||||..  | ||.||.|| |. . || |. |||
Sbjct: 171 VNIMHAKWQLLASEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQ-EKPSEYIAAILELS 229

Query: 223 NLINLRFRIFPYHNDLIFYLSPHGFRYRKACMVAHSHTEEVIXXXXXXXXXXXXXXXIQA 282
            |.  | .    . | ..||.| | |.|.|| . |  |. ||               .||
Sbjct: 230 ALVTKRHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQA 289

Query: 283 K---RNLDFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPK 339
           |   . |||.|.|| .|||. . | ||||||| ||||||||||||||.|..||.|| ||.
Sbjct: 290 KAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPE 349

Query: 340 HQKLCRKEIMQVLHGKD--TMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFF 397
           .|. ||.|. ..|  ..   ..|.|| ..|. |||||||||.||||| .||  |. |   
Sbjct: 350 YQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLP 409

Query: 398 DGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCI 457
           ||| .| |     |||| | | ..| .| |.|| || |.|| .| | ||.||||||||||
Sbjct: 410 DGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCI 469

Query: 458 GQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSLNGIHIKIK 506
           || ||| |||||. .|||.. .| . | .|.  | ||||.  |. ....
Sbjct: 470 GQAFAMAEMKVVLGLTLLRFRVLPDHT-EPRRKPELVLRAEGGLWLRVE 517

>hg18||uc002nbh
        |19|NM_173483|Q6NT55|Q6NT55_HUMAN|FLJ39501|NM_173483|NP_775754|cytochro
        me P450, family 2, subfamily E,

          Length = 531

 Score =  432 bits (1109), Expect = 8e-121
 Identities = 225/500 (45%), Positives = 325/500 (65%), Gaps = 13/500 (2%)

Query:  19 LALFCLAIVLYKLTVLLMLKRAL---IRNFESFPGPP-GHWLFGNILEFKQDGNDLDKLV 74
           | || |  .   |   | | |.     |    || ||  .|| |..  .  .   |    
Sbjct:  27 LLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFPQPPRRNWLLGHLGMYLPNEAGLQDEK 86

Query:  75 KFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTIL---ASTEPKDDLAYSFIQNWIGNGLLV 131
           |      .   .| || .  | . ||.|.| .|   |.| ||||| | |.. |.|.|||.
Sbjct:  87 KVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLGASAATAPKDDLFYGFLKPWLGDGLLL 146

Query: 132 SQGQKWFRHRRLLTPGFHYDVLKPYVKLMAHSTKTMLDKWESYAKTNK-PLEVFEYVSLM 190
           |.| || |||||||| ||.|.||||.|.   |   |  ||   |. .   |..||..|||
Sbjct: 147 SKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWRHLAEGSAVSLDMFEHISLM 206

Query: 191 TLDTILNCAFSYDSNCQTERKNTYIKAVYELSNLINLRFRIFPYHNDLIFYLSPHGFRYR 250
           |||..  | |||.|||| |. . || |. ||| |   |     .. | |.| |  | |.|
Sbjct: 207 TLDSLQKCVFSYNSNCQ-EKMSDYISAIIELSALSVRRQYRLHHYLDFIYYRSADGRRFR 265

Query: 251 KACMVAHSHTEEVIXXXXXXXXXXXXXXXIQAK--RNLDFLDILLFAKDENQQGLLDEDI 308
           .|| . |  | |||               ..||  . |||.|.|| |.||. . | ||||
Sbjct: 266 QACDMVHHFTTEVIQERRRALRRQGAEAWLKAKQGKTLDFIDVLLLARDEDGKELSDEDI 325

Query: 309 RAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGK--DTMDWEDLNKI 366
           ||| |||||||||||.||||..|.||| .|..|. ||.|| .|. |.  . ..|.|| ..
Sbjct: 326 RAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEKCREEIQEVMKGRELEELEWDDLTQL 385

Query: 367 PYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNASIWENPN 426
           |.|||||||||| .|||  .||. |. |   ||| .| |     |..| | | ..| .  
Sbjct: 386 PFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGRIIPKGIICLVSIYGTHHNPTVWPDSK 445

Query: 427 VFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLK 486
           |..| || |.|  .| | |.|||||||||||||.||| |..||.|.|||.. |  . | |
Sbjct: 446 VYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSVDRTRK 505

Query: 487 PKIIPRLVLRSLNGIHIKIK 506
            .  | |.||. ||. .|..
Sbjct: 506 VRRKPELILRTENGLWLKVE 525

>hg18||uc002nbj
        |19|NM_000896|Q08477|CP4F3_HUMAN|CYP4F3|NM_000896|NP_000887|cytochrome
        P450, family 4, subfamily F,

          Length = 520

 Score =  428 bits (1100), Expect = 8e-120
 Identities = 214/469 (45%), Positives = 309/469 (65%), Gaps = 12/469 (2%)

Query:  48 FPGPP-GHWLFGNILEFKQDGNDLDKLVKFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTI 106
           || ||  .|  |..         |         .      | ||.   . | || |.| .
Sbjct:  51 FPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPV 110

Query: 107 L---ASTEPKDDLAYSFIQNWIGNGLLVSQGQKWFRHRRLLTPGFHYDVLKPYVKLMAHS 163
           |   |.  ||| . |||.. |.|.|||.| |.|| ||||.||| ||...||||.|.   |
Sbjct: 111 LFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNES 170

Query: 164 TKTMLDKWESYAKTNKP-LEVFEYVSLMTLDTILNCAFSYDSNCQTERKNTYIKAVYELS 222
              |  ||.  |      |..||..||||||..  | ||.||.|| |. . || |. |||
Sbjct: 171 VNIMHAKWQLLASEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQ-EKPSEYIAAILELS 229

Query: 223 NLINLRFRIFPYHNDLIFYLSPHGFRYRKACMVAHSHTEEVIXXXXXXXXXXXXXXXIQA 282
            |.  | .    . | ..||.| | |.|.|| . |  |. ||               .||
Sbjct: 230 ALVTKRHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQA 289

Query: 283 K---RNLDFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPK 339
           |   . |||.|.|| .|||. . | ||||||| ||||||||||||||.|..||.|| ||.
Sbjct: 290 KAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPE 349

Query: 340 HQKLCRKEIMQVLHGKD--TMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFF 397
           .|. ||.|. ..|  ..   ..|.|| ..|. |||||||||.||||| .||  |. |   
Sbjct: 350 YQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLP 409

Query: 398 DGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCI 457
           ||| .| |     |||| | | ..| .| |.|| || |.|| .| | ||.||||||||||
Sbjct: 410 DGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCI 469

Query: 458 GQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSLNGIHIKIK 506
           || ||| |||||. .|||.. .| . | .|.  | ||||.  |. ....
Sbjct: 470 GQAFAMAEMKVVLGLTLLRFRVLPDHT-EPRRKPELVLRAEGGLWLRVE 517

>hg18||uc002nbt
        |19|NM_021187|Q9HBI6|CP4FB_HUMAN|CYP4F11|NM_021187|NP_067010|cytochrome
        P450, family 4, subfamily F,

          Length = 524

 Score =  427 bits (1096), Expect = 2e-119
 Identities = 214/479 (44%), Positives = 309/479 (64%), Gaps = 12/479 (2%)

Query:  43 RNFESFPGPP-GHWLFGNILEFKQDGNDLDKLVKFGQKYPYCFPLWFGPFVCFLNIHHPE 101
           |  . || ||  .| .|.          .  | .    ||  | || ||    | . ||.
Sbjct:  46 RRLQCFPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPD 105

Query: 102 YVKTIL---ASTEPKDDLAYSFIQNWIGNGLLVSQGQKWFRHRRLLTPGFHYDVLKPYVK 158
            .. |    |.  ||| . | |.. |.|.|||.| | || ||||.||| ||...||||.|
Sbjct: 106 IIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMK 165

Query: 159 LMAHSTKTMLDKWESYAKTNKP-LEVFEYVSLMTLDTILNCAFSYDSNCQTERKNTYIKA 217
           .   |   | |||.  |      |..||..||||||..  | ||..|||| |. . || |
Sbjct: 166 IFNKSVNIMHDKWQRLASEGSARLDMFEHISLMTLDSLQKCVFSFESNCQ-EKPSEYIAA 224

Query: 218 VYELSNLINLRFRIFPYHNDLIFYLSPHGFRYRKACMVAHSHTEEVIXXXXXXXXXXXXX 277
           . |||  .  | .    | | ..||.| | |.|.|| . |  |. ||             
Sbjct: 225 ILELSAFVEKRNQQILLHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRRTLPTQGID 284

Query: 278 XXIQAK---RNLDFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNL 334
             .. |   . |||.|.|| .|||. . | ||||||| ||||||||||||||.|..||.|
Sbjct: 285 DFLKNKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHL 344

Query: 335 ACHPKHQKLCRKEIMQVLHGKD--TMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTK 392
           | ||..|. ||.|. ..|  ..   ..|.|| ..|. |||||||||.||||| |||  |.
Sbjct: 345 AKHPEYQEQCRQEVQELLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQ 404

Query: 393 PITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAG 452
                ||| .| |     .. ||| | ..| .| |.|| ||  ||| .| | ||.|||||
Sbjct: 405 DFVLPDGRVIPKGIVCLINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAG 464

Query: 453 PRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSLNGIHIKIKNANQN 511
           ||||||| ||| |||||.|.||| . .|   | .|.  | |.||.  |. ....    |
Sbjct: 465 PRNCIGQAFAMAEMKVVLALTLLHFRILPTHT-EPRRKPELILRAEGGLWLRVEPLGAN 522

>hg18||uc002nbu
        |19|BC016853|Q9HBI6|CP4FB_HUMAN|CYP4F11|NM_021187|NP_067010|cytochrome
        P450, family 4, subfamily F,

          Length = 524

 Score =  426 bits (1095), Expect = 3e-119
 Identities = 214/479 (44%), Positives = 309/479 (64%), Gaps = 12/479 (2%)

Query:  43 RNFESFPGPP-GHWLFGNILEFKQDGNDLDKLVKFGQKYPYCFPLWFGPFVCFLNIHHPE 101
           |  . || ||  .| .|.          .  | .    ||  | || ||    | . ||.
Sbjct:  46 RRLQCFPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPD 105

Query: 102 YVKTIL---ASTEPKDDLAYSFIQNWIGNGLLVSQGQKWFRHRRLLTPGFHYDVLKPYVK 158
            .. |    |.  ||| . | |.. |.|.|||.| | || ||||.||| ||...||||.|
Sbjct: 106 IIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMK 165

Query: 159 LMAHSTKTMLDKWESYAKTNKP-LEVFEYVSLMTLDTILNCAFSYDSNCQTERKNTYIKA 217
           .   |   | |||.  |      |..||..||||||..  | ||..|||| |. . || |
Sbjct: 166 IFNKSVNIMHDKWQRLASEGSARLDMFEHISLMTLDSLQKCVFSFESNCQ-EKPSEYIAA 224

Query: 218 VYELSNLINLRFRIFPYHNDLIFYLSPHGFRYRKACMVAHSHTEEVIXXXXXXXXXXXXX 277
           . |||  .  | .    | | ..||.| | |.|.|| . |  |. ||             
Sbjct: 225 ILELSAFVEKRNQQILLHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPTQGID 284

Query: 278 XXIQAK---RNLDFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNL 334
             .. |   . |||.|.|| .|||. . | ||||||| ||||||||||||||.|..||.|
Sbjct: 285 DFLKNKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHL 344

Query: 335 ACHPKHQKLCRKEIMQVLHGKD--TMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTK 392
           | ||..|. ||.|. ..|  ..   ..|.|| ..|. |||||||||.||||| |||  |.
Sbjct: 345 AKHPEYQEQCRQEVQELLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQ 404

Query: 393 PITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAG 452
                ||| .| |     .. ||| | ..| .| |.|| ||  ||| .| | ||.|||||
Sbjct: 405 DFVLPDGRVIPKGIVCLINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAG 464

Query: 453 PRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSLNGIHIKIKNANQN 511
           ||||||| ||| |||||.|.||| . .|   | .|.  | |.||.  |. ....    |
Sbjct: 465 PRNCIGQAFAMAEMKVVLALTLLHFRILPTHT-EPRRKPELILRAEGGLWLRVEPLGAN 522

>hg18||uc001cqr |1|AK131355|Q6ZN67|Q6ZN67_HUMAN|CYP4X1|NA|NA|CDNA FLJ16384 fis,
        clone TLIVE2007607, weakly similar to CYTOCHROME P450 4A4 (EC
        1.14.14.1)

          Length = 508

 Score =  422 bits (1083), Expect = 8e-118
 Identities = 205/451 (45%), Positives = 295/451 (65%), Gaps = 5/451 (1%)

Query:  63 FKQDGNDLDKLVKFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTILASTEPKDDLAYSFIQ 122
           | || | ..|| .  .|||  || | |||  |  |. |.| ||.|. |.||      |  
Sbjct:  59 FIQDDN-MEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSP 117

Query: 123 NWIGNGLLVSQGQKWFRHRRLLTPGFHYDVLKPYVKLMAHSTKTMLDKWESYAKT-NKPL 181
             .| ||    | |||.||||||||||...|| |...|||| | ||||||    | .  .
Sbjct: 118 PLLGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSV 177

Query: 182 EVFEYVSLMTLDTILNCAFSYDSNCQT-ERKNTYIKAVYELSNLINLRFRIFPYHNDLIF 240
           ||.|... |.|| |. |||| ..||||    . | ||..||| .|  |     ||.|.||
Sbjct: 178 EVYEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIF 237

Query: 241 YLSPHGFRYRKACMVAHSHTEEVIXXXXXXXXXXXXXXXIQAKRNLDFLDILLFAKDENQ 300
            ||| |.|..|   | . .|. .|                  ..  |||||.| ||||. 
Sbjct: 238 KLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESG 297

Query: 301 QGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDW 360
               | |. .|| ||.  |||| |. ||..|| || .|.||. ||.|.  .|    .. |
Sbjct: 298 SSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITW 357

Query: 361 EDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNAS 420
           . | .. ||||||||. |. | || |||  .||.|| || |||||  .  |..|.| | .
Sbjct: 358 DQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPA 417

Query: 421 IWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTLLKYELL 480
           .|.|| |||||||  ||  .| |.|..||||| |||||| ||| |.|| ||. || . . 
Sbjct: 418 VWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVT 477

Query: 481 EEPTLKPKIIP-RLVLRSLNGIHIKIKNANQ 510
            .|| .|   |   .|.  ||... .|  ..
Sbjct: 478 PDPT-RPLTFPNHFILKPKNGMYLHLKKLSE 507

>hg18||uc002nbi |19|NM_007253|NA|NA|CYP4F8|NM_007253|NP_009184|cytochrome P450,
        family 4, subfamily F,

          Length = 520

 Score =  419 bits (1077), Expect = 4e-117
 Identities = 206/474 (43%), Positives = 307/474 (64%), Gaps = 12/474 (2%)

Query:  43 RNFESFPGP-PGHWLFGNILEFKQDGNDLDKLVKFGQKYPYCFPLWFGPFVCFLNIHHPE 101
           |    || |   .|  |..         |  | .    ||  |  | ||    .|. ||.
Sbjct:  46 RRLRCFPQPRKQNWFLGHLGLVTPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPD 105

Query: 102 YVKTILASTE---PKDDLAYSFIQNWIGNGLLVSQGQKWFRHRRLLTPGFHYDVLKPYVK 158
            |.... ...    || . |  .. |.|.|||.| | ||  ||||||| ||...||||.|
Sbjct: 106 IVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIK 165

Query: 159 LMAHSTKTMLDKWESYAKTNKP-LEVFEYVSLMTLDTILNCAFSYDSNCQTERKNTYIKA 217
           . . |   |  ||.  |      |.|||..||||||..  | ||.||||| |. . || |
Sbjct: 166 IFSKSANIMHAKWQRLAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQ-EKPSEYITA 224

Query: 218 VYELSNLINLRFRIFPYHNDLIFYLSPHGFRYRKACMVAHSHTEEVIXXXXXXXXXXXXX 277
           . ||| |.  |   |  . | ...|.| | |. .|| . |  |. ||             
Sbjct: 225 IMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVD 284

Query: 278 XXIQAK---RNLDFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNL 334
             .|||   . |||.|.|| ..|.| . | ||||||| ||||| ||||||||.|..||||
Sbjct: 285 DFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNL 344

Query: 335 ACHPKHQKLCRKEIMQVLHGKD--TMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTK 392
           | ||..|. ||.|. ..|  ..   ..|.|| ..|. |||.|||||.|||.|  .|  |.
Sbjct: 345 ARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQ 404

Query: 393 PITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAG 452
            .   | | .| |     ..| || | |.| .| |.|| || |||  || | ||.|||||
Sbjct: 405 DVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAG 464

Query: 453 PRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSLNGIHIKIK 506
           ||||||| ||| |||||.|.|||.. .| .   .|.  | .|||. .|. ....
Sbjct: 465 PRNCIGQKFAMAEMKVVLALTLLRFRILPDHR-EPRRTPEIVLRAEDGLWLRVE 517

>hg18||uc001cqs
        |1|AX747195|Q8NAZ3|Q8NAZ3_HUMAN|CYP4X1|NM_178033|NP_828847|cytochrome
        P450, family 4, subfamily X,

          Length = 444

 Score =  419 bits (1076), Expect = 5e-117
 Identities = 201/444 (45%), Positives = 291/444 (65%), Gaps = 4/444 (0%)

Query:  70 LDKLVKFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTILASTEPKDDLAYSFIQNWIGNGL 129
           ..|| .  .|||  || | |||  |  |. |.| ||.|. |.||      |    .| ||
Sbjct:   1 MEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPLLGKGL 60

Query: 130 LVSQGQKWFRHRRLLTPGFHYDVLKPYVKLMAHSTKTMLDKWESYAKT-NKPLEVFEYVS 188
               | |||.||||||||||...|| |...|||| | ||||||    | .  .||.|...
Sbjct:  61 AALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHIN 120

Query: 189 LMTLDTILNCAFSYDSNCQT-ERKNTYIKAVYELSNLINLRFRIFPYHNDLIFYLSPHGF 247
            |.|| |. |||| ..||||    . | ||..||| .|  |     ||.|.|| ||| |.
Sbjct: 121 SMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGY 180

Query: 248 RYRKACMVAHSHTEEVIXXXXXXXXXXXXXXXIQAKRNLDFLDILLFAKDENQQGLLDED 307
           |..|   | . .|. .|                  ..  |||||.| ||||.     | |
Sbjct: 181 RFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSSFSDID 240

Query: 308 IRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDWEDLNKIP 367
           . .|| ||.  |||| |. ||..|| || .|.||. ||.|.  .|    .. |. | .. 
Sbjct: 241 VHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQLGEMS 300

Query: 368 YTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNV 427
           ||||||||. |. | || |||  .||.|| || |||||  .  |..|.| | ..|.|| |
Sbjct: 301 YTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVWKNPKV 360

Query: 428 FDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKP 487
           ||||||  ||  .| |.|..||||| |||||| ||| |.|| ||. || . .  .|| .|
Sbjct: 361 FDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPDPT-RP 419

Query: 488 KIIP-RLVLRSLNGIHIKIKNANQ 510
              |   .|.  ||... .|  ..
Sbjct: 420 LTFPNHFILKPKNGMYLHLKKLSE 443

>hg18||uc002nbl
        |19|NM_023944|Q8IV39|Q8IV39_HUMAN|CYP4F12|NM_023944|NP_076433|cytochrom
        e P450, family 4, subfamily F,

          Length = 524

 Score =  415 bits (1065), Expect = 1e-115
 Identities = 206/477 (43%), Positives = 303/477 (63%), Gaps = 12/477 (2%)

Query:  43 RNFESFPGPP-GHWLFGNILEFKQDGNDLDKLVKFGQKYPYCFPLWFGPFVCFLNIHHPE 101
           |  . || ||  .| .|..         |    .    |   | .| || . |. . ||.
Sbjct:  46 RRLQCFPQPPKRNWFWGHLGLITPTEEGLKDSTQMSATYSQGFTVWLGPIIPFIVLCHPD 105

Query: 102 YVKTIL---ASTEPKDDLAYSFIQNWIGNGLLVSQGQKWFRHRRLLTPGFHYDVLKPYVK 158
            ...|    |.  |||.|   |.. |.| |.|.| | || ||||.||| ||...|| |. 
Sbjct: 106 TIRSITNASAAIAPKDNLFIRFLKPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYIT 165

Query: 159 LMAHSTKTMLDKWESYA-KTNKPLEVFEYVSLMTLDTILNCAFSYDSNCQTERKNTYIKA 217
           .   |   |||||.  | . .  |..||..||||||..  | ||.||.|| || . ||  
Sbjct: 166 IFNKSANIMLDKWQHLASEGSSRLDMFEHISLMTLDSLQKCIFSFDSHCQ-ERPSEYIAT 224

Query: 218 VYELSNLINLRFRIFPYHNDLIFYLSPHGFRYRKACMVAHSHTEEVIXXXXXXXXXXXXX 277
           . ||| |.  | .    | | ..|||  | |. .|| . |  |. ||             
Sbjct: 225 ILELSALVEKRSQHILQHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGID 284

Query: 278 XXIQAK---RNLDFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNL 334
              . |   . |||.|.|| .|||. . | ||||||| ||||| ||||||||.|..||||
Sbjct: 285 DFFKDKAKSKTLDFIDVLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNL 344

Query: 335 ACHPKHQKLCRKEIMQVLHGKD--TMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTK 392
           | ||..|. ||.|. ..|  .|   ..|.|| ..|. |||.|||||.||| | |||  |.
Sbjct: 345 ARHPEYQERCRQEVQELLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQ 404

Query: 393 PITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAG 452
            |   ||| .| |      . |.| | ..| .| |.|| || |||   | | ||.|||||
Sbjct: 405 DIVLPDGRVIPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAG 464

Query: 453 PRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSLNGIHIKIKNAN 509
           ||||||| ||| |||||.|. || .  | . | .|.    |..|.  |. ....  |
Sbjct: 465 PRNCIGQAFAMAEMKVVLALMLLHFRFLPDHT-EPRRKLELIMRAEGGLWLRVEPLN 520

>hg18||uc003iyw
        |4|NM_207352|Q6ZWL3|CP4V2_HUMAN|CYP4V2|NM_207352|NP_997235|cytochrome
        P450, family 4, subfamily v,

          Length = 525

 Score =  250 bits (637), Expect = 4e-066
 Identities = 159/473 (33%), Positives = 248/473 (52%), Gaps = 29/473 (6%)

Query:  56 LFGNILEFKQDGND-LDKLVKFGQKYPY--CFPLWFGPFVCFLNIHHPEYVKTILASTEP 112
           | |. |  | || .   ..... ..| .     || || |  . ... | |. || |.. 
Sbjct:  59 LVGHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGP-VPMVALYNAENVEVILTSSKQ 117

Query: 113 KDDLA-YSFIQNWIGNGLLVSQGQKWFRHRRLLTPGFHYDVLKPYVKLMAHSTKTMLDKW 171
            |  . | |.. |.| ||| | | ||   |..||| ||. .|. .. .|      .. | 
Sbjct: 118 IDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKL 177

Query: 172 ESYAKTNKPLEVFEYVSLMTLDTILNCAFSYDSNCQTERKNTYIKAVYELSNLINLRFRI 231
           | .    .    | |..|  || |   |   .   |.   . |..||| .| .|  | ..
Sbjct: 178 EKHI-NQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKM 236

Query: 232 FPYHNDLIFYLSPHGFRYRKACMVAHSHTEEVIXXXXXXXXX------XXXXXXIQAKRN 285
                || . .   |. ..|.  . |. |  ||                         . 
Sbjct: 237 PWLWLDLWYLMFKEGWEHKKSLKILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKR 296

Query: 286 LDFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCR 345
             |||.||   |.    |  |||| ||||||||||||||. |.. || |  .|. ||   
Sbjct: 297 RAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVD 356

Query: 346 KEIMQVLHGKD-TMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPA 404
            |.  |    |     ||| |. |    |||.||. | ||  .|  ..           |
Sbjct: 357 HELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEV-------A 409

Query: 405 GFRI--GTSV----FGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIG 458
           |.|.  ||      . .||.   . ||  | | || |||   | |.|.||||||||||||
Sbjct: 410 GYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIG 469

Query: 459 QNFAMNEMKVVIAMTLLKYELLEEPTLKPK--IIPRLVLRSLNGIHIKIKNAN 509
           | ||. | | ...  .|..  .|    . .  .  .|.||  ||| ||.|  |
Sbjct: 470 QKFAVMEEKTILS-CILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRN 521

>hg18||uc003urw
        |7|J04449|Q6GRK0|Q6GRK0_HUMAN|CYP3A4|NM_017460|NP_059488|cytochrome
        P450, subfamily IIIA, polypeptide 4

          Length = 502

 Score =  143 bits (358), Expect = 9e-034
 Identities = 114/463 (24%), Positives = 208/463 (44%), Gaps = 33/463 (7%)

Query:  49 PGPPGHWLFGNILEFKQDGNDLDKLVKFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTILA 108
           |||      |||| . .     |  ..  .||   .  . |     | |  |. .||.| 
Sbjct:  39 PGPTPLPFLGNILSYHKGFCMFD--MECHKKYGKVWGFYDGQ-QPVLAITDPDMIKTVLV 95

Query: 109 STEPKDDLAYSFIQN--------WIGNGLLVSQGQKWFRHRRLLTPGFHYDVLKPYVKLM 160
                    ||   |        .. . . ... ..| | | ||.| |    ||  | ..
Sbjct:  96 KE------CYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPII 149

Query: 161 AHSTKTMLDKWESYAKTNKPLEVFEYVSLMTLDTILNCAFSYDSNCQTERKNTYIKAVYE 220
           |     ..      |.| ||. . .     ..| | . .|  . .     .. ...   .
Sbjct: 150 AQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKK 209

Query: 221 LSNLINLRFRIF-PYHNDLIFYLSPHGFRYRKACMVAHSHTEEVIXXXXXXXXXXXXXXX 279
           |     |||    |.   .||            |.     |  .                
Sbjct: 210 L-----LRFDFLDPFFLSIIFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDT- 263

Query: 280 IQAKRNLDFLDILLFAKD----ENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLA 335
              |  .||| ... ...    |. . | | .. |.   |.| |..||.| .||..| ||
Sbjct: 264 --QKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELA 321

Query: 336 CHPKHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPIT 395
            ||  |.  ..||  ||  |    .. . .. |  | . |.||. |    . |   | . 
Sbjct: 322 THPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVE 381

Query: 396 FFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRN 455
             .|  .| |  .    . .||.   |  |  | | ||  .|     |. . || .||||
Sbjct: 382 -INGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRN 440

Query: 456 CIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSL 498
           |||  ||.  ||. .   |  .    .|  . .|  .| |  |
Sbjct: 441 CIGMRFALMNMKLALIRVLQNFSF--KPCKETQIPLKLSLGGL 481

>hg18||uc003urv
        |7|NM_017460|P08684|CP3A4_HUMAN|CYP3A4|NM_017460|NP_059488|cytochrome
        P450, subfamily IIIA, polypeptide 4

          Length = 503

 Score =  118 bits (294), Expect = 2e-026
 Identities = 67/220 (30%), Positives = 117/220 (53%), Gaps = 7/220 (3%)

Query: 283 KRNLDFLDILLFAKD----ENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHP 338
           |  .||| ... ...    |. . | | .. |.   |.| |..||.| .||..| || ||
Sbjct: 266 KHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHP 325

Query: 339 KHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFD 398
             |.  ..||  ||  |    .. . .. |  | . |.||. |    . |   | .   .
Sbjct: 326 DVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVE-IN 384

Query: 399 GRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIG 458
           |  .| |  .    . .||.   |  |  | | ||  .|     |. . || .|||||||
Sbjct: 385 GMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG 444

Query: 459 QNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSL 498
             ||.  ||. .   |  .    .|  . .|  .| |  |
Sbjct: 445 MRFALMNMKLALIRVLQNFSF--KPCKETQIPLKLSLGGL 482

>hg18||uc003uru
        |7|NM_000765|P24462|CP3A7_HUMAN|CYP3A7|NM_000765|NP_000756|cytochrome
        P450, family 3, subfamily A,

          Length = 503

 Score =  117 bits (292), Expect = 4e-026
 Identities = 62/199 (31%), Positives = 106/199 (53%), Gaps = 5/199 (2%)

Query: 283 KRNLDFLDILLFAKD----ENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHP 338
           |  .||| ... ...    |  . | | .. |.   |.| |..||.| .||..| || ||
Sbjct: 266 KHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHP 325

Query: 339 KHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFD 398
             |.  .|||  ||  |    .. . .. |  | . |.||. |    . |   | .   .
Sbjct: 326 DVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVE-IN 384

Query: 399 GRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIG 458
           |  .| |  .    . .| .   |  |  | | ||  .|     |. . || .|||||||
Sbjct: 385 GMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG 444

Query: 459 QNFAMNEMKVVIAMTLLKY 477
             ||.  ||. .   |  .
Sbjct: 445 MRFALVNMKLALVRVLQNF 463

>hg18||uc003urp |7|CR620792|NA|NA|CYP3A5|NM_000777|NP_000768|cytochrome P450,
        family 3, subfamily A,

          Length = 322

 Score =  114 bits (284), Expect = 3e-025
 Identities = 64/199 (32%), Positives = 105/199 (52%), Gaps = 6/199 (3%)

Query: 283 KRNLDFLDILLFAKD----ENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHP 338
           |  |||| ... ...    |. . | | .. |.   |.| |..||.| .|| || || ||
Sbjct:  86 KHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHP 145

Query: 339 KHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFD 398
             |.  .|||  ||  |    .. . .. |  | . |.||. |    . |   | .   .
Sbjct: 146 DVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVE-IN 204

Query: 399 GRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIG 458
           |  .| |  .    . .| .   |  |  | | ||  .  |   |. . ||  |||||||
Sbjct: 205 GVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKKKDS-IDPYIYTPFGTGPRNCIG 263

Query: 459 QNFAMNEMKVVIAMTLLKY 477
             ||.  ||. .   |  .
Sbjct: 264 MRFALMNMKLALIRVLQNF 282

>hg18||uc003urq
        |7|NM_000777|P20815|CP3A5_HUMAN|CYP3A5|NM_000777|NP_000768|cytochrome
        P450, family 3, subfamily A,

          Length = 502

 Score =  114 bits (284), Expect = 3e-025
 Identities = 64/199 (32%), Positives = 105/199 (52%), Gaps = 6/199 (3%)

Query: 283 KRNLDFLDILLFAKD----ENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHP 338
           |  |||| ... ...    |. . | | .. |.   |.| |..||.| .|| || || ||
Sbjct: 266 KHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHP 325

Query: 339 KHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFD 398
             |.  .|||  ||  |    .. . .. |  | . |.||. |    . |   | .   .
Sbjct: 326 DVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVE-IN 384

Query: 399 GRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIG 458
           |  .| |  .    . .| .   |  |  | | ||  .  |   |. . ||  |||||||
Sbjct: 385 GVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKKKDS-IDPYIYTPFGTGPRNCIG 443

Query: 459 QNFAMNEMKVVIAMTLLKY 477
             ||.  ||. .   |  .
Sbjct: 444 MRFALMNMKLALIRVLQNF 462

>hg18||uc003urr |7|BC025176|NA|NA|CYP3A43|NA|NA|Homo sapiens CYP3A5 mRNA, allele
        CYP3A5*3, exon 3B, alternatively spliced

          Length = 389

 Score =  114 bits (284), Expect = 3e-025
 Identities = 64/199 (32%), Positives = 105/199 (52%), Gaps = 6/199 (3%)

Query: 283 KRNLDFLDILLFAKD----ENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHP 338
           |  |||| ... ...    |. . | | .. |.   |.| |..||.| .|| || || ||
Sbjct: 153 KHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHP 212

Query: 339 KHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFD 398
             |.  .|||  ||  |    .. . .. |  | . |.||. |    . |   | .   .
Sbjct: 213 DVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVE-IN 271

Query: 399 GRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIG 458
           |  .| |  .    . .| .   |  |  | | ||  .  |   |. . ||  |||||||
Sbjct: 272 GVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKKKDS-IDPYIYTPFGTGPRNCIG 330

Query: 459 QNFAMNEMKVVIAMTLLKY 477
             ||.  ||. .   |  .
Sbjct: 331 MRFALMNMKLALIRVLQNF 349

>hg18||uc003urx
        |7|NM_057095|Q9HB55|CP343_HUMAN|CYP3A43|NM_057095|NP_476436|cytochrome
        P450, family 3, subfamily A,

          Length = 503

 Score =  111 bits (277), Expect = 2e-024
 Identities = 58/199 (29%), Positives = 106/199 (53%), Gaps = 5/199 (2%)

Query: 283 KRNLDFLDILLFAKD----ENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHP 338
           |  .||   .. ...    .. . | | .. |.    .|  .|||.. . |..| || ||
Sbjct: 266 KHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHP 325

Query: 339 KHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFD 398
             |.  ..||  ||  |  . .. | .. |  | . |.||. | |  ..|   | |   .
Sbjct: 326 DVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIE-IN 384

Query: 399 GRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIG 458
           |  .| |  .   .. .| .   |  |  | | ||  .|      . ..|| ||||||||
Sbjct: 385 GVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFSKKNKDSIDLYRYIPFGAGPRNCIG 444

Query: 459 QNFAMNEMKVVIAMTLLKY 477
             ||.  .|. .   |  .
Sbjct: 445 MRFALTNIKLAVIRALQNF 463

>hg18||uc001ygo
        |14|NM_006668|Q9Y6A2|CP46A_HUMAN|CYP46A1|NM_006668|NP_006659|cytochrome
        P450, family 46

          Length = 500

 Score =  110 bits (273), Expect = 7e-024
 Identities = 72/213 (33%), Positives = 116/213 (54%), Gaps = 20/213 (9%)

Query: 287 DFLDILLFAKD--ENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLC 344
           | |  .| |..  .. .||||  .     ||   ||.|.|. ..| .  |.  |.     
Sbjct: 274 DILTQILKAEEGAQDDEGLLDNFV-----TFFIAGHETSANHLAFTVMELSRQPEIVARL 328

Query: 345 RKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPA 404
           . |. .|.  |  .|.||| .. | .  .|||||..||  |  |   .  |  ||  .| 
Sbjct: 329 QAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEE-TLIDGVRVPG 387

Query: 405 GFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMN 464
              .  | . . |  . .|.|  |.| || |   . .|   . ||| | |.|||| ||  
Sbjct: 388 NTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPG--APKPRFTYFPFSLGHRSCIGQQFAQM 445

Query: 465 EMKVVIAMTLLKYE----------LLEEPTLKP 487
           |.|||.|  | . |          | |. ||||
Sbjct: 446 EVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKP 478

>hg18||uc003ury
        |7|NM_022820|Q9HB55-2|Q9HB55-2|CYP3A43|NM_022820|NP_073731|cytochrome
        P450, family 3, subfamily A,

          Length = 504

 Score =  107 bits (266), Expect = 4e-023
 Identities = 58/200 (29%), Positives = 106/200 (53%), Gaps = 6/200 (3%)

Query: 283 KRNLDFLDILLFAKD----ENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHP 338
           |  .||   .. ...    .. . | | .. |.    .|  .|||.. . |..| || ||
Sbjct: 266 KHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHP 325

Query: 339 KHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFD 398
             |.  ..||  ||  |  . .. | .. |  | . |.||. | |  ..|   | |   .
Sbjct: 326 DVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIE-IN 384

Query: 399 GRTLPAGFRIGTSVFGIHRNASIWENPNVFDP-LRFLPENISKRPPHAFVPFSAGPRNCI 457
           |  .| |  .   .. .| .   |  |  | |  ||  .|      . ..|| |||||||
Sbjct: 385 GVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCI 444

Query: 458 GQNFAMNEMKVVIAMTLLKY 477
           |  ||.  .|. .   |  .
Sbjct: 445 GMRFALTNIKLAVIRALQNF 464

>hg18||uc003vvh
        |7|AK223466|Q53F23|Q53F23_HUMAN|TBXAS1|NM_001061|NP_001052|thromboxane
        A synthase 1 (platelet, cytochrome

          Length = 534

 Score =  94 bits (231), Expect = 5e-019
 Identities = 55/203 (27%), Positives = 102/203 (50%), Gaps = 4/203 (1%)

Query: 306 EDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDWEDLNK 365
           ..|  .   |.  |..   . .||  | || .|  |.   .|.          ..  | .
Sbjct: 330 DEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEE 389

Query: 366 -IPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNASIWEN 424
            .||  | | |.|||.||    .|.  .      |. .|||  .  .|  .| .   | .
Sbjct: 390 GLPYLDMVIAETLRMYPPAFRFTREAAQDCEVL-GQRIPAGAVLEMAVGALHHDPEHWPS 448

Query: 425 PNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTL--LKYELLEE 482
           |  |.| ||  |   .  |  ..|| ||||.|.|    . |.|. .   |   ...   |
Sbjct: 449 PETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPE 508

Query: 483 PTLKPKIIPRLVLRSLNGIHIKI 505
             .  ..  .  |   ||..|||
Sbjct: 509 TQVPLQLESKSALGPKNGVYIKI 531

>hg18||uc003vvi
        |7|NM_001061|Q53F23|Q53F23_HUMAN|TBXAS1|NM_001061|NP_001052|thromboxane
        A synthase 1 (platelet, cytochrome

          Length = 534

 Score =  94 bits (231), Expect = 5e-019
 Identities = 55/203 (27%), Positives = 102/203 (50%), Gaps = 4/203 (1%)

Query: 306 EDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDWEDLNK 365
           ..|  .   |.  |..   . .||  | || .|  |.   .|.          ..  | .
Sbjct: 330 DEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEE 389

Query: 366 -IPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNASIWEN 424
            .||  | | |.|||.||    .|.  .      |. .|||  .  .|  .| .   | .
Sbjct: 390 GLPYLDMVIAETLRMYPPAFRFTREAAQDCEVL-GQRIPAGAVLEMAVGALHHDPEHWPS 448

Query: 425 PNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTL--LKYELLEE 482
           |  |.| ||  |   .  |  ..|| ||||.|.|    . |.|. .   |   ...   |
Sbjct: 449 PETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPE 508

Query: 483 PTLKPKIIPRLVLRSLNGIHIKI 505
             .  ..  .  |   ||..|||
Sbjct: 509 TQVPLQLESKSALGPKNGVYIKI 531

>hg18||uc001mlo |11|CR600246|NA|NA|CYP2R1|NA|NA|Homo sapiens cDNA FLJ35265 fis,
        clone PROST2005039, weakly similar to CYTOCHROME P450 2J2 (EC
        1.14.14.1)

          Length = 268

 Score =  93 bits (230), Expect = 6e-019
 Identities = 60/207 (28%), Positives = 100/207 (48%), Gaps = 2/207 (0%)

Query: 288 FLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKE 347
           .|| .   |..       |..   |   .  | .|| . . . .  .| .|  |   .||
Sbjct:  47 YLDEMDQGKNDPSSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKE 106

Query: 348 IMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVP-GISRKTTKPITFFDGRTLPAGF 406
           |  ..       |.|  |.|||   . | ||    || ||   |..      | ..| | 
Sbjct: 107 IDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSED-AVVRGYSIPKGT 165

Query: 407 RIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEM 466
            . |... .| .   | .| || | |||  .       | |||| | |.|.|.. |  ||
Sbjct: 166 TVITNLYSVHFDEKYWRDPEVFHPERFLDSSGYFAKKEALVPFSLGRRHCLGEHLARMEM 225

Query: 467 KVVIAMTLLKYELLEEPTLKPKIIPRL 493
            .     | .. |     | | . |||
Sbjct: 226 FLFFTALLQRFHLHFPHELVPDLKPRL 252

>hg18||uc001mlp
        |11|BC052580|Q2M3H3|Q2M3H3_HUMAN|CYP2R1|NM_024514|NP_078790|cytochrome
        P450, family 2, subfamily R,

          Length = 384

 Score =  93 bits (230), Expect = 6e-019
 Identities = 60/207 (28%), Positives = 100/207 (48%), Gaps = 2/207 (0%)

Query: 288 FLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKE 347
           .|| .   |..       |..   |   .  | .|| . . . .  .| .|  |   .||
Sbjct: 163 YLDEMDQGKNDPSSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKE 222

Query: 348 IMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVP-GISRKTTKPITFFDGRTLPAGF 406
           |  ..       |.|  |.|||   . | ||    || ||   |..      | ..| | 
Sbjct: 223 IDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSED-AVVRGYSIPKGT 281

Query: 407 RIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEM 466
            . |... .| .   | .| || | |||  .       | |||| | |.|.|.. |  ||
Sbjct: 282 TVITNLYSVHFDEKYWRDPEVFHPERFLDSSGYFAKKEALVPFSLGRRHCLGEHLARMEM 341

Query: 467 KVVIAMTLLKYELLEEPTLKPKIIPRL 493
            .     | .. |     | | . |||
Sbjct: 342 FLFFTALLQRFHLHFPHELVPDLKPRL 368

>hg18||uc001mlr
        |11|NM_024514|Q6VVX0|CP2R1_HUMAN|CYP2R1|NM_024514|NP_078790|cytochrome
        P450, family 2, subfamily R,

          Length = 501

 Score =  93 bits (230), Expect = 6e-019
 Identities = 60/207 (28%), Positives = 100/207 (48%), Gaps = 2/207 (0%)

Query: 288 FLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKE 347
           .|| .   |..       |..   |   .  | .|| . . . .  .| .|  |   .||
Sbjct: 280 YLDEMDQGKNDPSSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKE 339

Query: 348 IMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVP-GISRKTTKPITFFDGRTLPAGF 406
           |  ..       |.|  |.|||   . | ||    || ||   |..      | ..| | 
Sbjct: 340 IDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSED-AVVRGYSIPKGT 398

Query: 407 RIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEM 466
            . |... .| .   | .| || | |||  .       | |||| | |.|.|.. |  ||
Sbjct: 399 TVITNLYSVHFDEKYWRDPEVFHPERFLDSSGYFAKKEALVPFSLGRRHCLGEHLARMEM 458

Query: 467 KVVIAMTLLKYELLEEPTLKPKIIPRL 493
            .     | .. |     | | . |||
Sbjct: 459 FLFFTALLQRFHLHFPHELVPDLKPRL 485

>hg18||uc002xwu
        |20|AY858838|Q5I2W7|Q5I2W7_HUMAN|CYP24A1|NM_000782|NP_000773|cytochrome
        P450, family 24 precursor

          Length = 372

 Score =  89 bits (219), Expect = 1e-017
 Identities = 58/183 (31%), Positives = 92/183 (50%), Gaps = 6/183 (3%)

Query: 299 NQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTM 358
           .|  |  ... | |        .|||. . ..||||. .|. |.   |||  ||      
Sbjct: 165 HQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVP 224

Query: 359 DWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPAG--FRIGTSVFGIH 416
             |||  .||   |.|||.|. | ||  . .|    |      || |    . | | |  
Sbjct: 225 RAEDLRNMPYLKACLKESMRLTPSVP-FTTRTLDKATVLGEYALPKGTVLMLNTQVLG-- 281

Query: 417 RNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTLLK 476
            .   .|. . | | |.| |   |  | | .||  | | |||.  |  .. . .   . |
Sbjct: 282 SSEDNFEDSSQFRPERWLQEK-EKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRK 340

Query: 477 YEL 479
           |..
Sbjct: 341 YDI 343

>hg18||uc002xwv
        |20|NM_000782|Q07973|CP24A_HUMAN|CYP24A1|NM_000782|NP_000773|cytochrome
        P450, family 24 precursor

          Length = 514

 Score =  89 bits (219), Expect = 1e-017
 Identities = 58/183 (31%), Positives = 92/183 (50%), Gaps = 6/183 (3%)

Query: 299 NQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTM 358
           .|  |  ... | |        .|||. . ..||||. .|. |.   |||  ||      
Sbjct: 307 HQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVP 366

Query: 359 DWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPAG--FRIGTSVFGIH 416
             |||  .||   |.|||.|. | ||  . .|    |      || |    . | | |  
Sbjct: 367 RAEDLRNMPYLKACLKESMRLTPSVP-FTTRTLDKATVLGEYALPKGTVLMLNTQVLG-- 423

Query: 417 RNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTLLK 476
            .   .|. . | | |.| |   |  | | .||  | | |||.  |  .. . .   . |
Sbjct: 424 SSEDNFEDSSQFRPERWLQEK-EKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRK 482

Query: 477 YEL 479
           |..
Sbjct: 483 YDI 485

>hg18||uc001kik
        |10|NM_057157|Q5VXH9|Q5VXH9_HUMAN|CYP26A1|NM_057157|NP_476498|cytochrom
        e P450, family 26, subfamily A,

          Length = 428

 Score =  87 bits (213), Expect = 6e-017
 Identities = 58/190 (30%), Positives = 98/190 (51%), Gaps = 12/190 (6%)

Query: 287 DFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPK-----HQ 341
           | | .|.    |  . |  . ..      .| ||.||||  . |.  |  .|       .
Sbjct: 200 DALQLLIEHSWERGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVRE 259

Query: 342 KLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRT 401
           .|  | ..   .  . .| | | .. |    |||.||..|||||  |   |     .|  
Sbjct: 260 ELKSKGLLCKSNQDNKLDMEILEQLKYIGCVIKETLRLNPPVPGGFRVALKTFE-LNGYQ 318

Query: 402 LPAGFRIGTSVFGIHRNASIWENPNVFDPLRFL---PENISKRPPHAFVPFSAGPRNCIG 458
           .| |. .  |.   |  | |. |   |.| ||.   ||. |.    .|.||  | |.|.|
Sbjct: 319 IPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFMLPHPEDASR---FSFIPFGGGLRSCVG 375

Query: 459 QNFAMNEMKV 468
           . ||   .|.
Sbjct: 376 KEFAKILLKI 385

>hg18||uc001kil
        |10|NM_000783|Q5VXI0|Q5VXI0_HUMAN|CYP26A1|NM_000783|NP_000774|cytochrom
        e P450, family 26, subfamily A,

          Length = 497

 Score =  87 bits (213), Expect = 6e-017
 Identities = 58/190 (30%), Positives = 98/190 (51%), Gaps = 12/190 (6%)

Query: 287 DFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPK-----HQ 341
           | | .|.    |  . |  . ..      .| ||.||||  . |.  |  .|       .
Sbjct: 269 DALQLLIEHSWERGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVRE 328

Query: 342 KLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRT 401
           .|  | ..   .  . .| | | .. |    |||.||..|||||  |   |     .|  
Sbjct: 329 ELKSKGLLCKSNQDNKLDMEILEQLKYIGCVIKETLRLNPPVPGGFRVALKTFE-LNGYQ 387

Query: 402 LPAGFRIGTSVFGIHRNASIWENPNVFDPLRFL---PENISKRPPHAFVPFSAGPRNCIG 458
           .| |. .  |.   |  | |. |   |.| ||.   ||. |.    .|.||  | |.|.|
Sbjct: 388 IPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFMLPHPEDASR---FSFIPFGGGLRSCVG 444

Query: 459 QNFAMNEMKV 468
           . ||   .|.
Sbjct: 445 KEFAKILLKI 454

>hg18||uc001kim |10|CR604765|NA|NA|CYP26A1|NA|NA|Homo sapiens retinoic acid
        hydroxylase mRNA, complete cds

          Length = 395

 Score =  87 bits (213), Expect = 6e-017
 Identities = 58/190 (30%), Positives = 98/190 (51%), Gaps = 12/190 (6%)

Query: 287 DFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPK-----HQ 341
           | | .|.    |  . |  . ..      .| ||.||||  . |.  |  .|       .
Sbjct: 167 DALQLLIEHSWERGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVRE 226

Query: 342 KLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRT 401
           .|  | ..   .  . .| | | .. |    |||.||..|||||  |   |     .|  
Sbjct: 227 ELKSKGLLCKSNQDNKLDMEILEQLKYIGCVIKETLRLNPPVPGGFRVALKTFE-LNGYQ 285

Query: 402 LPAGFRIGTSVFGIHRNASIWENPNVFDPLRFL---PENISKRPPHAFVPFSAGPRNCIG 458
           .| |. .  |.   |  | |. |   |.| ||.   ||. |.    .|.||  | |.|.|
Sbjct: 286 IPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFMLPHPEDASR---FSFIPFGGGLRSCVG 342

Query: 459 QNFAMNEMKV 468
           . ||   .|.
Sbjct: 343 KEFAKILLKI 352

>hg18||uc003ulm
        |7|NM_000786|Q16850|CP51A_HUMAN|CYP51A1|NM_000786|NP_000777|cytochrome
        P450, family 51

          Length = 509

 Score =  82 bits (200), Expect = 2e-015
 Identities = 56/193 (29%), Positives = 92/193 (47%), Gaps = 2/193 (1%)

Query: 287 DFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRK 346
           | |  || |  .. . | |...   .   .  |  |...  ... . ||     || |  
Sbjct: 286 DILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYL 345

Query: 347 EIMQVL-HGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPAG 405
           |   |       . .. |  .     ||||.||. ||.  . |    | |   | |.| |
Sbjct: 346 EQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQT-VAGYTIPPG 404

Query: 406 FRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNE 465
            ..  |     |    |     |.| |.| .| .     |.||| ||   |||.|||  .
Sbjct: 405 HQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQ 464

Query: 466 MKVVIAMTLLKYE 478
           .| . .  |  ||
Sbjct: 465 IKTIWSTMLRLYE 477

>hg18||uc003uln
        |7|AK091323|Q16850|CP51A_HUMAN|CYP51A1|NM_000786|NP_000777|cytochrome
        P450, family 51

          Length = 446

 Score =  82 bits (200), Expect = 2e-015
 Identities = 56/193 (29%), Positives = 92/193 (47%), Gaps = 2/193 (1%)

Query: 287 DFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRK 346
           | |  || |  .. . | |...   .   .  |  |...  ... . ||     || |  
Sbjct: 223 DILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYL 282

Query: 347 EIMQVL-HGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPAG 405
           |   |       . .. |  .     ||||.||. ||.  . |    | |   | |.| |
Sbjct: 283 EQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQT-VAGYTIPPG 341

Query: 406 FRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNE 465
            ..  |     |    |     |.| |.| .| .     |.||| ||   |||.|||  .
Sbjct: 342 HQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQ 401

Query: 466 MKVVIAMTLLKYE 478
           .| . .  |  ||
Sbjct: 402 IKTIWSTMLRLYE 414

>hg18||uc002sih
        |2|NM_019885|Q9NR63|CP26B_HUMAN|CYP26B1|NM_019885|NP_063938|cytochrome
        P450, family 26, subfamily b,

          Length = 512

 Score =  81 bits (199), Expect = 3e-015
 Identities = 65/233 (27%), Positives = 113/233 (48%), Gaps = 11/233 (4%)

Query: 281 QAKRNLDFLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKH 340
           | |  || ||.|. .  |. . .  ....      .|  . ||||  . |.  |  ||  
Sbjct: 259 QGKDYLDALDLLIESSKEHGKEMTMQELKDGTLELIFAAYATTASASTSLIMQLLKHPTV 318

Query: 341 QKLCRKEIMQ--VLHG-----KDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKP 393
            .  | |.    .||      . |.  . |. . |    ||| .|.  |. |   .|   
Sbjct: 319 LEKLRDELRAHGILHSGGCPCEGTLRLDTLSGLRYLDCVIKEVMRLFTPISG-GYRTVLQ 377

Query: 394 ITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRF-LPENISKRPPHAFVPFSAG 452
               ||  .| |. .  |.   |  | .... ||||| ||    .  |     ..||  |
Sbjct: 378 TFELDGFQIPKGWSVMYSIRDTHDTAPVFKDVNVFDPDRFSQARSEDKDGRFHYLPFGGG 437

Query: 453 PRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLK-PKIIPRLVLRSLNGIHIK 504
            | |.|.. |   .| |.|. |      |  |   |.|    ||  ..|. .|
Sbjct: 438 VRTCLGKHLAKLFLK-VLAVELASTSRFELATRTFPRITLVPVLHPVDGLSVK 489

>hg18||uc003bce
        |22|NM_000106|Q6NWU0|Q6NWU0_HUMAN|CYP2D6|NM_000106|NP_000097|cytochrome
        P450, family 2, subfamily D,

          Length = 497

 Score =  80 bits (195), Expect = 7e-015
 Identities = 59/202 (29%), Positives = 98/202 (48%), Gaps = 3/202 (1%)

Query: 288 FLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKE 347
           ||  .  ||   .    ||..   |      |  ||.. ... |  .  ||  |.  ..|
Sbjct: 275 FLAEMEKAKGNPESSFNDENLCIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQE 334

Query: 348 IMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVP-GISRKTTKPITFFDGRTLPAGF 406
           |  |.      .  |   .||||  | |  |    || |..  |.. |    |  .| | 
Sbjct: 335 IDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIE-VQGFRIPKGT 393

Query: 407 RIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEM 466
            . |..  . .. ..|| |  | |  ||        | ||.||||| | |.|.  |  |.
Sbjct: 394 TLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMEL 453

Query: 467 KVVIAMTLLKYELLEEPTLKPK 488
             .   .||..     || .|.
Sbjct: 454 -FLFFTSLLQHFSFSVPTGQPR 474

>hg18||uc003bcf
        |22|NM_001025161|Q6NXU8|Q6NXU8_HUMAN|CYP2D6|NM_001025161|NP_001020332|c
        ytochrome P450, family 2, subfamily D,

          Length = 446

 Score =  80 bits (195), Expect = 7e-015
 Identities = 59/202 (29%), Positives = 98/202 (48%), Gaps = 3/202 (1%)

Query: 288 FLDILLFAKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKE 347
           ||  .  ||   .    ||..   |      |  ||.. ... |  .  ||  |.  ..|
Sbjct: 224 FLAEMEKAKGNPESSFNDENLCIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQE 283

Query: 348 IMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVP-GISRKTTKPITFFDGRTLPAGF 406
           |  |.      .  |   .||||  | |  |    || |..  |.. |    |  .| | 
Sbjct: 284 IDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIE-VQGFRIPKGT 342

Query: 407 RIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFAMNEM 466
            . |..  . .. ..|| |  | |  ||        | ||.||||| | |.|.  |  |.
Sbjct: 343 TLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMEL 402

Query: 467 KVVIAMTLLKYELLEEPTLKPK 488
             .   .||..     || .|.
Sbjct: 403 -FLFFTSLLQHFSFSVPTGQPR 423

>hg18||uc003sjq
        |7|NM_017781|Q8TAV3|CP2W1_HUMAN|CYP2W1|NM_017781|NP_060251|cytochrome
        P450, family 2, subfamily W,

          Length = 490

 Score =  77 bits (189), Expect = 4e-014
 Identities = 51/169 (30%), Positives = 81/169 (47%), Gaps = 1/169 (0%)

Query: 319 GHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLR 378
           | .||.. . .    .  ||  |   ..|. .||    |   ||   .|||.  . |  |
Sbjct: 297 GTETTSATLQWAALLMGRHPDVQGRVQEELDRVLGPGRTPRLEDQQALPYTSAVLHEVQR 356

Query: 379 MHPPVPGISRKTTKPITFFDGRTLPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENI 438
               .| . | |    |   |  || |  .   .  .  . . |. |  |.|  ||  | 
Sbjct: 357 FITLLPHVPRCTAAD-TQLGGFLLPKGTPVIPLLTSVLLDETQWQTPGQFNPGHFLDANG 415

Query: 439 SKRPPHAFVPFSAGPRNCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKP 487
                 ||.||||| | |.|.  |  |. .. |  | .| ||  | . |
Sbjct: 416 HFVKREAFLPFSAGRRVCVGERLARTELFLLFAGLLQRYRLLPPPGVSP 464

>hg18||uc001kkb
        |10|NM_000770|P10632|CP2C8_HUMAN|CYP2C8|NM_000770|NP_000761|cytochrome
        P450, family 2, subfamily C,

          Length = 490

 Score =  75 bits (182), Expect = 2e-013
 Identities = 57/205 (27%), Positives = 91/205 (44%), Gaps = 6/205 (2%)

Query: 287 DFLDILLF----AKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQK 342
           ||.|  |      ||  .     |..   |      | .||.. . . |  |  ||.   
Sbjct: 262 DFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTA 321

Query: 343 LCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVP-GISRKTTKPITFFDGRT 401
             ..||  |.    .   .| . .|||   . |  |    || |.    |   | |    
Sbjct: 322 KVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTD-TKFRNYL 380

Query: 402 LPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNF 461
           .| |  |   .  .  .   . |||.|||  || .| . .    |.||||| | | |.  
Sbjct: 381 IPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGL 440

Query: 462 AMNEMKVVIAMTLLKYELLEEPTLK 486
           |  |. . .   |  . |     ||
Sbjct: 441 ARMELFLFLTTILQNFNLKSVDDLK 465

>hg18||uc002opl
        |19|NM_000762|P11509|CP2A6_HUMAN|CYP2A6|NM_000762|NP_000753|cytochrome
        P450, family 2, subfamily A,

          Length = 494

 Score =  75 bits (182), Expect = 2e-013
 Identities = 54/198 (27%), Positives = 87/198 (43%), Gaps = 6/198 (3%)

Query: 287 DFLDILLF-----AKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQ 341
           ||.|  |       |. | .  |   .   .. |.  | .| .. . .    |  ||. .
Sbjct: 266 DFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFI-GGTETVSTTLRYGFLLLMKHPEVE 324

Query: 342 KLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRT 401
               .|| .|.       .||  |.||    | |  |    .|    .  |  | |    
Sbjct: 325 AKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFF 384

Query: 402 LPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNF 461
           || |  .   .  . |. | . ||  |.|  || |    .   |||||| | ||| |.  
Sbjct: 385 LPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGL 444

Query: 462 AMNEMKVVIAMTLLKYEL 479
           |  |. .     .  . |
Sbjct: 445 ARMELFLFFTTVMQNFRL 462

>hg18||uc002opm
        |19|NM_000764|P20853|CP2A7_HUMAN|CYP2A7|NM_000764|NP_000755|cytochrome
        P450, family 2, subfamily A,

          Length = 494

 Score =  75 bits (182), Expect = 2e-013
 Identities = 53/198 (26%), Positives = 88/198 (44%), Gaps = 6/198 (3%)

Query: 287 DFLDILLF-----AKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQ 341
           ||.|  |       |. | .  |   . . .. |.  | .| .. . .    |  ||. .
Sbjct: 266 DFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI-AGTETVSTTLRYGFLLLMKHPEVE 324

Query: 342 KLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRT 401
               .|| .|.       .||  |.||    | |  |    .|    .  |  | |    
Sbjct: 325 AKVHEEIDRVIGKNRQPKFEDRTKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFF 384

Query: 402 LPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNF 461
           || |  .   .  . |. | . ||  |.|  || .    .   |||||| | ||| |.  
Sbjct: 385 LPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDKGQFKKSDAFVPFSIGKRNCFGEGL 444

Query: 462 AMNEMKVVIAMTLLKYEL 479
           |  |. .     .  . |
Sbjct: 445 ARMELFLFFTTVMQNFRL 462

>hg18||uc002opn
        |19|NM_030589|P20853|CP2A7_HUMAN|CYP2A7|NM_030589|NP_085079|cytochrome
        P450, family 2, subfamily A,

          Length = 443

 Score =  75 bits (182), Expect = 2e-013
 Identities = 53/198 (26%), Positives = 88/198 (44%), Gaps = 6/198 (3%)

Query: 287 DFLDILLF-----AKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQ 341
           ||.|  |       |. | .  |   . . .. |.  | .| .. . .    |  ||. .
Sbjct: 215 DFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI-AGTETVSTTLRYGFLLLMKHPEVE 273

Query: 342 KLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRT 401
               .|| .|.       .||  |.||    | |  |    .|    .  |  | |    
Sbjct: 274 AKVHEEIDRVIGKNRQPKFEDRTKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFF 333

Query: 402 LPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNF 461
           || |  .   .  . |. | . ||  |.|  || .    .   |||||| | ||| |.  
Sbjct: 334 LPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDKGQFKKSDAFVPFSIGKRNCFGEGL 393

Query: 462 AMNEMKVVIAMTLLKYEL 479
           |  |. .     .  . |
Sbjct: 394 ARMELFLFFTTVMQNFRL 411

>hg18||uc002opo
        |19|U22029|P20853|CP2A7_HUMAN|CYP2A7|NM_000764|NP_000755|cytochrome
        P450, family 2, subfamily A,

          Length = 494

 Score =  75 bits (182), Expect = 2e-013
 Identities = 53/198 (26%), Positives = 88/198 (44%), Gaps = 6/198 (3%)

Query: 287 DFLDILLF-----AKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQ 341
           ||.|  |       |. | .  |   . . .. |.  | .| .. . .    |  ||. .
Sbjct: 266 DFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI-AGTETVSTTLRYGFLLLMKHPEVE 324

Query: 342 KLCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRT 401
               .|| .|.       .||  |.||    | |  |    .|    .  |  | |    
Sbjct: 325 AKVHEEIDRVIGKNRQPKFEDRTKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFF 384

Query: 402 LPAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNF 461
           || |  .   .  . |. | . ||  |.|  || .    .   |||||| | ||| |.  
Sbjct: 385 LPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDKGQFKKSDAFVPFSIGKRNCFGEGL 444

Query: 462 AMNEMKVVIAMTLLKYEL 479
           |  |. .     .  . |
Sbjct: 445 ARMELFLFFTTVMQNFRL 462

>hg18||uc001kjy
        |10|NM_000769|P33261|CP2CJ_HUMAN|CYP2C19|NM_000769|NP_000760|cytochrome
        P450, family 2, subfamily C,

          Length = 490

 Score =  73 bits (178), Expect = 7e-013
 Identities = 51/197 (25%), Positives = 86/197 (43%), Gaps = 4/197 (2%)

Query: 287 DFLDILLF----AKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQK 342
           ||.|  |      |   |     |..       .  | .||.. . . |  |  ||.   
Sbjct: 262 DFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTA 321

Query: 343 LCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTL 402
             ..|| .|.    .   .|   .|||   . |  |    .|            |    .
Sbjct: 322 KVQEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLI 381

Query: 403 PAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFA 462
           | |  | ||.  .  .   . || .|||  || |  . .  . |.||||| | |.|.  |
Sbjct: 382 PKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLA 441

Query: 463 MNEMKVVIAMTLLKYEL 479
             |. . .   |  . |
Sbjct: 442 RMELFLFLTFILQNFNL 458

>hg18||uc001kjx
        |10|L07093|P33261|CP2CJ_HUMAN|CYP2C19|NM_000769|NP_000760|cytochrome
        P450, family 2, subfamily C,

          Length = 468

 Score =  73 bits (177), Expect = 9e-013
 Identities = 51/197 (25%), Positives = 86/197 (43%), Gaps = 4/197 (2%)

Query: 287 DFLDILLF----AKDENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQK 342
           ||.|  |      |   |     |..       .  | .||.. . . |  |  ||.   
Sbjct: 240 DFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTA 299

Query: 343 LCRKEIMQVLHGKDTMDWEDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTL 402
             ..|| .|.    .   .|   .|||   . |  |    .|            |    .
Sbjct: 300 KVQEEIERVVGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLI 359

Query: 403 PAGFRIGTSVFGIHRNASIWENPNVFDPLRFLPENISKRPPHAFVPFSAGPRNCIGQNFA 462
           | |  | ||.  .  .   . || .|||  || |  . .  . |.||||| | |.|.  |
Sbjct: 360 PKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLA 419

Query: 463 MNEMKVVIAMTLLKYEL 479
             |. . .   |  . |
Sbjct: 420 RMELFLFLTFILQNFNL 436

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0