BLASTP 7.6.0


Query=fugu4_571776 |jgi|Takru4|571776|e_gw2.97.87.1
        (761 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003mcs |5|NM_030627|Q17RY0|CPEB4_HUMAN|CPEB4|NM_030627|N...    653   4e-187
hg18||uc003gnm |4|BC103941|Q7Z5Q1-6|Q7Z5Q1-6|CPEB2|NM_182646|NP_...    635   9e-182
hg18||uc001khu |10|AK127060|Q8NE35|CPEB3_HUMAN|CPEB3|NM_014912|N...    634   1e-181
hg18||uc003gnk |4|BC103942|Q7Z5Q1|CPEB2_HUMAN|CPEB2|NM_182485|NP...    632   8e-181
hg18||uc003gnl |4|BC103939|Q7Z5Q1-6|Q7Z5Q1-6|CPEB2|NM_182646|NP_...    630   3e-180
hg18||uc001khv |10|AB023157|Q8NE35-2|Q8NE35-2|CPEB3|NM_014912|NP...    629   5e-180
hg18||uc001khw |10|NM_014912|Q8NE35|CPEB3_HUMAN|CPEB3|NM_014912|...    602   7e-172
hg18||uc003mcu |5|BC036899|Q17RY0-3|Q17RY0-3|CPEB4|NM_030627|NP_...    590   2e-168
hg18||uc003mct |5|CR598263|Q17RY0-3|Q17RY0-3|CPEB4|NM_030627|NP_...    590   3e-168
hg18||uc001khw |10|NM_014912|Q8NE35|CPEB3_HUMAN|CPEB3|NM_014912|...    582   9e-166
hg18||uc003gni |4|NM_182485|Q7Z5Q1-2|Q7Z5Q1-2|CPEB2|NM_182485|NP...    552   8e-157
hg18||uc003gnj |4|NM_182646|Q7Z5Q1-5|Q7Z5Q1-5|CPEB2|NM_182646|NP...    552   8e-157
hg18||uc003gnn |4|BC105925|Q7Z5Q1-4|Q7Z5Q1-4|CPEB2|NM_182646|NP_...    552   8e-157
hg18||uc002bip |15|AL832156|NA|NA|CPEB1|NM_001079535|NP_00107300...    211   4e-054
hg18||uc002biq |15|NM_001079534|Q9BZB8-4|Q9BZB8-4|CPEB1|NM_00107...    211   4e-054
hg18||uc002bis |15|NM_001079535|Q9BZB8-4|Q9BZB8-4|CPEB1|NM_00107...    211   4e-054
hg18||uc002biu |15|BX649159|Q9BZB8-3|Q9BZB8-3|CPEB1|NM_030594|NP...    211   4e-054
hg18||uc002biv |15|NM_030594|Q9BZB8-3|Q9BZB8-3|CPEB1|NM_030594|N...    211   4e-054
hg18||uc002bir |15|NM_001079533|Q9BZB8-2|Q9BZB8-2|CPEB1|NM_00107...    205   3e-052
hg18||uc002bit |15|AF329402|Q9BZB8|CPEB1_HUMAN|CPEB1|NM_030594|N...    205   3e-052
hg18||uc003mcs |5|NM_030627|Q17RY0|CPEB4_HUMAN|CPEB4|NM_030627|N...    169   1e-041
hg18||uc003mcs |5|NM_030627|Q17RY0|CPEB4_HUMAN|CPEB4|NM_030627|N...     92   2e-018
hg18||uc003gnj |4|NM_182646|Q7Z5Q1-5|Q7Z5Q1-5|CPEB2|NM_182646|NP...     75   3e-013
hg18||uc003gni |4|NM_182485|Q7Z5Q1-2|Q7Z5Q1-2|CPEB2|NM_182485|NP...     72   2e-012
hg18||uc003gnn |4|BC105925|Q7Z5Q1-4|Q7Z5Q1-4|CPEB2|NM_182646|NP_...     70   9e-012
hg18||uc003gnl |4|BC103939|Q7Z5Q1-6|Q7Z5Q1-6|CPEB2|NM_182646|NP_...     55   4e-007
hg18||uc003gnn |4|BC105925|Q7Z5Q1-4|Q7Z5Q1-4|CPEB2|NM_182646|NP_...     55   4e-007
hg18||uc003gni |4|NM_182485|Q7Z5Q1-2|Q7Z5Q1-2|CPEB2|NM_182485|NP...     54   9e-007
hg18||uc003gnk |4|BC103942|Q7Z5Q1|CPEB2_HUMAN|CPEB2|NM_182485|NP...     54   9e-007
hg18||uc003mct |5|CR598263|Q17RY0-3|Q17RY0-3|CPEB4|NM_030627|NP_...     51   6e-006
hg18||uc003gnj |4|NM_182646|Q7Z5Q1-5|Q7Z5Q1-5|CPEB2|NM_182646|NP...     50   1e-005
hg18||uc003gnm |4|BC103941|Q7Z5Q1-6|Q7Z5Q1-6|CPEB2|NM_182646|NP_...     50   1e-005
hg18||uc002lsl |19|CR608914|Q96EP5|DAZP1_HUMAN|DAZAP1|NM_018959|...     44   9e-004
hg18||uc002lsm |19|NM_170711|Q96EP5-2|Q96EP5-2|DAZAP1|NM_170711|...     44   9e-004
hg18||uc002lsn |19|NM_018959|Q96EP5|DAZP1_HUMAN|DAZAP1|NM_018959...     44   9e-004
hg18||uc002lso |19|CR601549|Q96EP5|DAZP1_HUMAN|DAZAP1|NM_018959|...     44   9e-004
hg18||uc003hmr |4|NM_031372|Q96IM0|Q96IM0_HUMAN|HNRPDL|NM_031372...     43   0.002
hg18||uc003hmt |4|AB066484|O14979|O14979_HUMAN|HNRPDL|NM_031372|...     43   0.002
hg18||uc003mcu |5|BC036899|Q17RY0-3|Q17RY0-3|CPEB4|NM_030627|NP_...     42   0.003
hg18||uc001khv |10|AB023157|Q8NE35-2|Q8NE35-2|CPEB3|NM_014912|NP...     42   0.004
hg18||uc001khw |10|NM_014912|Q8NE35|CPEB3_HUMAN|CPEB3|NM_014912|...     42   0.004
hg18||uc003miu |5|NM_031266|Q99729-2|Q99729-2|HNRPAB|NM_031266|N...     42   0.004
hg18||uc003miv |5|NM_004499|Q99729-3|Q99729-3|HNRPAB|NM_004499|N...     42   0.004
hg18||uc003miw |5|CR609806|Q99729-2|Q99729-2|HNRPAB|NM_031266|NP...     42   0.004
hg18||uc003mix |5|CR590133|Q99729-3|Q99729-3|HNRPAB|NM_004499|NP...     42   0.004
hg18||uc003hmm |4|NM_031370|Q14103|HNRPD_HUMAN|HNRPD|NM_031370|N...     38   0.039
hg18||uc003hmn |4|NM_031369|Q14103-2|Q14103-2|HNRPD|NM_031369|NP...     38   0.039
hg18||uc003hmo |4|NM_002138|Q14103-3|Q14103-3|HNRPD|NM_002138|NP...     38   0.039
hg18||uc003hmp |4|NM_001003810|Q14103-4|Q14103-4|HNRPD|NM_001003...     38   0.039
hg18||uc003hir |4|NM_012297|Q9UN86|G3BP2_HUMAN|G3BP2|NM_012297|N...     38   0.051
hg18||uc003his |4|NM_203505|Q9UN86|G3BP2_HUMAN|G3BP2|NM_203505|N...     38   0.051
hg18||uc003hit |4|NM_203504|Q9UN86-2|Q9UN86-2|G3BP2|NM_203504|NP...     38   0.051
hg18||uc003cba |3|BX648638|Q5HYB4|Q5HYB4_HUMAN|DAZL|NM_001351|NP...     37   0.113
hg18||uc003cbb |3|NM_001351|Q92904|DAZL_HUMAN|DAZL|NM_001351|NP_...     37   0.113
hg18||uc003miu |5|NM_031266|Q99729-2|Q99729-2|HNRPAB|NM_031266|N...     37   0.113
hg18||uc003miv |5|NM_004499|Q99729-3|Q99729-3|HNRPAB|NM_004499|N...     37   0.113
hg18||uc003miw |5|CR609806|Q99729-2|Q99729-2|HNRPAB|NM_031266|NP...     37   0.113
hg18||uc003mix |5|CR590133|Q99729-3|Q99729-3|HNRPAB|NM_004499|NP...     37   0.113
hg18||uc004fvm |Y|NM_004081|Q86SG3|DAZ4_HUMAN|DAZ1|NM_004081|NP_...     37   0.113
hg18||uc004fvm |Y|NM_004081|Q86SG3|DAZ4_HUMAN|DAZ1|NM_004081|NP_...     37   0.113
hg18||uc004fvn |Y|NM_020420|Q86SG3-2|Q86SG3-2|DAZ4|NM_020420|NP_...     37   0.113
hg18||uc004fvo |Y|U21663|Q13117-2|Q13117-2|DAZ2|NM_001005786|NP_...     37   0.113
hg18||uc004fvp |Y|BC114927|Q1RMF9|Q1RMF9_HUMAN|DAZ1|NA|NA|DAZ1 p...     37   0.113
hg18||uc004fvp |Y|BC114927|Q1RMF9|Q1RMF9_HUMAN|DAZ1|NA|NA|DAZ1 p...     37   0.113
hg18||uc004fvp |Y|BC114927|Q1RMF9|Q1RMF9_HUMAN|DAZ1|NA|NA|DAZ1 p...     37   0.113
hg18||uc004fvq |Y|NM_020363|Q13117|DAZ2_HUMAN|DAZ2|NM_020363|NP_...     37   0.113
hg18||uc004fvr |Y|NM_001005785|Q2KHN6|Q2KHN6_HUMAN|DAZ2|NM_00100...     37   0.113
hg18||uc004fvs |Y|NM_020364|Q2KHN7|Q2KHN7_HUMAN|DAZ3|NM_020364|N...     37   0.113
hg18||uc004fvt |Y|NM_020420|Q86SG3-2|Q86SG3-2|DAZ4|NM_020420|NP_...     37   0.113
hg18||uc004fvu |Y|NM_001005786|Q13117-2|Q13117-2|DAZ2|NM_0010057...     37   0.113
hg18||uc004fvv |Y|BC036648|Q2KHN6|Q2KHN6_HUMAN|DAZ2|NM_001005785...     37   0.113
hg18||uc004fvw |Y|AF248481|Q9NR90|DAZ3_HUMAN|DAZ3|NM_020364|NP_0...     37   0.113
hg18||uc004fwk |Y|NM_020364|Q2KHN7|Q2KHN7_HUMAN|DAZ3|NM_020364|N...     37   0.113
hg18||uc004fwl |Y|BC047480|Q86SG3-2|Q86SG3-2|DAZ4|NM_020420|NP_0...     37   0.113
hg18||uc004fwm |Y|NM_001005375|Q86SG3|DAZ4_HUMAN|DAZ4|NM_0010053...     37   0.113
hg18||uc004fwm |Y|NM_001005375|Q86SG3|DAZ4_HUMAN|DAZ4|NM_0010053...     37   0.113
hg18||uc004fwn |Y|NM_001005785|Q2KHN6|Q2KHN6_HUMAN|DAZ2|NM_00100...     37   0.113
hg18||uc004fwo |Y|NM_020364|Q2KHN7|Q2KHN7_HUMAN|DAZ3|NM_020364|N...     37   0.113
hg18||uc004fwp |Y|NM_020420|Q86SG3-2|Q86SG3-2|DAZ4|NM_020420|NP_...     37   0.113
hg18||uc004fwq |Y|NM_001005786|Q13117-2|Q13117-2|DAZ2|NM_0010057...     37   0.113
hg18||uc004fwr |Y|AF248480|Q13117|DAZ2_HUMAN|DAZ2|NM_020363|NP_0...     37   0.113
hg18||uc001bgq |1|DQ351905|Q2L7G6|Q2L7G6_HUMAN|HNRPR|NM_005826|N...     36   0.147
hg18||uc001art |1|NM_007375|Q13148|TADBP_HUMAN|TARDBP|NM_007375|...     36   0.192
hg18||uc004evt |X|NM_016024|Q9Y388|RBMX2_HUMAN|RBMX2|NM_016024|N...     36   0.192
hg18||uc004dzn |X|NM_007363|Q15233|NONO_HUMAN|NONO|NM_007363|NP_...     34   0.731
hg18||uc004dzo |X|BC003129|Q15233|NONO_HUMAN|NONO|NM_007363|NP_0...     34   0.731
hg18||uc004dzp |X|BC012141|Q15233|NONO_HUMAN|NONO|NM_007363|NP_0...     34   0.731
hg18||uc003kgo |5|DQ579214|NA|NA|DQ579214|NA|NA|full-length cDNA...     33   1.247
hg18||uc003ioo |4|NM_144979|Q8TBY0|Q8TBY0_HUMAN|MGC27016|NM_1449...     33   1.628
hg18||uc003iop |4|AK125877|NA|NA|MGC27016|NA|NA|Homo sapiens cDN...     33   1.628
hg18||uc003lbt |5|NM_006805|Q13151|ROA0_HUMAN|HNRPA0|NM_006805|N...     32   2.127
hg18||uc004arv |9|NM_017948|Q76FK4|NOL8_HUMAN|NOL8|NM_017948|NP_...     32   2.127
hg18||uc004arx |9|AK001049|NA|NA|NOL8|NA|NA|Homo sapiens NOL8 mR...     32   2.127

>hg18||uc003mcs
        |5|NM_030627|Q17RY0|CPEB4_HUMAN|CPEB4|NM_030627|NP_085130|cytoplasmic
        polyadenylation element binding

          Length = 729

 Score =  653 bits (1682), Expect = 4e-187
 Identities = 317/359 (88%), Positives = 333/359 (92%), Gaps = 6/359 (1%)

Query: 403 ERTRSFDSFSMHSLENSLIDIMRAEQDSLKGRYSFPHQGGDGPLPMNARSYGRRRGHSSL 462
           .| |.||   |||||.||||||||| |..||| .. . | |  | .|||.|||||| |||
Sbjct: 376 DRPRTFD---MHSLESSLIDIMRAENDTIKGRLNYSYPGSDSSLLINARTYGRRRGQSSL 432

Query: 463 FPMEDERSFGEDESGDQGL-AGLGSAHCFPHLNGERVERFSRKVFVGGLPPDIDEDEITA 521
           |||||   | .|  ||| | .|||| ||| | |||||||.||||||||||||||||||||
Sbjct: 433 FPMED--GFLDDGRGDQPLHSGLGSPHCFSHQNGERVERYSRKVFVGGLPPDIDEDEITA 490

Query: 522 SFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIQEEGKLYLCVSSPT 581
           |||||| |||||||||||||||||||||||||||||||||||||||.|.|||||||||||
Sbjct: 491 SFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPT 550

Query: 582 IKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYA 641
           |||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 551 IKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYA 610

Query: 642 GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDEC 701
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 611 GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDEC 670

Query: 702 QGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRWN 760
           || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 671 QGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRWN 729

>hg18||uc003gnm
        |4|BC103941|Q7Z5Q1-6|Q7Z5Q1-6|CPEB2|NM_182646|NP_872587|cytoplasmic
        polyadenylation element binding

          Length = 567

 Score =  635 bits (1636), Expect = 9e-182
 Identities = 309/364 (84%), Positives = 329/364 (90%), Gaps = 4/364 (1%)

Query: 398 LLFLQERTRSFDSFSMHSLENSLIDIMRAEQDSLKGRYSFPHQGGDGPLPMNARSYGRRR 457
           || ||.|.| .|| .||||||||||||||| | |||| |.|| | |  | .|||||||||
Sbjct: 207 LLPLQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNARSYGRRR 266

Query: 458 GHSSLFPMEDERSFGEDESGDQGLAGLGSAHCF-PHLNGERVERFSRKVFVGGLPPDIDE 516
           | |||||..|     .|   || .  | |  |.  | ||||.||||||||||||||||||
Sbjct: 267 GRSSLFPIDD--GLLDDGHSDQ-VGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDE 323

Query: 517 DEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIQEEGKLYLC 576
           ||||||||||| |.||||||||||||||||||||||||.||||||||||||.|.||||||
Sbjct: 324 DEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLC 383

Query: 577 VSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYG 636
           ||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||||
Sbjct: 384 VSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYG 443

Query: 637 GVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQ 696
           ||||||||||||||||||||||||||||||||||||||||||||.|||||||||||||||
Sbjct: 444 GVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQ 503

Query: 697 LCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHIS 756
           .|||||| ||||||||||||||||||||||.||| ||||||||||||||||| |||| | 
Sbjct: 504 MCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIH 563

Query: 757 FRWN 760
           ||||
Sbjct: 564 FRWN 567

>hg18||uc001khu
        |10|AK127060|Q8NE35|CPEB3_HUMAN|CPEB3|NM_014912|NP_055727|cytoplasmic
        polyadenylation element binding

          Length = 707

 Score =  634 bits (1635), Expect = 1e-181
 Identities = 361/702 (51%), Positives = 419/702 (59%), Gaps = 134/702 (19%)

Query: 132 GKEKLRIESPVLTGFDYQDSLGMGXXXXXXXXXXXXXXXFNNWSPAVPPTQSPIVGEDIG 191
           | .|...|||.| |  .                        . ||.   | |      . 
Sbjct:  67 GPDKMQMESPLLPGLSFHQPPQQPPPPQEPAAPGA------SLSPSFGSTWSTGTTNAVE 120

Query: 192 GFFGPASTNANGPHLLFQNFSHHTGPGFGAGGTFSPQIG--------------------- 230
             |    |  ||  .||||| ||  | |  |||||||||                     
Sbjct: 121 DSFFQGITPVNGT-MLFQNFPHHVNPVF--GGTFSPQIGLAQTQHHQQPPPPAPAPQPAQ 177

Query: 231 ---------------PLSXXXXXXXXXXXXXXXXXGLXXXXXXXXXXXXXXXXXXXXXXX 275
                          | |                                          
Sbjct: 178 PAQPPQAQPPQQRRSPASPSQAPYAQRSAAAAYGHQPIMTSKPSSSSAVAAAAAAAAASS 237

Query: 276 RTGPFTQLPHLTPAQSKPPSPWGNXXXXXXXXXXXXXXXXXXXXXXXXXVREYRRGLGGG 335
            .  .     .  | | | .|||                           |. || .| |
Sbjct: 238 ASSSWNTHQSVNAAWSAPSNPWGGLQAG----------------------RDPRRAVGVG 275

Query: 336 M-------TGLNSISPLKKSFSNNQVPSQKFPRNTSGFNHKAWVEDGMSR---GDSVYPF 385
           .       . || |||||| ||.| .   ||||  .    |.|.||   |   |... ||
Sbjct: 276 VGVGVGVPSPLNPISPLKKPFSSNVIAPPKFPR-AAPLTSKSWMEDNAFRTDNGNNLLPF 334

Query: 386 QVRMSQDIYCCLLLFLQERTRSFDSFSMHSLENSLIDIMRAEQDSLKGRY---------- 435
                           |.|.| .|.|..|||||||.|..| . . |||..          
Sbjct: 335 ----------------QDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSGPPMSF 378

Query: 436 ---------------SFPHQGGDGPLPMNARSYGRRRGHSSLFPMEDERSFGEDESGDQG 480
                          .| | | |  . .|.|        ||||| ||  .| .|  ||| 
Sbjct: 379 ADIMWRNHFAGRMGINFHHPGTDNIMALNSR--------SSLFPFED--AFLDDSHGDQA 428

Query: 481 L-AGLGS-AHCFPHLNGERVERFSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAE 538
           | .|| |   |    |||||||.|||||||||||||||||||||||||| |.||||||||
Sbjct: 429 LSSGLSSPTRC---QNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAE 485

Query: 539 SKSYFPPKGYAFLLFQDESSVQALIDACIQEEGKLYLCVSSPTIKDKPVQIRPWNLNDSD 598
           ||||||||||||||||.|||||||||||..|.||||||||||||||||||||||||.|||
Sbjct: 486 SKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSD 545

Query: 599 FVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRV 658
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 546 FVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRV 605

Query: 659 AFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANV 718
           ||||||||||||||||||||| .|||||||||||||||.|||||||||||||||||||||
Sbjct: 606 AFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANV 665

Query: 719 TCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRWN 760
           ||||||||||||.|||||||||||||||||||||||. |||.
Sbjct: 666 TCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRWS 707

>hg18||uc003gnk
        |4|BC103942|Q7Z5Q1|CPEB2_HUMAN|CPEB2|NM_182485|NP_872291|cytoplasmic
        polyadenylation element binding

          Length = 597

 Score =  632 bits (1628), Expect = 8e-181
 Identities = 306/360 (85%), Positives = 326/360 (90%), Gaps = 4/360 (1%)

Query: 402 QERTRSFDSFSMHSLENSLIDIMRAEQDSLKGRYSFPHQGGDGPLPMNARSYGRRRGHSS 461
           |.|.| .|| .||||||||||||||| | |||| |.|| | |  | .|||||||||| ||
Sbjct: 241 QDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNARSYGRRRGRSS 300

Query: 462 LFPMEDERSFGEDESGDQGLAGLGSAHCF-PHLNGERVERFSRKVFVGGLPPDIDEDEIT 520
           |||..|     .|   || .  | |  |.  | ||||.||||||||||||||||||||||
Sbjct: 301 LFPIDD--GLLDDGHSDQ-VGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEIT 357

Query: 521 ASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIQEEGKLYLCVSSP 580
           ||||||| |.||||||||||||||||||||||||.||||||||||||.|.||||||||||
Sbjct: 358 ASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSP 417

Query: 581 TIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCY 640
           ||||||||||||||.|||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 418 TIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCY 477

Query: 641 AGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDE 700
           ||||||||||||||||||||||||||||||||||||||||.|||||||||||||||.|||
Sbjct: 478 AGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDE 537

Query: 701 CQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRWN 760
           ||| ||||||||||||||||||||||.||| ||||||||||||||||| |||| | ||||
Sbjct: 538 CQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN 597

>hg18||uc003gnl
        |4|BC103939|Q7Z5Q1-6|Q7Z5Q1-6|CPEB2|NM_182646|NP_872587|cytoplasmic
        polyadenylation element binding

          Length = 570

 Score =  630 bits (1623), Expect = 3e-180
 Identities = 305/359 (84%), Positives = 325/359 (90%), Gaps = 4/359 (1%)

Query: 403 ERTRSFDSFSMHSLENSLIDIMRAEQDSLKGRYSFPHQGGDGPLPMNARSYGRRRGHSSL 462
           .|.| .|| .||||||||||||||| | |||| |.|| | |  | .|||||||||| |||
Sbjct: 215 DRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNARSYGRRRGRSSL 274

Query: 463 FPMEDERSFGEDESGDQGLAGLGSAHCF-PHLNGERVERFSRKVFVGGLPPDIDEDEITA 521
           ||..|     .|   || .  | |  |.  | ||||.|||||||||||||||||||||||
Sbjct: 275 FPIDD--GLLDDGHSDQ-VGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITA 331

Query: 522 SFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIQEEGKLYLCVSSPT 581
           |||||| |.||||||||||||||||||||||||.||||||||||||.|.|||||||||||
Sbjct: 332 SFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPT 391

Query: 582 IKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYA 641
           |||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 392 IKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYA 451

Query: 642 GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDEC 701
           |||||||||||||||||||||||||||||||||||||||.|||||||||||||||.||||
Sbjct: 452 GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDEC 511

Query: 702 QGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRWN 760
           || ||||||||||||||||||||||.||| ||||||||||||||||| |||| | ||||
Sbjct: 512 QGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN 570

>hg18||uc001khv
        |10|AB023157|Q8NE35-2|Q8NE35-2|CPEB3|NM_014912|NP_055727|cytoplasmic
        polyadenylation element binding

          Length = 684

 Score =  629 bits (1621), Expect = 5e-180
 Identities = 321/449 (71%), Positives = 363/449 (80%), Gaps = 44/449 (9%)

Query: 326 REYRRGLGGGM-------TGLNSISPLKKSFSNNQVPSQKFPRNTSGFNHKAWVEDGMSR 378
           |. || .| |.       . || |||||| ||.| .   ||||  .    |.|.||   |
Sbjct: 266 RDPRRAVGVGVGVGVGVPSPLNPISPLKKPFSSNVIAPPKFPR-AAPLTSKSWMEDNAFR 324

Query: 379 ---GDSVYPFQVRMSQDIYCCLLLFLQERTRSFDSFSMHSLENSLIDIMRAEQDSLKGR- 434
              |... ||                |.|.| .|.|..|||||||.|..| . . |||| 
Sbjct: 325 TDNGNNLLPF----------------QDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGRM 368

Query: 435 -YSFPHQGGDGPLPMNARSYGRRRGHSSLFPMEDERSFGEDESGDQGL-AGLGS-AHCFP 491
             .| | | |  . .|.|        ||||| ||  .| .|  ||| | .|| |   |  
Sbjct: 369 GINFHHPGTDNIMALNSR--------SSLFPFED--AFLDDSHGDQALSSGLSSPTRC-- 416

Query: 492 HLNGERVERFSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFL 551
             |||||||.|||||||||||||||||||||||||| |.|||||||||||||||||||||
Sbjct: 417 -QNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFL 475

Query: 552 LFQDESSVQALIDACIQEEGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRK 611
           |||.|||||||||||..|.||||||||||||||||||||||||.||||||||||||||||
Sbjct: 476 LFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRK 535

Query: 612 TIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAIS 671
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 536 TIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAIS 595

Query: 672 ARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAA 731
           |||||||| .|||||||||||||||.|||||||||||||||||||||||||||||||||.
Sbjct: 596 ARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAS 655

Query: 732 IHSRAGREFHKPLVKEGGDRPRHISFRWN 760
           |||||||||||||||||||||||. |||.
Sbjct: 656 IHSRAGREFHKPLVKEGGDRPRHVPFRWS 684

>hg18||uc001khw
        |10|NM_014912|Q8NE35|CPEB3_HUMAN|CPEB3|NM_014912|NP_055727|cytoplasmic
        polyadenylation element binding

          Length = 698

 Score =  602 bits (1551), Expect = 7e-172
 Identities = 313/453 (69%), Positives = 354/453 (78%), Gaps = 48/453 (10%)

Query: 326 REYRRGLGGGM-------TGLNSISPLKKSFSNNQVPSQKFPRNTSGFNHKAWVEDGMSR 378
           |. || .| |.       . || |||||| ||.| .   ||||  .    |.|.||   |
Sbjct: 266 RDPRRAVGVGVGVGVGVPSPLNPISPLKKPFSSNVIAPPKFPR-AAPLTSKSWMEDNAFR 324

Query: 379 ---GDSVYPFQVRMSQDIYCCLLLFLQERTRSFDSFSMHSLENSLIDIMRAEQDSLKGRY 435
              |... ||                |.|.| .|.|..|||||||.|..| . . |||. 
Sbjct: 325 TDNGNNLLPF----------------QDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGK- 367

Query: 436 SFPHQGGDGPLPMN------ARSYGRRRGHSSLFPMED-----ERSFGEDESGDQGL-AG 483
              |    || ||.         .  | | .   |  |       .| .|  ||| | .|
Sbjct: 368 ---HYPPSGP-PMSFADIMWRNHFAGRMGINFHHPGTDNIMALNNAFLDDSHGDQALSSG 423

Query: 484 LGS-AHCFPHLNGERVERFSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSY 542
           | |   |    |||||||.|||||||||||||||||||||||||| |.||||||||||||
Sbjct: 424 LSSPTRC---QNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSY 480

Query: 543 FPPKGYAFLLFQDESSVQALIDACIQEEGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMD 602
           ||||||||||||.|||||||||||..|.||||||||||||||||||||||||.|||||||
Sbjct: 481 FPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMD 540

Query: 603 GSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSN 662
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 GSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSN 600

Query: 663 QQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQ 722
           ||||||||||||||||| .|||||||||||||||.|||||||||||||||||||||||||
Sbjct: 601 QQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQ 660

Query: 723 YYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHI 755
           ||||||||.|||||||||||||||||||||||.
Sbjct: 661 YYCEYCWASIHSRAGREFHKPLVKEGGDRPRHV 693

>hg18||uc003mcu
        |5|BC036899|Q17RY0-3|Q17RY0-3|CPEB4|NM_030627|NP_085130|cytoplasmic
        polyadenylation element binding

          Length = 322

 Score =  590 bits (1521), Expect = 2e-168
 Identities = 284/305 (93%), Positives = 291/305 (95%), Gaps = 3/305 (0%)

Query: 457 RGHSSLFPMEDERSFGEDESGDQGL-AGLGSAHCFPHLNGERVERFSRKVFVGGLPPDID 515
           .| ||||||||   | .|  ||| | .|||| ||| | |||||||.||||||||||||||
Sbjct:  20 KGQSSLFPMED--GFLDDGRGDQPLHSGLGSPHCFSHQNGERVERYSRKVFVGGLPPDID 77

Query: 516 EDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIQEEGKLYL 575
           |||||||||||| |||||||||||||||||||||||||||||||||||||||.|.|||||
Sbjct:  78 EDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYL 137

Query: 576 CVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLY 635
           |||||||||||||||||||.||||||||||||||||||||||||||||||||||||||||
Sbjct: 138 CVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLY 197

Query: 636 GGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDD 695
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 198 GGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDD 257

Query: 696 QLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHI 755
           |||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 258 QLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHI 317

Query: 756 SFRWN 760
           |||||
Sbjct: 318 SFRWN 322

>hg18||uc003mct
        |5|CR598263|Q17RY0-3|Q17RY0-3|CPEB4|NM_030627|NP_085130|cytoplasmic
        polyadenylation element binding

          Length = 339

 Score =  590 bits (1519), Expect = 3e-168
 Identities = 284/304 (93%), Positives = 290/304 (95%), Gaps = 3/304 (0%)

Query: 458 GHSSLFPMEDERSFGEDESGDQGL-AGLGSAHCFPHLNGERVERFSRKVFVGGLPPDIDE 516
           | ||||||||   | .|  ||| | .|||| ||| | |||||||.|||||||||||||||
Sbjct:  38 GQSSLFPMED--GFLDDGRGDQPLHSGLGSPHCFSHQNGERVERYSRKVFVGGLPPDIDE 95

Query: 517 DEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIQEEGKLYLC 576
           ||||||||||| |||||||||||||||||||||||||||||||||||||||.|.||||||
Sbjct:  96 DEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLC 155

Query: 577 VSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYG 636
           ||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||||
Sbjct: 156 VSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYG 215

Query: 637 GVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQ 696
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 216 GVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQ 275

Query: 697 LCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHIS 756
           ||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 276 LCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHIS 335

Query: 757 FRWN 760
           ||||
Sbjct: 336 FRWN 339

>hg18||uc001khw
        |10|NM_014912|Q8NE35|CPEB3_HUMAN|CPEB3|NM_014912|NP_055727|cytoplasmic
        polyadenylation element binding

          Length = 698

 Score =  582 bits (1498), Expect = 9e-166
 Identities = 288/372 (77%), Positives = 319/372 (85%), Gaps = 13/372 (3%)

Query: 398 LLFLQERTRSFDSFSMHSLENSLIDIMRAEQDSLKGRYSFPHQGGDGPLP--MNARSYGR 455
           ||  |.|.| .|.|..|||||||.|..| . . |||.. .|  |        |    .  
Sbjct: 331 LLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKH-YPPSGPPMSFADIMWRNHFAG 389

Query: 456 RRGHSSLFPMED-----ERSFGEDESGDQGL-AGLGS-AHCFPHLNGERVERFSRKVFVG 508
           | | .   |  |       .| .|  ||| | .|| |   |    |||||||.|||||||
Sbjct: 390 RMGINFHHPGTDNIMALNNAFLDDSHGDQALSSGLSSPTRC---QNGERVERYSRKVFVG 446

Query: 509 GLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIQ 568
           ||||||||||||||||||| |.||||||||||||||||||||||||.|||||||||||..
Sbjct: 447 GLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLE 506

Query: 569 EEGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELA 628
           |.||||||||||||||||||||||||.|||||||||||||||||||||||||||||||||
Sbjct: 507 EDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELA 566

Query: 629 MIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEV 688
           ||||||||||||||||||||||||||||||||||||||||||||||||||| .|||||||
Sbjct: 567 MIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEV 626

Query: 689 KPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEG 748
           ||||||||.|||||||||||||||||||||||||||||||||.|||||||||||||||||
Sbjct: 627 KPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEG 686

Query: 749 GDRPRHISFRWN 760
           ||||||. |||.
Sbjct: 687 GDRPRHVPFRWS 698

>hg18||uc003gni
        |4|NM_182485|Q7Z5Q1-2|Q7Z5Q1-2|CPEB2|NM_182485|NP_872291|cytoplasmic
        polyadenylation element binding

          Length = 589

 Score =  552 bits (1421), Expect = 8e-157
 Identities = 266/304 (87%), Positives = 280/304 (92%), Gaps = 4/304 (1%)

Query: 458 GHSSLFPMEDERSFGEDESGDQGLAGLGSAHCF-PHLNGERVERFSRKVFVGGLPPDIDE 516
           | |||||..|     .|   || .  | |  |.  | ||||.||||||||||||||||||
Sbjct: 289 GRSSLFPIDD--GLLDDGHSDQ-VGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDE 345

Query: 517 DEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIQEEGKLYLC 576
           ||||||||||| |.||||||||||||||||||||||||.||||||||||||.|.||||||
Sbjct: 346 DEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLC 405

Query: 577 VSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYG 636
           ||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||||
Sbjct: 406 VSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYG 465

Query: 637 GVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQ 696
           ||||||||||||||||||||||||||||||||||||||||||||.|||||||||||||||
Sbjct: 466 GVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQ 525

Query: 697 LCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHIS 756
           .|||||| ||||||||||||||||||||||.||| ||||||||||||||||| |||| | 
Sbjct: 526 MCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIH 585

Query: 757 FRWN 760
           ||||
Sbjct: 586 FRWN 589

>hg18||uc003gnj
        |4|NM_182646|Q7Z5Q1-5|Q7Z5Q1-5|CPEB2|NM_182646|NP_872587|cytoplasmic
        polyadenylation element binding

          Length = 559

 Score =  552 bits (1421), Expect = 8e-157
 Identities = 266/304 (87%), Positives = 280/304 (92%), Gaps = 4/304 (1%)

Query: 458 GHSSLFPMEDERSFGEDESGDQGLAGLGSAHCF-PHLNGERVERFSRKVFVGGLPPDIDE 516
           | |||||..|     .|   || .  | |  |.  | ||||.||||||||||||||||||
Sbjct: 259 GRSSLFPIDD--GLLDDGHSDQ-VGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDE 315

Query: 517 DEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIQEEGKLYLC 576
           ||||||||||| |.||||||||||||||||||||||||.||||||||||||.|.||||||
Sbjct: 316 DEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLC 375

Query: 577 VSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYG 636
           ||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||||
Sbjct: 376 VSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYG 435

Query: 637 GVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQ 696
           ||||||||||||||||||||||||||||||||||||||||||||.|||||||||||||||
Sbjct: 436 GVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQ 495

Query: 697 LCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHIS 756
           .|||||| ||||||||||||||||||||||.||| ||||||||||||||||| |||| | 
Sbjct: 496 MCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIH 555

Query: 757 FRWN 760
           ||||
Sbjct: 556 FRWN 559

>hg18||uc003gnn
        |4|BC105925|Q7Z5Q1-4|Q7Z5Q1-4|CPEB2|NM_182646|NP_872587|cytoplasmic
        polyadenylation element binding

          Length = 562

 Score =  552 bits (1421), Expect = 8e-157
 Identities = 266/304 (87%), Positives = 280/304 (92%), Gaps = 4/304 (1%)

Query: 458 GHSSLFPMEDERSFGEDESGDQGLAGLGSAHCF-PHLNGERVERFSRKVFVGGLPPDIDE 516
           | |||||..|     .|   || .  | |  |.  | ||||.||||||||||||||||||
Sbjct: 262 GRSSLFPIDD--GLLDDGHSDQ-VGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDE 318

Query: 517 DEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIQEEGKLYLC 576
           ||||||||||| |.||||||||||||||||||||||||.||||||||||||.|.||||||
Sbjct: 319 DEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLC 378

Query: 577 VSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYG 636
           ||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||||
Sbjct: 379 VSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYG 438

Query: 637 GVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQ 696
           ||||||||||||||||||||||||||||||||||||||||||||.|||||||||||||||
Sbjct: 439 GVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQ 498

Query: 697 LCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHIS 756
           .|||||| ||||||||||||||||||||||.||| ||||||||||||||||| |||| | 
Sbjct: 499 MCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIH 558

Query: 757 FRWN 760
           ||||
Sbjct: 559 FRWN 562

>hg18||uc002bip |15|AL832156|NA|NA|CPEB1|NM_001079535|NP_001073003|cytoplasmic
        polyadenylation element binding

          Length = 335

 Score =  211 bits (535), Expect = 4e-054
 Identities = 112/257 (43%), Positives = 157/257 (61%), Gaps = 13/257 (5%)

Query: 501 FSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQ 560
           .| |||.||.| || |  .  .|| || | |.|| |       ||||| .|.|. | ||.
Sbjct:  83 YSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGYVYLVFELEKSVR 142

Query: 561 ALIDACIQEE------GKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIF 614
           .|. ||  .        . |  .||  .. | ||. || | ||.||   || ||| .|.|
Sbjct: 143 SLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVF 202

Query: 615 VGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARF 674
           || .   | |  || |.. |.||| |||||||   ||| |.||| |.||.||. |.|| |
Sbjct: 203 VGALHGMLNAEALAAILNDLFGGVVYAGIDTDKH-KYPIGSGRVTFNNQRSYLKAVSAAF 261

Query: 675 VQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHS 734
           |...  .  |.|.. || |.| ||       |  .  |||| .  | .|.|  ||   ||
Sbjct: 262 VEIKTTKFTKKVQIDPY-LEDSLCH-----ICSSQPGPFFCRDQVCFKYFCRSCWHWRHS 315

Query: 735 RAGREFHKPLVKEGGDR 751
             |   | ||..   .|
Sbjct: 316 MEGLRHHSPLMRNQKNR 332

>hg18||uc002biq
        |15|NM_001079534|Q9BZB8-4|Q9BZB8-4|CPEB1|NM_001079534|NP_001073002|cyto
        plasmic polyadenylation element binding

          Length = 486

 Score =  211 bits (535), Expect = 4e-054
 Identities = 112/257 (43%), Positives = 157/257 (61%), Gaps = 13/257 (5%)

Query: 501 FSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQ 560
           .| |||.||.| || |  .  .|| || | |.|| |       ||||| .|.|. | ||.
Sbjct: 234 YSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGYVYLVFELEKSVR 293

Query: 561 ALIDACIQEE------GKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIF 614
           .|. ||  .        . |  .||  .. | ||. || | ||.||   || ||| .|.|
Sbjct: 294 SLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVF 353

Query: 615 VGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARF 674
           || .   | |  || |.. |.||| |||||||   ||| |.||| |.||.||. |.|| |
Sbjct: 354 VGALHGMLNAEALAAILNDLFGGVVYAGIDTDKH-KYPIGSGRVTFNNQRSYLKAVSAAF 412

Query: 675 VQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHS 734
           |...  .  |.|.. || |.| ||       |  .  |||| .  | .|.|  ||   ||
Sbjct: 413 VEIKTTKFTKKVQIDPY-LEDSLCH-----ICSSQPGPFFCRDQVCFKYFCRSCWHWRHS 466

Query: 735 RAGREFHKPLVKEGGDR 751
             |   | ||..   .|
Sbjct: 467 MEGLRHHSPLMRNQKNR 483

>hg18||uc002bis
        |15|NM_001079535|Q9BZB8-4|Q9BZB8-4|CPEB1|NM_001079535|NP_001073003|cyto
        plasmic polyadenylation element binding

          Length = 486

 Score =  211 bits (535), Expect = 4e-054
 Identities = 112/257 (43%), Positives = 157/257 (61%), Gaps = 13/257 (5%)

Query: 501 FSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQ 560
           .| |||.||.| || |  .  .|| || | |.|| |       ||||| .|.|. | ||.
Sbjct: 234 YSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGYVYLVFELEKSVR 293

Query: 561 ALIDACIQEE------GKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIF 614
           .|. ||  .        . |  .||  .. | ||. || | ||.||   || ||| .|.|
Sbjct: 294 SLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVF 353

Query: 615 VGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARF 674
           || .   | |  || |.. |.||| |||||||   ||| |.||| |.||.||. |.|| |
Sbjct: 354 VGALHGMLNAEALAAILNDLFGGVVYAGIDTDKH-KYPIGSGRVTFNNQRSYLKAVSAAF 412

Query: 675 VQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHS 734
           |...  .  |.|.. || |.| ||       |  .  |||| .  | .|.|  ||   ||
Sbjct: 413 VEIKTTKFTKKVQIDPY-LEDSLCH-----ICSSQPGPFFCRDQVCFKYFCRSCWHWRHS 466

Query: 735 RAGREFHKPLVKEGGDR 751
             |   | ||..   .|
Sbjct: 467 MEGLRHHSPLMRNQKNR 483

>hg18||uc002biu
        |15|BX649159|Q9BZB8-3|Q9BZB8-3|CPEB1|NM_030594|NP_085097|cytoplasmic
        polyadenylation element binding

          Length = 588

 Score =  211 bits (535), Expect = 4e-054
 Identities = 112/257 (43%), Positives = 157/257 (61%), Gaps = 13/257 (5%)

Query: 501 FSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQ 560
           .| |||.||.| || |  .  .|| || | |.|| |       ||||| .|.|. | ||.
Sbjct: 336 YSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGYVYLVFELEKSVR 395

Query: 561 ALIDACIQEE------GKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIF 614
           .|. ||  .        . |  .||  .. | ||. || | ||.||   || ||| .|.|
Sbjct: 396 SLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVF 455

Query: 615 VGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARF 674
           || .   | |  || |.. |.||| |||||||   ||| |.||| |.||.||. |.|| |
Sbjct: 456 VGALHGMLNAEALAAILNDLFGGVVYAGIDTDKH-KYPIGSGRVTFNNQRSYLKAVSAAF 514

Query: 675 VQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHS 734
           |...  .  |.|.. || |.| ||       |  .  |||| .  | .|.|  ||   ||
Sbjct: 515 VEIKTTKFTKKVQIDPY-LEDSLCH-----ICSSQPGPFFCRDQVCFKYFCRSCWHWRHS 568

Query: 735 RAGREFHKPLVKEGGDR 751
             |   | ||..   .|
Sbjct: 569 MEGLRHHSPLMRNQKNR 585

>hg18||uc002biv
        |15|NM_030594|Q9BZB8-3|Q9BZB8-3|CPEB1|NM_030594|NP_085097|cytoplasmic
        polyadenylation element binding

          Length = 561

 Score =  211 bits (535), Expect = 4e-054
 Identities = 112/257 (43%), Positives = 157/257 (61%), Gaps = 13/257 (5%)

Query: 501 FSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQ 560
           .| |||.||.| || |  .  .|| || | |.|| |       ||||| .|.|. | ||.
Sbjct: 309 YSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGYVYLVFELEKSVR 368

Query: 561 ALIDACIQEE------GKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIF 614
           .|. ||  .        . |  .||  .. | ||. || | ||.||   || ||| .|.|
Sbjct: 369 SLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVF 428

Query: 615 VGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARF 674
           || .   | |  || |.. |.||| |||||||   ||| |.||| |.||.||. |.|| |
Sbjct: 429 VGALHGMLNAEALAAILNDLFGGVVYAGIDTDKH-KYPIGSGRVTFNNQRSYLKAVSAAF 487

Query: 675 VQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHS 734
           |...  .  |.|.. || |.| ||       |  .  |||| .  | .|.|  ||   ||
Sbjct: 488 VEIKTTKFTKKVQIDPY-LEDSLCH-----ICSSQPGPFFCRDQVCFKYFCRSCWHWRHS 541

Query: 735 RAGREFHKPLVKEGGDR 751
             |   | ||..   .|
Sbjct: 542 MEGLRHHSPLMRNQKNR 558

>hg18||uc002bir
        |15|NM_001079533|Q9BZB8-2|Q9BZB8-2|CPEB1|NM_001079533|NP_001073001|cyto
        plasmic polyadenylation element binding

          Length = 491

 Score =  205 bits (519), Expect = 3e-052
 Identities = 112/262 (42%), Positives = 157/262 (59%), Gaps = 18/262 (6%)

Query: 501 FSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFP-----PKGYAFLLFQD 555
           .| |||.||.| || |  .  .|| || | |.|| |       |     |||| .|.|. 
Sbjct: 234 YSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGYVYLVFEL 293

Query: 556 ESSVQALIDACIQEE------GKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDP 609
           | ||..|. ||  .        . |  .||  .. | ||. || | ||.||   || |||
Sbjct: 294 EKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDP 353

Query: 610 RKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAA 669
            .|.||| .   | |  || |.. |.||| |||||||   ||| |.||| |.||.||. |
Sbjct: 354 SRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKH-KYPIGSGRVTFNNQRSYLKA 412

Query: 670 ISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCW 729
           .|| ||...  .  |.|.. || |.| ||       |  .  |||| .  | .|.|  ||
Sbjct: 413 VSAAFVEIKTTKFTKKVQIDPY-LEDSLCH-----ICSSQPGPFFCRDQVCFKYFCRSCW 466

Query: 730 AAIHSRAGREFHKPLVKEGGDR 751
              ||  |   | ||..   .|
Sbjct: 467 HWRHSMEGLRHHSPLMRNQKNR 488

>hg18||uc002bit
        |15|AF329402|Q9BZB8|CPEB1_HUMAN|CPEB1|NM_030594|NP_085097|cytoplasmic
        polyadenylation element binding

          Length = 626

 Score =  205 bits (519), Expect = 3e-052
 Identities = 112/262 (42%), Positives = 157/262 (59%), Gaps = 18/262 (6%)

Query: 501 FSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFP-----PKGYAFLLFQD 555
           .| |||.||.| || |  .  .|| || | |.|| |       |     |||| .|.|. 
Sbjct: 369 YSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGYVYLVFEL 428

Query: 556 ESSVQALIDACIQEE------GKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDP 609
           | ||..|. ||  .        . |  .||  .. | ||. || | ||.||   || |||
Sbjct: 429 EKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDP 488

Query: 610 RKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAA 669
            .|.||| .   | |  || |.. |.||| |||||||   ||| |.||| |.||.||. |
Sbjct: 489 SRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKH-KYPIGSGRVTFNNQRSYLKA 547

Query: 670 ISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCW 729
           .|| ||...  .  |.|.. || |.| ||       |  .  |||| .  | .|.|  ||
Sbjct: 548 VSAAFVEIKTTKFTKKVQIDPY-LEDSLCH-----ICSSQPGPFFCRDQVCFKYFCRSCW 601

Query: 730 AAIHSRAGREFHKPLVKEGGDR 751
              ||  |   | ||..   .|
Sbjct: 602 HWRHSMEGLRHHSPLMRNQKNR 623

>hg18||uc003mcs
        |5|NM_030627|Q17RY0|CPEB4_HUMAN|CPEB4|NM_030627|NP_085130|cytoplasmic
        polyadenylation element binding

          Length = 729

 Score =  169 bits (427), Expect = 1e-041
 Identities = 104/238 (43%), Positives = 129/238 (54%), Gaps = 13/238 (5%)

Query:   1 MGDYAFGVLVKNSSGNKSAFPVRIXXXXXXXXXXXXXXXXXXXXFISNNCSTNG---GSA 57
           |||| |||||....|||||||||                     ||.|| . ||   |||
Sbjct:   1 MGDYGFGVLVQSNTGNKSAFPVRF-HPHLQPPHHHQNATPSPAAFINNNTAANGSSAGSA 59

Query:  58 WLFPTVAQHSNMQDDILESDKSKALDLQDMQEKXXXXXXXXXXXXGHQEAGGNLGDLEGP 117
           ||||  | | |.||.|| |.|.|.      ||.              ||||      .  
Sbjct:  60 WLFPAPATH-NIQDEILGSEKAKS----QQQEQQDPLEKQQLSPSPGQEAGILPETEKAK 114

Query: 118 EETTLEKGSLESSGGKEKLRIESPVLTGFDYQDSLGMGXXXXXXXXXXXXXXXFNNWSPA 177
            |      | |.  ||||.|||||||||||||.. |.|               |.||| |
Sbjct: 115 SEENQGDNSSENGNGKEKIRIESPVLTGFDYQEATGLGTSTQPLTSSASSLTGFSNWSAA 174

Query: 178 VPPTQSPIVGEDIGGFF--GPASTNANGPHLLFQNFSHHTGPGFGAGGTFSPQIGPLS 233
           . |. | |. ||   |   |  . .||   |||||| ||  |||  ||.|||||| ||
Sbjct: 175 IAPSSSTIINEDASFFHQGGVPAASANNGALLFQNFPHHVSPGF--GGSFSPQIGLLS 230

>hg18||uc003mcs
        |5|NM_030627|Q17RY0|CPEB4_HUMAN|CPEB4|NM_030627|NP_085130|cytoplasmic
        polyadenylation element binding

          Length = 729

 Score =  92 bits (227), Expect = 2e-018
 Identities = 46/114 (40%), Positives = 64/114 (56%), Gaps = 1/114 (0%)

Query: 276 RTGPFTQLPHLTPAQSKPPSPWGNXXX-XXXXXXXXXXXXXXXXXXXXXXVREYRRGLGG 334
           |   | |||||    .|||||| .                           |..|||| |
Sbjct: 264 RNAAFNQLPHLANNLNKPPSPWSSYQSPSPTPSSSWSPGGGGYGGWGGSQGRDHRRGLNG 323

Query: 335 GMTGLNSISPLKKSFSNNQVPSQKFPRNTSGFNHKAWVEDGMSRGDSVYPFQVR 388
           |.| |||||||||.|..| .  ||. | .| |  |.|.|| ..| |...||  |
Sbjct: 324 GITPLNSISPLKKNFASNHIQLQKYARPSSAFAPKSWMEDSLNRADNIFPFPDR 377

>hg18||uc003gnj
        |4|NM_182646|Q7Z5Q1-5|Q7Z5Q1-5|CPEB2|NM_182646|NP_872587|cytoplasmic
        polyadenylation element binding

          Length = 559

 Score =  75 bits (183), Expect = 3e-013
 Identities = 37/55 (67%), Positives = 43/55 (78%)

Query: 398 LLFLQERTRSFDSFSMHSLENSLIDIMRAEQDSLKGRYSFPHQGGDGPLPMNARS 452
           || ||.|.| .|| .||||||||||||||| | |||| |.|| | |  | .| ||
Sbjct: 207 LLPLQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGRS 261

>hg18||uc003gni
        |4|NM_182485|Q7Z5Q1-2|Q7Z5Q1-2|CPEB2|NM_182485|NP_872291|cytoplasmic
        polyadenylation element binding

          Length = 589

 Score =  72 bits (175), Expect = 2e-012
 Identities = 34/51 (66%), Positives = 40/51 (78%)

Query: 402 QERTRSFDSFSMHSLENSLIDIMRAEQDSLKGRYSFPHQGGDGPLPMNARS 452
           |.|.| .|| .||||||||||||||| | |||| |.|| | |  | .| ||
Sbjct: 241 QDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGRS 291

>hg18||uc003gnn
        |4|BC105925|Q7Z5Q1-4|Q7Z5Q1-4|CPEB2|NM_182646|NP_872587|cytoplasmic
        polyadenylation element binding

          Length = 562

 Score =  70 bits (170), Expect = 9e-012
 Identities = 33/50 (66%), Positives = 39/50 (78%)

Query: 403 ERTRSFDSFSMHSLENSLIDIMRAEQDSLKGRYSFPHQGGDGPLPMNARS 452
           .|.| .|| .||||||||||||||| | |||| |.|| | |  | .| ||
Sbjct: 215 DRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGRS 264

>hg18||uc003gnl
        |4|BC103939|Q7Z5Q1-6|Q7Z5Q1-6|CPEB2|NM_182646|NP_872587|cytoplasmic
        polyadenylation element binding

          Length = 570

 Score =  55 bits (130), Expect = 4e-007
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 5/71 (7%)

Query: 326 REYRRGLGGGMTG-LNSISPLKKSFSNNQVPSQKFPRNTSGFNHKAWVEDGMSRGD---- 380
           |..||    |. | .| |||||| || | .   || |.|     |.|.|| . | |    
Sbjct: 146 RDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSN 205

Query: 381 SVYPFQVRMSQ 391
           .. | |||| .
Sbjct: 206 TLLPLQVRMDR 216

>hg18||uc003gnn
        |4|BC105925|Q7Z5Q1-4|Q7Z5Q1-4|CPEB2|NM_182646|NP_872587|cytoplasmic
        polyadenylation element binding

          Length = 562

 Score =  55 bits (130), Expect = 4e-007
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 5/71 (7%)

Query: 326 REYRRGLGGGMTG-LNSISPLKKSFSNNQVPSQKFPRNTSGFNHKAWVEDGMSRGD---- 380
           |..||    |. | .| |||||| || | .   || |.|     |.|.|| . | |    
Sbjct: 146 RDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSN 205

Query: 381 SVYPFQVRMSQ 391
           .. | |||| .
Sbjct: 206 TLLPLQVRMDR 216

>hg18||uc003gni
        |4|NM_182485|Q7Z5Q1-2|Q7Z5Q1-2|CPEB2|NM_182485|NP_872291|cytoplasmic
        polyadenylation element binding

          Length = 589

 Score =  54 bits (127), Expect = 9e-007
 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 5/70 (7%)

Query: 326 REYRRGLGGGMTG-LNSISPLKKSFSNNQVPSQKFPRNTSGFNHKAWVEDGMSRGD---- 380
           |..||    |. | .| |||||| || | .   || |.|     |.|.|| . | |    
Sbjct: 146 RDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSN 205

Query: 381 SVYPFQVRMS 390
           .. | ||| |
Sbjct: 206 TLLPLQVRSS 215

>hg18||uc003gnk
        |4|BC103942|Q7Z5Q1|CPEB2_HUMAN|CPEB2|NM_182485|NP_872291|cytoplasmic
        polyadenylation element binding

          Length = 597

 Score =  54 bits (127), Expect = 9e-007
 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 5/70 (7%)

Query: 326 REYRRGLGGGMTG-LNSISPLKKSFSNNQVPSQKFPRNTSGFNHKAWVEDGMSRGD---- 380
           |..||    |. | .| |||||| || | .   || |.|     |.|.|| . | |    
Sbjct: 146 RDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSN 205

Query: 381 SVYPFQVRMS 390
           .. | ||| |
Sbjct: 206 TLLPLQVRSS 215

>hg18||uc003mct
        |5|CR598263|Q17RY0-3|Q17RY0-3|CPEB4|NM_030627|NP_085130|cytoplasmic
        polyadenylation element binding

          Length = 339

 Score =  51 bits (120), Expect = 6e-006
 Identities = 23/40 (57%), Positives = 31/40 (77%)

Query: 413 MHSLENSLIDIMRAEQDSLKGRYSFPHQGGDGPLPMNARS 452
           |||||.||||||||| |..||| .. . | |  | .| .|
Sbjct:   1 MHSLESSLIDIMRAENDTIKGRLNYSYPGSDSSLLINGQS 40

>hg18||uc003gnj
        |4|NM_182646|Q7Z5Q1-5|Q7Z5Q1-5|CPEB2|NM_182646|NP_872587|cytoplasmic
        polyadenylation element binding

          Length = 559

 Score =  50 bits (118), Expect = 1e-005
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 326 REYRRGLGGGMTG-LNSISPLKKSFSNNQVPSQKFPRNTSGFNHKAWVEDGMSRGDS 381
           |..||    |. | .| |||||| || | .   || |.|     |.|.|| . | |.
Sbjct: 146 RDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDN 202

>hg18||uc003gnm
        |4|BC103941|Q7Z5Q1-6|Q7Z5Q1-6|CPEB2|NM_182646|NP_872587|cytoplasmic
        polyadenylation element binding

          Length = 567

 Score =  50 bits (118), Expect = 1e-005
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 326 REYRRGLGGGMTG-LNSISPLKKSFSNNQVPSQKFPRNTSGFNHKAWVEDGMSRGDS 381
           |..||    |. | .| |||||| || | .   || |.|     |.|.|| . | |.
Sbjct: 146 RDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDN 202

>hg18||uc002lsl |19|CR608914|Q96EP5|DAZP1_HUMAN|DAZAP1|NM_018959|NP_061832|DAZ
        associated protein 1 isoform b

          Length = 406

 Score =  44 bits (101), Expect = 9e-004
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 502 SRKVFVGGLPPDIDEDEITASFRRFGHLI-VDWPHKAESKSYFPPKGYAFLLFQDESSVQ 560
           | |.||||.| .  | |.   |..|| .  |   . || .    |.|. |. |.|| || 
Sbjct: 112 SNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQR---PRGFGFITFEDEQSVD 168

Query: 561 ALID 564
             ..
Sbjct: 169 QAVN 172

>hg18||uc002lsm |19|NM_170711|Q96EP5-2|Q96EP5-2|DAZAP1|NM_170711|NP_733829|DAZ
        associated protein 1 isoform a

          Length = 378

 Score =  44 bits (101), Expect = 9e-004
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 502 SRKVFVGGLPPDIDEDEITASFRRFGHLI-VDWPHKAESKSYFPPKGYAFLLFQDESSVQ 560
           | |.||||.| .  | |.   |..|| .  |   . || .    |.|. |. |.|| || 
Sbjct: 112 SNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQR---PRGFGFITFEDEQSVD 168

Query: 561 ALID 564
             ..
Sbjct: 169 QAVN 172

>hg18||uc002lsn |19|NM_018959|Q96EP5|DAZP1_HUMAN|DAZAP1|NM_018959|NP_061832|DAZ
        associated protein 1 isoform b

          Length = 407

 Score =  44 bits (101), Expect = 9e-004
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 502 SRKVFVGGLPPDIDEDEITASFRRFGHLI-VDWPHKAESKSYFPPKGYAFLLFQDESSVQ 560
           | |.||||.| .  | |.   |..|| .  |   . || .    |.|. |. |.|| || 
Sbjct: 112 SNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQR---PRGFGFITFEDEQSVD 168

Query: 561 ALID 564
             ..
Sbjct: 169 QAVN 172

>hg18||uc002lso |19|CR601549|Q96EP5|DAZP1_HUMAN|DAZAP1|NM_018959|NP_061832|DAZ
        associated protein 1 isoform b

          Length = 406

 Score =  44 bits (101), Expect = 9e-004
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 502 SRKVFVGGLPPDIDEDEITASFRRFGHLI-VDWPHKAESKSYFPPKGYAFLLFQDESSVQ 560
           | |.||||.| .  | |.   |..|| .  |   . || .    |.|. |. |.|| || 
Sbjct: 111 SNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQR---PRGFGFITFEDEQSVD 167

Query: 561 ALID 564
             ..
Sbjct: 168 QAVN 171

>hg18||uc003hmr
        |4|NM_031372|Q96IM0|Q96IM0_HUMAN|HNRPDL|NM_031372|NP_112740|heterogeneo
        us nuclear ribonucleoprotein D-like

          Length = 420

 Score =  43 bits (99), Expect = 0.002
 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 503 RKVFVGGLPPDIDEDEITASFRRFGHL-IVDWPHKAESKSYFPPKGYAFLLFQDESSVQA 561
           .||||||| ||  |..|   |  || .  .. |   ..      .|. |. . ||  |. 
Sbjct: 233 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNE---RRGFCFITYTDEEPVKK 289

Query: 562 LIDACIQE--EGKLYLCVSSP 580
           |...   .   ||  . |. |
Sbjct: 290 LLESRYHQIGSGKCEIKVAQP 310

>hg18||uc003hmt
        |4|AB066484|O14979|O14979_HUMAN|HNRPDL|NM_031372|NP_112740|heterogeneou
        s nuclear ribonucleoprotein D-like

          Length = 363

 Score =  43 bits (99), Expect = 0.002
 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 503 RKVFVGGLPPDIDEDEITASFRRFGHL-IVDWPHKAESKSYFPPKGYAFLLFQDESSVQA 561
           .||||||| ||  |..|   |  || .  .. |   ..      .|. |. . ||  |. 
Sbjct: 233 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNE---RRGFCFITYTDEEPVKK 289

Query: 562 LIDACIQE--EGKLYLCVSSP 580
           |...   .   ||  . |. |
Sbjct: 290 LLESRYHQIGSGKCEIKVAQP 310

>hg18||uc003mcu
        |5|BC036899|Q17RY0-3|Q17RY0-3|CPEB4|NM_030627|NP_085130|cytoplasmic
        polyadenylation element binding

          Length = 322

 Score =  42 bits (97), Expect = 0.003
 Identities = 21/31 (67%), Positives = 26/31 (83%), Gaps = 1/31 (3%)

Query: 413 MHSLENSLIDIMRAEQDSLKGRYS-FPHQGG 442
           |||||.||||||||| |..||. | || . |
Sbjct:   1 MHSLESSLIDIMRAENDTIKGQSSLFPMEDG 31

>hg18||uc001khv
        |10|AB023157|Q8NE35-2|Q8NE35-2|CPEB3|NM_014912|NP_055727|cytoplasmic
        polyadenylation element binding

          Length = 684

 Score =  42 bits (96), Expect = 0.004
 Identities = 26/56 (46%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 175 SPAVPPTQSPIVGEDIGGFFGPASTNANGPHLLFQNFSHHTGPGFGAGGTFSPQIG 230
           ||.   | |      .   |    |  ||  .||||| ||  | |  |||||||||
Sbjct: 104 SPSFGSTWSTGTTNAVEDSFFQGITPVNGT-MLFQNFPHHVNPVF--GGTFSPQIG 156

>hg18||uc001khw
        |10|NM_014912|Q8NE35|CPEB3_HUMAN|CPEB3|NM_014912|NP_055727|cytoplasmic
        polyadenylation element binding

          Length = 698

 Score =  42 bits (96), Expect = 0.004
 Identities = 26/56 (46%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 175 SPAVPPTQSPIVGEDIGGFFGPASTNANGPHLLFQNFSHHTGPGFGAGGTFSPQIG 230
           ||.   | |      .   |    |  ||  .||||| ||  | |  |||||||||
Sbjct: 104 SPSFGSTWSTGTTNAVEDSFFQGITPVNGT-MLFQNFPHHVNPVF--GGTFSPQIG 156

>hg18||uc003miu
        |5|NM_031266|Q99729-2|Q99729-2|HNRPAB|NM_031266|NP_112556|heterogeneous
        nuclear ribonucleoprotein AB

          Length = 332

 Score =  42 bits (96), Expect = 0.004
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 5/81 (6%)

Query: 493 LNGERVERFSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLL 552
           .|  . |  . |.|||||  |  . ..   | .||  .||   | .  .    .|. |.|
Sbjct:  60 INASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGE-VVDCTIKMDPNT-GRSRGFGFIL 117

Query: 553 FQDESSVQALIDACIQEEGKL 573
           |.| .||. ..|   |.| .|
Sbjct: 118 FKDAASVEKVLD---QKEHRL 135

>hg18||uc003miv
        |5|NM_004499|Q99729-3|Q99729-3|HNRPAB|NM_004499|NP_004490|heterogeneous
        nuclear ribonucleoprotein AB

          Length = 285

 Score =  42 bits (96), Expect = 0.004
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 5/81 (6%)

Query: 493 LNGERVERFSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLL 552
           .|  . |  . |.|||||  |  . ..   | .||  .||   | .  .    .|. |.|
Sbjct:  60 INASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGE-VVDCTIKMDPNT-GRSRGFGFIL 117

Query: 553 FQDESSVQALIDACIQEEGKL 573
           |.| .||. ..|   |.| .|
Sbjct: 118 FKDAASVEKVLD---QKEHRL 135

>hg18||uc003miw
        |5|CR609806|Q99729-2|Q99729-2|HNRPAB|NM_031266|NP_112556|heterogeneous
        nuclear ribonucleoprotein AB

          Length = 332

 Score =  42 bits (96), Expect = 0.004
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 5/81 (6%)

Query: 493 LNGERVERFSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLL 552
           .|  . |  . |.|||||  |  . ..   | .||  .||   | .  .    .|. |.|
Sbjct:  60 INASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGE-VVDCTIKMDPNT-GRSRGFGFIL 117

Query: 553 FQDESSVQALIDACIQEEGKL 573
           |.| .||. ..|   |.| .|
Sbjct: 118 FKDAASVEKVLD---QKEHRL 135

>hg18||uc003mix
        |5|CR590133|Q99729-3|Q99729-3|HNRPAB|NM_004499|NP_004490|heterogeneous
        nuclear ribonucleoprotein AB

          Length = 285

 Score =  42 bits (96), Expect = 0.004
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 5/81 (6%)

Query: 493 LNGERVERFSRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFLL 552
           .|  . |  . |.|||||  |  . ..   | .||  .||   | .  .    .|. |.|
Sbjct:  60 INASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGE-VVDCTIKMDPNT-GRSRGFGFIL 117

Query: 553 FQDESSVQALIDACIQEEGKL 573
           |.| .||. ..|   |.| .|
Sbjct: 118 FKDAASVEKVLD---QKEHRL 135

>hg18||uc003hmm
        |4|NM_031370|Q14103|HNRPD_HUMAN|HNRPD|NM_031370|NP_112738|heterogeneous
        nuclear ribonucleoprotein D

          Length = 355

 Score =  38 bits (87), Expect = 0.039
 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 503 RKVFVGGLPPDIDEDEITASFRRFGHL-IVDWPHKAESKSYFPPKGYAFLLFQDESSVQA 561
           .|.||||| ||  |..|   |  || .  .. |   ..      .|. |. |..|  |. 
Sbjct: 182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNK---RRGFCFITFKEEEPVKK 238

Query: 562 LIDACIQEEGKLYLCVSSPTIKDKPVQIRPW 592
           ...      |     .     |..  | . |
Sbjct: 239 IMEKKYHNVGLSKCEIKVAMSKEQYQQQQQW 269

>hg18||uc003hmn
        |4|NM_031369|Q14103-2|Q14103-2|HNRPD|NM_031369|NP_112737|heterogeneous
        nuclear ribonucleoprotein D

          Length = 336

 Score =  38 bits (87), Expect = 0.039
 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 503 RKVFVGGLPPDIDEDEITASFRRFGHL-IVDWPHKAESKSYFPPKGYAFLLFQDESSVQA 561
           .|.||||| ||  |..|   |  || .  .. |   ..      .|. |. |..|  |. 
Sbjct: 163 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNK---RRGFCFITFKEEEPVKK 219

Query: 562 LIDACIQEEGKLYLCVSSPTIKDKPVQIRPW 592
           ...      |     .     |..  | . |
Sbjct: 220 IMEKKYHNVGLSKCEIKVAMSKEQYQQQQQW 250

>hg18||uc003hmo
        |4|NM_002138|Q14103-3|Q14103-3|HNRPD|NM_002138|NP_002129|heterogeneous
        nuclear ribonucleoprotein D

          Length = 306

 Score =  38 bits (87), Expect = 0.039
 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 503 RKVFVGGLPPDIDEDEITASFRRFGHL-IVDWPHKAESKSYFPPKGYAFLLFQDESSVQA 561
           .|.||||| ||  |..|   |  || .  .. |   ..      .|. |. |..|  |. 
Sbjct: 182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNK---RRGFCFITFKEEEPVKK 238

Query: 562 LIDACIQEEGKLYLCVSSPTIKDKPVQIRPW 592
           ...      |     .     |..  | . |
Sbjct: 239 IMEKKYHNVGLSKCEIKVAMSKEQYQQQQQW 269

>hg18||uc003hmp
        |4|NM_001003810|Q14103-4|Q14103-4|HNRPD|NM_001003810|NP_001003810|heter
        ogeneous nuclear ribonucleoprotein D

          Length = 287

 Score =  38 bits (87), Expect = 0.039
 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 503 RKVFVGGLPPDIDEDEITASFRRFGHL-IVDWPHKAESKSYFPPKGYAFLLFQDESSVQA 561
           .|.||||| ||  |..|   |  || .  .. |   ..      .|. |. |..|  |. 
Sbjct: 163 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNK---RRGFCFITFKEEEPVKK 219

Query: 562 LIDACIQEEGKLYLCVSSPTIKDKPVQIRPW 592
           ...      |     .     |..  | . |
Sbjct: 220 IMEKKYHNVGLSKCEIKVAMSKEQYQQQQQW 250

>hg18||uc003hir
        |4|NM_012297|Q9UN86|G3BP2_HUMAN|G3BP2|NM_012297|NP_036429|Ras-GTPase
        activating protein SH3 domain-binding

          Length = 482

 Score =  38 bits (86), Expect = 0.051
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 4/74 (5%)

Query: 494 NGERVERF--SRKVFVGGLPPDIDEDEITASFRRFGHLIVDWPHKAESKSYFPPKGYAFL 551
           .  |. |.  | ..||| || ||||.|.   |  ||...    .        |   . |.
Sbjct: 320 DNRRIIRYPDSHQLFVGNLPHDIDENELKEFFMSFGNVVELRINTKGVGGKLP--NFGFV 377

Query: 552 LFQDESSVQALIDA 565
           .| |   || .. |
Sbjct: 378 VFDDSEPVQRILIA 391

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0