BLASTP 7.6.0


Query=fugu4_571864 |jgi|Takru4|571864|e_gw2.196.49.1
        (187 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002nxp |19|NM_001037|Q07699|SCN1B_HUMAN|SCN1B|NM_001037|...    151   4e-037
hg18||uc001pza |11|NM_001040151|Q9NY72|SCN3B_HUMAN|SCN3B|NM_0010...    139   2e-033
hg18||uc001pzb |11|NM_018400|Q9NY72|SCN3B_HUMAN|SCN3B|NM_018400|...    139   2e-033
hg18||uc002nxo |19|NM_199037|Q6TN97|Q6TN97_HUMAN|SCN1B|NM_199037...    106   3e-023
hg18||uc001psn |11|NM_005797|O60487|EVA1_HUMAN|EVA1|NM_005797|NP...     54   1e-007
hg18||uc001pso |11|NM_144765|O60487|EVA1_HUMAN|EVA1|NM_144765|NP...     54   1e-007
hg18||uc001psp |11|CR590568|O60487|EVA1_HUMAN|EVA1|NM_144765|NP_...     54   1e-007
hg18||uc001psm |11|NM_198275|Q6UWV2|Q6UWV2_HUMAN|LOC196264|NM_19...     53   2e-007
hg18||uc001gaf |1|NM_000530|P25189|MYP0_HUMAN|MPZ|NM_000530|NP_0...     51   8e-007
hg18||uc003bot |3|NM_006614|O00533-2|O00533-2|CHL1|NM_006614|NP_...     34   0.104
hg18||uc003bou |3|AB209329|O00533|CHL1_HUMAN|CHL1|NM_006614|NP_0...     34   0.104
hg18||uc003bow |3|AK126878|O00533|CHL1_HUMAN|CHL1|NM_006614|NP_0...     34   0.104
hg18||uc002wfg |20|AK095499|Q5JXA9|Q5JXA9_HUMAN|PTPN1L|NA|NA|OTT...     29   2.557
hg18||uc002ykh |21|AY072912|P78310-5|P78310-5|CXADR|NA|NA|Coxsac...     29   2.557
hg18||uc002yki |21|NM_001338|P78310|CXAR_HUMAN|CXADR|NM_001338|N...     29   2.557
hg18||uc002ykj |21|CR617256|P78310-2|P78310-2|CXADR|NM_001338|NP...     29   2.557
hg18||uc003lrl |5|BC047521|P07333|CSF1R_HUMAN|CSF1R|NM_005211|NP...     29   3.339
hg18||uc003lrm |5|NM_005211|P07333|CSF1R_HUMAN|CSF1R|NM_005211|N...     29   3.339
hg18||uc002ori |19|NM_006890|Q14002|CEAM7_HUMAN|CEACAM7|NM_00689...     28   4.361
hg18||uc003nib |6|NM_007049|Q7KYR7-2|Q7KYR7-2|BTN2A1|NM_007049|N...     28   4.361
hg18||uc003nic |6|NM_078476|Q96AV7|Q96AV7_HUMAN|BTN2A1|NM_078476...     28   4.361

>hg18||uc002nxp
        |19|NM_001037|Q07699|SCN1B_HUMAN|SCN1B|NM_001037|NP_001028|sodium
        channel, voltage-gated, type I, beta

          Length = 218

 Score =  151 bits (381), Expect = 4e-037
 Identities = 74/172 (43%), Positives = 111/172 (64%), Gaps = 2/172 (1%)

Query:   4 GGCAEVDSLTEAVVGEGFRLGCISCKRREEVSAQATVDWHFRPLGEEDFMHIFHYDHPSA 63
           ||| |||| |||| |  |.. ||||||| | .|.   .| ||  | |.|. |  |..   
Sbjct:  19 GGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVL 78

Query:  64 EILH-KNFSNRLEWHGT-PDRDVQTASIYIHNITYNDIGTYRCTIQRTLHLPRDDEHVTV 121
           ..   . |  |. |.|.   .|.|  ||.| |.|||  | | | . | |     . . .|
Sbjct:  79 QLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSV 138

Query: 122 EKQVELNVVAEAHPELTTVVSEIMMYVLIVTLQLWLVAILVHCYKKTSKEYE 173
            |.. . || .|. .. ..||||||||||| | .|||| ...|||| .   |
Sbjct: 139 VKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMIYCYKKIAAATE 190

>hg18||uc001pza
        |11|NM_001040151|Q9NY72|SCN3B_HUMAN|SCN3B|NM_001040151|NP_001035241|vol
        tage-gated sodium channel beta-3 subunit

          Length = 215

 Score =  139 bits (349), Expect = 2e-033
 Identities = 73/172 (42%), Positives = 101/172 (58%), Gaps = 4/172 (2%)

Query:   2 CQGGCAEVDSLTEAVVGEGFRLGCISCKRREEVSAQATVDWHFRPLGEEDFMHIFHYDHP 61
           |   | || | |||| |   .| |||| .|||| |   |.| .|| | .||. |. | . 
Sbjct:  22 CFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFL-IYEYRNG 80

Query:  62 SAEILHKNFSNRLEWHGTPDRDVQTASIYIHNITYNDIGTYRCTIQRTLHLPRDDEHVTV 121
             |.    |  ||.|.|.  .|.|  || . |.| || | | | . |          |  
Sbjct:  81 HQEV-ESPFQGRLQWNGS--KDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKT 137

Query: 122 EKQVELNVVAEAHPELTTVVSEIMMYVLIVTLQLWLVAILVHCYKKTSKEYE 173
            . . | |  ||  . |.||||||||.|.| | |||.  ...||.| ||  |
Sbjct: 138 TRLIPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYCYRKVSKAEE 189

>hg18||uc001pzb
        |11|NM_018400|Q9NY72|SCN3B_HUMAN|SCN3B|NM_018400|NP_060870|voltage-gate
        d sodium channel beta-3 subunit

          Length = 215

 Score =  139 bits (349), Expect = 2e-033
 Identities = 73/172 (42%), Positives = 101/172 (58%), Gaps = 4/172 (2%)

Query:   2 CQGGCAEVDSLTEAVVGEGFRLGCISCKRREEVSAQATVDWHFRPLGEEDFMHIFHYDHP 61
           |   | || | |||| |   .| |||| .|||| |   |.| .|| | .||. |. | . 
Sbjct:  22 CFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFL-IYEYRNG 80

Query:  62 SAEILHKNFSNRLEWHGTPDRDVQTASIYIHNITYNDIGTYRCTIQRTLHLPRDDEHVTV 121
             |.    |  ||.|.|.  .|.|  || . |.| || | | | . |          |  
Sbjct:  81 HQEV-ESPFQGRLQWNGS--KDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKT 137

Query: 122 EKQVELNVVAEAHPELTTVVSEIMMYVLIVTLQLWLVAILVHCYKKTSKEYE 173
            . . | |  ||  . |.||||||||.|.| | |||.  ...||.| ||  |
Sbjct: 138 TRLIPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYCYRKVSKAEE 189

>hg18||uc002nxo
        |19|NM_199037|Q6TN97|Q6TN97_HUMAN|SCN1B|NM_199037|NP_950238|sodium
        channel, voltage-gated, type I, beta

          Length = 268

 Score =  106 bits (262), Expect = 3e-023
 Identities = 52/129 (40%), Positives = 78/129 (60%), Gaps = 2/129 (1%)

Query:   4 GGCAEVDSLTEAVVGEGFRLGCISCKRREEVSAQATVDWHFRPLGEEDFMHIFHYDHPSA 63
           ||| |||| |||| |  |.. ||||||| | .|.   .| ||  | |.|. |  |..   
Sbjct:  19 GGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVL 78

Query:  64 EILH-KNFSNRLEWHGT-PDRDVQTASIYIHNITYNDIGTYRCTIQRTLHLPRDDEHVTV 121
           ..   . |  |. |.|.   .|.|  ||.| |.|||  | | | . | |     . . .|
Sbjct:  79 QLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSV 138

Query: 122 EKQVELNVV 130
            |.. . ||
Sbjct: 139 VKKIHIEVV 147

>hg18||uc001psn
        |11|NM_005797|O60487|EVA1_HUMAN|EVA1|NM_005797|NP_005788|epithelial
        V-like antigen 1 precursor

          Length = 215

 Score =  54 bits (127), Expect = 1e-007
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 7/96 (7%)

Query:  14 EAVVGEGFRLGCISCKRREEVSAQATVDWHFRPL--GEEDFMHIFHYDHPSAEILHKNFS 71
           ||| |   || | .      |    || |.||||  | | |.  .| |    . .   | 
Sbjct:  36 EAVNGTDARLKC-TFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHID--PFQPMSGRFK 92

Query:  72 NRLEWHGTPDRDVQTASIYIHNITYNDIGTYRCTIQ 107
           .|. | | |.|    ||| .  . ..| ||| | ..
Sbjct:  93 DRVSWDGNPER--YDASILLWKLQFDDNGTYTCQVK 126

>hg18||uc001pso
        |11|NM_144765|O60487|EVA1_HUMAN|EVA1|NM_144765|NP_658911|epithelial
        V-like antigen 1 precursor

          Length = 215

 Score =  54 bits (127), Expect = 1e-007
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 7/96 (7%)

Query:  14 EAVVGEGFRLGCISCKRREEVSAQATVDWHFRPL--GEEDFMHIFHYDHPSAEILHKNFS 71
           ||| |   || | .      |    || |.||||  | | |.  .| |    . .   | 
Sbjct:  36 EAVNGTDARLKC-TFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHID--PFQPMSGRFK 92

Query:  72 NRLEWHGTPDRDVQTASIYIHNITYNDIGTYRCTIQ 107
           .|. | | |.|    ||| .  . ..| ||| | ..
Sbjct:  93 DRVSWDGNPER--YDASILLWKLQFDDNGTYTCQVK 126

>hg18||uc001psp
        |11|CR590568|O60487|EVA1_HUMAN|EVA1|NM_144765|NP_658911|epithelial
        V-like antigen 1 precursor

          Length = 195

 Score =  54 bits (127), Expect = 1e-007
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 7/96 (7%)

Query:  14 EAVVGEGFRLGCISCKRREEVSAQATVDWHFRPL--GEEDFMHIFHYDHPSAEILHKNFS 71
           ||| |   || | .      |    || |.||||  | | |.  .| |    . .   | 
Sbjct:  36 EAVNGTDARLKC-TFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHID--PFQPMSGRFK 92

Query:  72 NRLEWHGTPDRDVQTASIYIHNITYNDIGTYRCTIQ 107
           .|. | | |.|    ||| .  . ..| ||| | ..
Sbjct:  93 DRVSWDGNPER--YDASILLWKLQFDDNGTYTCQVK 126

>hg18||uc001psm
        |11|NM_198275|Q6UWV2|Q6UWV2_HUMAN|LOC196264|NM_198275|NP_938016|hypothe
        tical protein LOC196264

          Length = 235

 Score =  53 bits (126), Expect = 2e-007
 Identities = 34/109 (31%), Positives = 49/109 (44%), Gaps = 7/109 (6%)

Query:  10 DSLTEAVVGEGFRLGCISCKRREEVSAQATVDWHFRPLGEEDFMHIFHYDHPSAEILHKN 69
           |.     |||  .| | . |   .|. . |.|| .||      . ||||           
Sbjct:  37 DAHVRGYVGEKIKLKC-TFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGT 95

Query:  70 FSNRLEWHGTPDRDVQTASIYIHNITYNDIGTYRCTIQRTLHLPRDDEH 118
           | .|. | |   .    ||| | | |  | ||. | ..     | |  |
Sbjct:  96 FRDRISWVGNVYKG--DASISISNPTIKDNGTFSCAVKN----PPDVHH 138

>hg18||uc001gaf |1|NM_000530|P25189|MYP0_HUMAN|MPZ|NM_000530|NP_000521|myelin
        protein zero

          Length = 258

 Score =  51 bits (120), Expect = 8e-007
 Identities = 35/113 (30%), Positives = 49/113 (43%), Gaps = 4/113 (3%)

Query:  10 DSLTEAVVGEGFRLGCISCKRREEVSAQATVDWHFRPLGEEDFMHIFHYDHPSAEILH-K 68
           |      ||    | | |    | ||   .  | ..| |  | . ||||      |    
Sbjct:  45 DREVHGAVGSRVTLHC-SFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVG 103

Query:  69 NFSNRLEWHGTPDRDVQTASIYIHNITYNDIGTYRCTIQRTLHLPRDDEHVTV 121
            |  |..| | |    .  || |||. |.| ||. | ..    .      ||.
Sbjct: 104 TFKERIQWVGDP--RWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTL 154

>hg18||uc003bot |3|NM_006614|O00533-2|O00533-2|CHL1|NM_006614|NP_006605|cell
        adhesion molecule with homology to L1CAM

          Length = 1224

 Score =  34 bits (76), Expect = 0.104
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query:  88 SIYIHNITYNDIGTYRCTIQRTLHLPRDDEHVTVEK 123
           .. | |..| | | ||||    |     | || ||.
Sbjct: 310 TLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEE 345

>hg18||uc003bou |3|AB209329|O00533|CHL1_HUMAN|CHL1|NM_006614|NP_006605|cell
        adhesion molecule with homology to L1CAM

          Length = 1208

 Score =  34 bits (76), Expect = 0.104
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query:  88 SIYIHNITYNDIGTYRCTIQRTLHLPRDDEHVTVEK 123
           .. | |..| | | ||||    |     | || ||.
Sbjct: 294 TLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEE 329

>hg18||uc003bow |3|AK126878|O00533|CHL1_HUMAN|CHL1|NM_006614|NP_006605|cell
        adhesion molecule with homology to L1CAM

          Length = 1112

 Score =  34 bits (76), Expect = 0.104
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query:  88 SIYIHNITYNDIGTYRCTIQRTLHLPRDDEHVTVEK 123
           .. | |..| | | ||||    |     | || ||.
Sbjct: 294 TLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEE 329

>hg18||uc002wfg
        |20|AK095499|Q5JXA9|Q5JXA9_HUMAN|PTPN1L|NA|NA|OTTHUMP00000029984

          Length = 342

 Score =  29 bits (64), Expect = 2.557
 Identities = 11/17 (64%), Positives = 12/17 (70%)

Query:  88 SIYIHNITYNDIGTYRC 104
           ||||||.|    ||| |
Sbjct: 111 SIYIHNVTREHTGTYHC 127

>hg18||uc002ykh |21|AY072912|P78310-5|P78310-5|CXADR|NA|NA|Coxsackievirus and
        adenovirus receptor precursor (Coxsackievirus B- adenovirus receptor)
        (hCAR) (CVB3-binding protein) (HCVADR)

          Length = 251

 Score =  29 bits (64), Expect = 2.557
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query:  87 ASIYIHNITYNDIGTYRCTIQRTLHLPRDDEHVTV 121
           ||| . |.  .|||||.| ...   .     |. |
Sbjct: 103 ASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVV 137

>hg18||uc002yki
        |21|NM_001338|P78310|CXAR_HUMAN|CXADR|NM_001338|NP_001329|coxsackie
        virus and adenovirus receptor

          Length = 365

 Score =  29 bits (64), Expect = 2.557
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query:  87 ASIYIHNITYNDIGTYRCTIQRTLHLPRDDEHVTV 121
           ||| . |.  .|||||.| ...   .     |. |
Sbjct: 103 ASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVV 137

>hg18||uc002ykj
        |21|CR617256|P78310-2|P78310-2|CXADR|NM_001338|NP_001329|coxsackie
        virus and adenovirus receptor

          Length = 325

 Score =  29 bits (64), Expect = 2.557
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query:  87 ASIYIHNITYNDIGTYRCTIQRTLHLPRDDEHVTV 121
           ||| . |.  .|||||.| ...   .     |. |
Sbjct:  76 ASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVV 110

>hg18||uc003lrl |5|BC047521|P07333|CSF1R_HUMAN|CSF1R|NM_005211|NP_005202|colony
        stimulating factor 1 receptor precursor

          Length = 972

 Score =  29 bits (63), Expect = 3.339
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 6/38 (15%)

Query:  74 LEWHGTPD------RDVQTASIYIHNITYNDIGTYRCT 105
           .|| | |        |  .. .  .| |. . ||||||
Sbjct:  48 VEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCT 85

>hg18||uc003lrm |5|NM_005211|P07333|CSF1R_HUMAN|CSF1R|NM_005211|NP_005202|colony
        stimulating factor 1 receptor precursor

          Length = 972

 Score =  29 bits (63), Expect = 3.339
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 6/38 (15%)

Query:  74 LEWHGTPD------RDVQTASIYIHNITYNDIGTYRCT 105
           .|| | |        |  .. .  .| |. . ||||||
Sbjct:  48 VEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCT 85

>hg18||uc002ori
        |19|NM_006890|Q14002|CEAM7_HUMAN|CEACAM7|NM_006890|NP_008821|carcinoemb
        ryonic antigen-related cell adhesion

          Length = 265

 Score =  28 bits (62), Expect = 4.361
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query:  88 SIYIHNITYNDIGTYRCTIQRTLHLPRDDEHVTVEKQVELNVVAEAHPELT--TVVSEIM 145
           .. . . | |||| | | ||  .   | |    |   |    |  . |.|.  | || ||
Sbjct: 200 TLVLLSATKNDIGPYECEIQNPVGASRSD---PVTLNVRYESVQASSPDLSAGTAVS-IM 255

Query: 146 MYVL 149
           . ||
Sbjct: 256 IGVL 259

>hg18||uc003nib
        |6|NM_007049|Q7KYR7-2|Q7KYR7-2|BTN2A1|NM_007049|NP_008980|butyrophilin,
        subfamily 2, member A1 isoform 1

          Length = 527

 Score =  28 bits (62), Expect = 4.361
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query:  86 TASIYIHNITYNDIGTYRCTIQ 107
           . .. |||||  . |||||  |
Sbjct: 107 SVALVIHNITAQENGTYRCYFQ 128

>hg18||uc003nic
        |6|NM_078476|Q96AV7|Q96AV7_HUMAN|BTN2A1|NM_078476|NP_510961|butyrophili
        n, subfamily 2, member A1 isoform 2

          Length = 334

 Score =  28 bits (62), Expect = 4.361
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query:  86 TASIYIHNITYNDIGTYRCTIQ 107
           . .. |||||  . |||||  |
Sbjct: 107 SVALVIHNITAQENGTYRCYFQ 128

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0