BLASTP 7.6.0


Query=fugu4_571632 |jgi|Takru4|571632|e_gw2.402.44.1
        (249 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc004aya |9|NM_006401|Q92688|AN32B_HUMAN|ANP32B|NM_006401|...    225   5e-059
hg18||uc002arl |15|NM_006305|P39687|AN32A_HUMAN|ANP32A|NM_006305...    222   3e-058
hg18||uc001etv |1|AL833660|Q5TB18|Q5TB18_HUMAN|ANP32E|NM_030920|...    191   1e-048
hg18||uc001etw |1|NM_030920|Q9BTT0|AN32E_HUMAN|ANP32E|NM_030920|...    191   1e-048
hg18||uc003iqt |4|NM_012403|O43423|AN32C_HUMAN|ANP32C|NM_012403|...    178   6e-045
hg18||uc001rrq |12|NM_012404|O95626|AN32D_HUMAN|ANP32D|NM_012404...    161   9e-040
hg18||uc003ytk |8|NM_012472|Q86X45|LRRC6_HUMAN|LRRC6|NM_012472|N...     39   0.007
hg18||uc001tbm |12|NM_002345|P51884|LUM_HUMAN|LUM|NM_002345|NP_0...     35   0.100
hg18||uc001nvf |11|NM_006362|Q9UBU9|NXF1_HUMAN|NXF1|NM_006362|NP...     32   0.850
hg18||uc001vln |13|NM_015567|O94991|SLIK5_HUMAN|SLITRK5|NM_01556...     32   0.850
hg18||uc001dnh |1|BC030607|Q6P9F7|LRC8B_HUMAN|LRRC8B|NM_015350|N...     30   1.894
hg18||uc001dni |1|BC060782|Q6P9F7|LRC8B_HUMAN|LRRC8B|NM_015350|N...     30   1.894
hg18||uc001dnj |1|NM_015350|Q6P9F7|LRC8B_HUMAN|LRRC8B|NM_015350|...     30   1.894
hg18||uc002dai |16|NM_000246|P33076|C2TA_HUMAN|CIITA|NM_000246|N...     30   1.894
hg18||uc002daj |16|BC007430|P33076|C2TA_HUMAN|CIITA|NM_000246|NP...     30   1.894
hg18||uc002dak |16|AY084054|Q8SNB8|Q8SNB8_HUMAN|CIITA|NM_000246|...     30   1.894
hg18||uc003gqm |4|NM_145290|Q8IWK6|GP125_HUMAN|GPR125|NM_145290|...     30   2.474
hg18||uc003gqo |4|AY358306|Q8IWK6-2|Q8IWK6-2|GPR125|NM_145290|NP...     30   2.474
hg18||uc002dai |16|NM_000246|P33076|C2TA_HUMAN|CIITA|NM_000246|N...     30   3.232
hg18||uc002daj |16|BC007430|P33076|C2TA_HUMAN|CIITA|NM_000246|NP...     30   3.232
hg18||uc002dak |16|AY084054|Q8SNB8|Q8SNB8_HUMAN|CIITA|NM_000246|...     30   3.232
hg18||uc002hgj |17|NM_002544|P23515|OMGP_HUMAN|OMG|NM_002544|NP_...     30   3.232
hg18||uc002cos |16|NM_001009944|P98161|PKD1_HUMAN|PKD1|NM_001009...     28   7.199
hg18||uc002cot |16|NM_000296|P98161-3|P98161-3|PKD1|NM_000296|NP...     28   7.199
hg18||uc002pss |19|NM_001080457|Q9NT99|LRC4B_HUMAN|LRRC4B|NM_001...     28   7.199
hg18||uc003fwv |3|NM_198565|Q86YC3|LRC33_HUMAN|LRRC33|NM_198565|...     28   7.199
hg18||uc003gpr |4|NM_004787|O94813|SLIT2_HUMAN|SLIT2|NM_004787|N...     28   7.199
hg18||uc003gps |4|AF055585|O94813-3|O94813-3|SLIT2|NM_004787|NP_...     28   7.199
hg18||uc002cjc |16|NM_153350|Q8N461|FXL16_HUMAN|FBXL16|NM_153350...     28   9.402
hg18||uc002gsa |17|BC050665|NA|NA|LRRC48|NM_031294|NP_112584|leu...     28   9.402
hg18||uc002gsb |17|NM_031294|NA|NA|LRRC48|NM_031294|NP_112584|le...     28   9.402

>hg18||uc004aya
        |9|NM_006401|Q92688|AN32B_HUMAN|ANP32B|NM_006401|NP_006392|acidic
        (leucine-rich) nuclear phosphoprotein 32

          Length = 251

 Score =  225 bits (572), Expect = 5e-059
 Identities = 113/155 (72%), Positives = 130/155 (83%)

Query:   1 MDMNKRVNLELRHRPPSEVKELVLDNCRSDDGKIEGITAEFSNLELLSLINVGLSSVAEI 60
           ||| .|..||||.| |. |.|||||||.|.||||||.|||| ||| |||||||| ||. .
Sbjct:   1 MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNL 60

Query:  61 PXXXXXXXXXXSDNRISGGLEVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDL 120
           |          |.||| |||..|||.| ||||||||||| ||||||||||||  ||||||
Sbjct:  61 PKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDL 120

Query: 121 FNCEVTNLGDYRESIFKLLPQLTYLDGYDIDDCEA 155
           |||||||| |||||.|||||||||||||| .| ||
Sbjct: 121 FNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQEA 155

>hg18||uc002arl
        |15|NM_006305|P39687|AN32A_HUMAN|ANP32A|NM_006305|NP_006296|acidic
        (leucine-rich) nuclear phosphoprotein 32

          Length = 249

 Score =  222 bits (565), Expect = 3e-058
 Identities = 109/155 (70%), Positives = 128/155 (82%)

Query:   1 MDMNKRVNLELRHRPPSEVKELVLDNCRSDDGKIEGITAEFSNLELLSLINVGLSSVAEI 60
           |.| .|..||||.| ||.|||||||| ||..||.||.| ||  || || |||||.|.| .
Sbjct:   1 MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANL 60

Query:  61 PXXXXXXXXXXSDNRISGGLEVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDL 120
           |          ||||.|||||||||.  ||||||||||| ||.||.||||||  ||||||
Sbjct:  61 PKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL 120

Query: 121 FNCEVTNLGDYRESIFKLLPQLTYLDGYDIDDCEA 155
           |||||||| ||||..|||||||||||||| || ||
Sbjct: 121 FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEA 155

>hg18||uc001etv
        |1|AL833660|Q5TB18|Q5TB18_HUMAN|ANP32E|NM_030920|NP_112182|acidic
        (leucine-rich) nuclear phosphoprotein 32

          Length = 267

 Score =  191 bits (483), Expect = 1e-048
 Identities = 97/155 (62%), Positives = 117/155 (75%)

Query:   1 MDMNKRVNLELRHRPPSEVKELVLDNCRSDDGKIEGITAEFSNLELLSLINVGLSSVAEI 60
           |.| |..|||||.| | || |||||||   .|.|||.   |  || ||. || |||.| .
Sbjct:   1 MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARL 60

Query:  61 PXXXXXXXXXXSDNRISGGLEVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDL 120
           |          ||| ||||||||||.  |||.||||||| ||.||.| |. |  ||||||
Sbjct:  61 PSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDL 120

Query: 121 FNCEVTNLGDYRESIFKLLPQLTYLDGYDIDDCEA 155
           ||||.||| |||||||.|| |.|||||.| .| ||
Sbjct: 121 FNCEITNLEDYRESIFELLQQITYLDGFDQEDNEA 155

>hg18||uc001etw
        |1|NM_030920|Q9BTT0|AN32E_HUMAN|ANP32E|NM_030920|NP_112182|acidic
        (leucine-rich) nuclear phosphoprotein 32

          Length = 268

 Score =  191 bits (483), Expect = 1e-048
 Identities = 97/155 (62%), Positives = 117/155 (75%)

Query:   1 MDMNKRVNLELRHRPPSEVKELVLDNCRSDDGKIEGITAEFSNLELLSLINVGLSSVAEI 60
           |.| |..|||||.| | || |||||||   .|.|||.   |  || ||. || |||.| .
Sbjct:   1 MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARL 60

Query:  61 PXXXXXXXXXXSDNRISGGLEVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDL 120
           |          ||| ||||||||||.  |||.||||||| ||.||.| |. |  ||||||
Sbjct:  61 PSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDL 120

Query: 121 FNCEVTNLGDYRESIFKLLPQLTYLDGYDIDDCEA 155
           ||||.||| |||||||.|| |.|||||.| .| ||
Sbjct: 121 FNCEITNLEDYRESIFELLQQITYLDGFDQEDNEA 155

>hg18||uc003iqt
        |4|NM_012403|O43423|AN32C_HUMAN|ANP32C|NM_012403|NP_036535|acidic
        nuclear phosphoprotein 32C

          Length = 234

 Score =  178 bits (451), Expect = 6e-045
 Identities = 93/155 (60%), Positives = 116/155 (74%), Gaps = 4/155 (2%)

Query:   1 MDMNKRVNLELRHRPPSEVKELVLDNCRSDDGKIEGITAEFSNLELLSLINVGLSSVAEI 60
           |.| .|.. |||.| ||.|||| ||| ||..||.| .| ||  || || || ||.|....
Sbjct:   1 MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDL 60

Query:  61 PXXXXXXXXXXSDNRISGGLEVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDL 120
           |           . |.|||||||||.  ||||| ||||| ||.||.||||.|  ||||||
Sbjct:  61 PKLKLRKL----ELRVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDL 116

Query: 121 FNCEVTNLGDYRESIFKLLPQLTYLDGYDIDDCEA 155
           |||||||| || |..|||| ||||||    |  ||
Sbjct: 117 FNCEVTNLNDYGENVFKLLLQLTYLDSCYWDHKEA 151

>hg18||uc001rrq
        |12|NM_012404|O95626|AN32D_HUMAN|ANP32D|NM_012404|NP_036536|acidic
        nuclear phosphoprotein 32D

          Length = 131

 Score =  161 bits (406), Expect = 9e-040
 Identities = 80/131 (61%), Positives = 100/131 (76%)

Query:   1 MDMNKRVNLELRHRPPSEVKELVLDNCRSDDGKIEGITAEFSNLELLSLINVGLSSVAEI 60
           |.| | ..||||.| ||.|||| ||| .|..||.||.| ||  ||||. ||.||.|.| .
Sbjct:   1 MEMGKWIHLELRNRTPSDVKELFLDNSQSNEGKLEGLTDEFEELELLNTINIGLTSIANL 60

Query:  61 PXXXXXXXXXXSDNRISGGLEVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDL 120
           |          | || | |||||||.  || |||||||| ||.||.||||||  |.||||
Sbjct:  61 PKLNKLKKLELSSNRASVGLEVLAEKCPNLIHLNLSGNKIKDLSTIEPLKKLENLESLDL 120

Query: 121 FNCEVTNLGDY 131
           | |||||| .|
Sbjct: 121 FTCEVTNLNNY 131

>hg18||uc003ytk
        |8|NM_012472|Q86X45|LRRC6_HUMAN|LRRC6|NM_012472|NP_036604|leucine rich
        repeat containing 6

          Length = 466

 Score =  39 bits (88), Expect = 0.007
 Identities = 22/65 (33%), Positives = 35/65 (53%)

Query:  90 LTHLNLSGNKFKDISTLEPLKKLPQLKSLDLFNCEVTNLGDYRESIFKLLPQLTYLDGYD 149
           |  |.|. |   ..|... |.    || | |      .   ||| .   |||| .||| .
Sbjct:  90 LAKLDLTVNFIGELSSIKNLQHNIHLKELFLMGNPCASFDHYREFVVATLPQLKWLDGKE 149

Query: 150 IDDCE 154
           |.  |
Sbjct: 150 IEPSE 154

>hg18||uc001tbm |12|NM_002345|P51884|LUM_HUMAN|LUM|NM_002345|NP_002336|lumican
        precursor

          Length = 338

 Score =  35 bits (78), Expect = 0.100
 Identities = 31/116 (26%), Positives = 58/116 (50%), Gaps = 10/116 (8%)

Query:  17 SEVKELVLDNCRSDDGKIEGITAEFSNLELLSLINVGLSSVAEI--PXXXXXXXXXXSDN 74
           .... |.||.   .. ||.|    || |. |  ...  ... |   |          . |
Sbjct:  90 TDLQWLILDHNLLENSKIKG--RVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHN 147

Query:  75 RIS--GGLEVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDLFNCEVTNL 128
           .|.  |      | ||||| ..|  |. |. .     | |  |. |||   ..  |
Sbjct: 148 KITKLGSF----EGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARL 199

>hg18||uc001nvf |11|NM_006362|Q9UBU9|NXF1_HUMAN|NXF1|NM_006362|NP_006353|nuclear
        RNA export factor 1 isoform 1

          Length = 619

 Score =  32 bits (70), Expect = 0.850
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 13/88 (14%)

Query:  72 SDNRI--SGGLEVLAERLVNLTHLNLSGNKFKDISTLEPLK--KLPQL-----KSLDLFN 122
           |.||.     .  . ..  ||  ||||||. |    |. .|  || .|        | | 
Sbjct: 273 SNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFR 332

Query: 123 CEVTNLGDYRESIFKLLPQLTYLDGYDI 150
            . | .   ||      |.|  |||...
Sbjct: 333 DQSTYISAIRER----FPKLLRLDGHEL 356

>hg18||uc001vln
        |13|NM_015567|O94991|SLIK5_HUMAN|SLITRK5|NM_015567|NP_056382|SLIT and
        NTRK-like family, member 5

          Length = 958

 Score =  32 bits (70), Expect = 0.850
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query:  86 RLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDL------FNCEVTNLGDYRESI 135
           | | ||||.| ||. | .  .  |. . ..  | |       .||. .| |. .||
Sbjct: 198 RFVPLTHLDLRGNRLKLLPYVGLLQHMDKVVELQLEENPWNCSCELISLKDWLDSI 253

>hg18||uc001dnh |1|BC030607|Q6P9F7|LRC8B_HUMAN|LRRC8B|NM_015350|NP_056165|T-cell
        activation leucine repeat-rich protein

          Length = 803

 Score =  30 bits (67), Expect = 1.894
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query:  81 EVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDLFNCEVTNLGDYRESIFKL 138
           .|. . | .|  |.|  |.   .  |  |||.  ||||.| .|..  .     ||| |
Sbjct: 554 QVVTDLLPSLQKLSLD-NEGSKLVVLNNLKKMVNLKSLELISCDLERI---PHSIFSL 607

>hg18||uc001dni |1|BC060782|Q6P9F7|LRC8B_HUMAN|LRRC8B|NM_015350|NP_056165|T-cell
        activation leucine repeat-rich protein

          Length = 803

 Score =  30 bits (67), Expect = 1.894
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query:  81 EVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDLFNCEVTNLGDYRESIFKL 138
           .|. . | .|  |.|  |.   .  |  |||.  ||||.| .|..  .     ||| |
Sbjct: 554 QVVTDLLPSLQKLSLD-NEGSKLVVLNNLKKMVNLKSLELISCDLERI---PHSIFSL 607

>hg18||uc001dnj
        |1|NM_015350|Q6P9F7|LRC8B_HUMAN|LRRC8B|NM_015350|NP_056165|T-cell
        activation leucine repeat-rich protein

          Length = 803

 Score =  30 bits (67), Expect = 1.894
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query:  81 EVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDLFNCEVTNLGDYRESIFKL 138
           .|. . | .|  |.|  |.   .  |  |||.  ||||.| .|..  .     ||| |
Sbjct: 554 QVVTDLLPSLQKLSLD-NEGSKLVVLNNLKKMVNLKSLELISCDLERI---PHSIFSL 607

>hg18||uc002dai |16|NM_000246|P33076|C2TA_HUMAN|CIITA|NM_000246|NP_000237|class
        II transactivator

          Length = 1130

 Score =  30 bits (67), Expect = 1.894
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query:   72 SDNRIS----GGLEVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKS----LDLFNC 123
            |.|.|       |     .| .|  |||| |   |.   .  . || | .    | |.| 
Sbjct:  995 SENKIGDEGVSQLSATFPQLKSLETLNLSQNNITDLGAYKLAEALPSLAASLLRLSLYNN 1054

Query:  124 EVTNLGDYRESIFKLLPQLTYLDGYDI 150
             . ..|   ||. ..|| .  |   |.
Sbjct: 1055 CICDVG--AESLARVLPDMVSLRVMDV 1079

>hg18||uc002daj |16|BC007430|P33076|C2TA_HUMAN|CIITA|NM_000246|NP_000237|class
        II transactivator

          Length = 1131

 Score =  30 bits (67), Expect = 1.894
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query:   72 SDNRIS----GGLEVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKS----LDLFNC 123
            |.|.|       |     .| .|  |||| |   |.   .  . || | .    | |.| 
Sbjct:  996 SENKIGDEGVSQLSATFPQLKSLETLNLSQNNITDLGAYKLAEALPSLAASLLRLSLYNN 1055

Query:  124 EVTNLGDYRESIFKLLPQLTYLDGYDI 150
             . ..|   ||. ..|| .  |   |.
Sbjct: 1056 CICDVG--AESLARVLPDMVSLRVMDV 1080

>hg18||uc002dak |16|AY084054|Q8SNB8|Q8SNB8_HUMAN|CIITA|NM_000246|NP_000237|class
        II transactivator

          Length = 546

 Score =  30 bits (67), Expect = 1.894
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query:  72 SDNRIS----GGLEVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKS----LDLFNC 123
           |.|.|       |     .| .|  |||| |   |.   .  . || | .    | |.| 
Sbjct: 411 SENKIGDEGVSQLSATFPQLKSLETLNLSQNNITDLGAYKLAEALPSLAASLLRLSLYNN 470

Query: 124 EVTNLGDYRESIFKLLPQLTYLDGYDI 150
            . ..|   ||. ..|| .  |   |.
Sbjct: 471 CICDVG--AESLARVLPDMVSLRVMDV 495

>hg18||uc003gqm |4|NM_145290|Q8IWK6|GP125_HUMAN|GPR125|NM_145290|NP_660333|G
        protein-coupled receptor 125

          Length = 1321

 Score =  30 bits (66), Expect = 2.474
 Identities = 32/105 (30%), Positives = 45/105 (42%), Gaps = 5/105 (4%)

Query:  16 PSEVKELVLDNCRSDDGKIEGITAEFSNLELLSLINVGLSSV--AEIPXXXXXXXXXXSD 73
           |.    |.| | .  . |  |  .  | || | | |  .||.                ..
Sbjct:  80 PNRTVTLILSNNKISELK-NGSFSGLSLLERLDLRNNLISSIDPGAFWGLSSLKRLDLTN 138

Query:  74 NRISGGLEVLAERLVNLTHLNLSGNKFKDIS--TLEPLKKLPQLK 116
           |||      .   | ||  |||||| |  .|  | . |  |  |.
Sbjct: 139 NRIGCLNADIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRSLE 183

>hg18||uc003gqo |4|AY358306|Q8IWK6-2|Q8IWK6-2|GPR125|NM_145290|NP_660333|G
        protein-coupled receptor 125

          Length = 616

 Score =  30 bits (66), Expect = 2.474
 Identities = 32/105 (30%), Positives = 45/105 (42%), Gaps = 5/105 (4%)

Query:  16 PSEVKELVLDNCRSDDGKIEGITAEFSNLELLSLINVGLSSV--AEIPXXXXXXXXXXSD 73
           |.    |.| | .  . |  |  .  | || | | |  .||.                ..
Sbjct:  80 PNRTVTLILSNNKISELK-NGSFSGLSLLERLDLRNNLISSIDPGAFWGLSSLKRLDLTN 138

Query:  74 NRISGGLEVLAERLVNLTHLNLSGNKFKDIS--TLEPLKKLPQLK 116
           |||      .   | ||  |||||| |  .|  | . |  |  |.
Sbjct: 139 NRIGCLNADIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRSLE 183

>hg18||uc002dai |16|NM_000246|P33076|C2TA_HUMAN|CIITA|NM_000246|NP_000237|class
        II transactivator

          Length = 1130

 Score =  30 bits (65), Expect = 3.232
 Identities = 25/74 (33%), Positives = 36/74 (48%), Gaps = 8/74 (10%)

Query:   89 NLTHLN---LSGNKFKDISTLEPLKKLPQLKSLDLFNC---EVTNLGDYR--ESIFKLLP 140
            .| ||.   || ||  |    .     ||||||.  |     .|.|| |.  |..  |  
Sbjct:  985 SLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETLNLSQNNITDLGAYKLAEALPSLAA 1044

Query:  141 QLTYLDGYDIDDCE 154
             |  |  |.   |.
Sbjct: 1045 SLLRLSLYNNCICD 1058

>hg18||uc002daj |16|BC007430|P33076|C2TA_HUMAN|CIITA|NM_000246|NP_000237|class
        II transactivator

          Length = 1131

 Score =  30 bits (65), Expect = 3.232
 Identities = 25/74 (33%), Positives = 36/74 (48%), Gaps = 8/74 (10%)

Query:   89 NLTHLN---LSGNKFKDISTLEPLKKLPQLKSLDLFNC---EVTNLGDYR--ESIFKLLP 140
            .| ||.   || ||  |    .     ||||||.  |     .|.|| |.  |..  |  
Sbjct:  986 SLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETLNLSQNNITDLGAYKLAEALPSLAA 1045

Query:  141 QLTYLDGYDIDDCE 154
             |  |  |.   |.
Sbjct: 1046 SLLRLSLYNNCICD 1059

>hg18||uc002dak |16|AY084054|Q8SNB8|Q8SNB8_HUMAN|CIITA|NM_000246|NP_000237|class
        II transactivator

          Length = 546

 Score =  30 bits (65), Expect = 3.232
 Identities = 25/74 (33%), Positives = 36/74 (48%), Gaps = 8/74 (10%)

Query:  89 NLTHLN---LSGNKFKDISTLEPLKKLPQLKSLDLFNC---EVTNLGDYR--ESIFKLLP 140
           .| ||.   || ||  |    .     ||||||.  |     .|.|| |.  |..  |  
Sbjct: 401 SLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETLNLSQNNITDLGAYKLAEALPSLAA 460

Query: 141 QLTYLDGYDIDDCE 154
            |  |  |.   |.
Sbjct: 461 SLLRLSLYNNCICD 474

>hg18||uc002hgj
        |17|NM_002544|P23515|OMGP_HUMAN|OMG|NM_002544|NP_002535|oligodendrocyte
        myelin glycoprotein

          Length = 440

 Score =  30 bits (65), Expect = 3.232
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 3/91 (3%)

Query:  34 IEGITAEFSNLELLSLINVGLSSVAEIPXX--XXXXXXXXSDNRISGGLEVLAERLVNLT 91
           .| .    . |  | ..|.  . .  .|            |.| ..  |      | |||
Sbjct: 135 LEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLT 194

Query:  92 HLNLSGNKFKDISTLEPLKKLPQLKSLDLFN 122
           || |  |||  |   .   .| ||. . |.|
Sbjct: 195 HLYLHNNKFTFIPD-QSFDQLFQLQEITLYN 224

>hg18||uc002cos
        |16|NM_001009944|P98161|PKD1_HUMAN|PKD1|NM_001009944|NP_001009944|polyc
        ystin 1 isoform 1 precursor

          Length = 4303

 Score =  28 bits (62), Expect = 7.199
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query:  46 LLSLINVGLSSVAEIPXXXXXXXXXXSDNRISGGLEVLAERLVNLTHLNLSGNKFK 101
           ||  ..|||     .           |.|.||   | .   | ||. .||||| |.
Sbjct:  78 LLRALDVGL-----LANLSALAELDISNNKISTLEEGIFANLFNLSEINLSGNPFE 128

>hg18||uc002cot
        |16|NM_000296|P98161-3|P98161-3|PKD1|NM_000296|NP_000287|polycystin 1
        isoform 2 precursor

          Length = 4302

 Score =  28 bits (62), Expect = 7.199
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query:  46 LLSLINVGLSSVAEIPXXXXXXXXXXSDNRISGGLEVLAERLVNLTHLNLSGNKFK 101
           ||  ..|||     .           |.|.||   | .   | ||. .||||| |.
Sbjct:  78 LLRALDVGL-----LANLSALAELDISNNKISTLEEGIFANLFNLSEINLSGNPFE 128

>hg18||uc002pss
        |19|NM_001080457|Q9NT99|LRC4B_HUMAN|LRRC4B|NM_001080457|NP_001073926|le
        ucine rich repeat containing 4B

          Length = 713

 Score =  28 bits (62), Expect = 7.199
 Identities = 16/36 (44%), Positives = 20/36 (55%)

Query:  81 EVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLK 116
           |   | |||| .|||     |||  |  | .| .|.
Sbjct: 200 EAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELE 235

>hg18||uc003fwv
        |3|NM_198565|Q86YC3|LRC33_HUMAN|LRRC33|NM_198565|NP_940967|leucine rich
        repeat containing 33

          Length = 692

 Score =  28 bits (62), Expect = 7.199
 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query:  73 DNRISGGLEVLA---ERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDLFNCEVTNLG 129
           || .|   |  |     |  |  |.||||   .      |. |  |.|. |    .  | 
Sbjct: 114 DNCLSENYEETAAALHALPGLRRLDLSGNALTEDMAALMLQNLSSLRSVSLAGNTIMRLD 173

Query: 130 DYRESIFKLLPQLTYLD 146
           |   |.|. | .|  ||
Sbjct: 174 D---SVFEGLERLRELD 187

>hg18||uc003gpr |4|NM_004787|O94813|SLIT2_HUMAN|SLIT2|NM_004787|NP_004778|slit
        homolog 2

          Length = 1529

 Score =  28 bits (62), Expect = 7.199
 Identities = 12/36 (33%), Positives = 22/36 (61%)

Query:  93 LNLSGNKFKDISTLEPLKKLPQLKSLDLFNCEVTNL 128
           | |. |.|  .      ||||||. ..  | ..|..
Sbjct: 538 LRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDI 573

>hg18||uc003gps |4|AF055585|O94813-3|O94813-3|SLIT2|NM_004787|NP_004778|slit
        homolog 2

          Length = 1521

 Score =  28 bits (62), Expect = 7.199
 Identities = 12/36 (33%), Positives = 22/36 (61%)

Query:  93 LNLSGNKFKDISTLEPLKKLPQLKSLDLFNCEVTNL 128
           | |. |.|  .      ||||||. ..  | ..|..
Sbjct: 530 LRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDI 565

>hg18||uc002cjc
        |16|NM_153350|Q8N461|FXL16_HUMAN|FBXL16|NM_153350|NP_699181|F-box and
        leucine-rich repeat protein 16

          Length = 479

 Score =  28 bits (61), Expect = 9.402
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query:  79 GLEVLAERLVNLTHLNLSG-NKFKDISTLEPLKKLPQLKSLDLFNCEVTNLGDYRESIFK 137
           ||||. |..  .  | ||| | | .      |    .. || . .| .    |   .| .
Sbjct: 209 GLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLS--ARITSLSVSDC-INVADDAIAAISQ 265

Query: 138 LLPQLT--YLDGYDIDD 152
           ||| |    |  | . |
Sbjct: 266 LLPNLAELSLQAYHVTD 282

>hg18||uc002gsa |17|BC050665|NA|NA|LRRC48|NM_031294|NP_112584|leucine rich
        repeat containing 48

          Length = 274

 Score =  28 bits (61), Expect = 9.402
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 5/89 (5%)

Query:  40 EFSNLELLSLINVGLSSVAEIPXXXXXXXXXXSDNRISGGLEVLAERLVNLTHLNLSGNK 99
           .| ||  | | |  .  .  .           | | |   .| | . ||||  |.|  |.
Sbjct:  63 QFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIE-TIEGL-DTLVNLEDLSLFNNR 120

Query: 100 FKDISTLEPLKKLPQLKSLDLFNCEVTNL 128
              | .|. | |   |. | | |  . |.
Sbjct: 121 ISKIDSLDALVK---LQVLSLGNNRIDNM 146

>hg18||uc002gsb |17|NM_031294|NA|NA|LRRC48|NM_031294|NP_112584|leucine rich
        repeat containing 48

          Length = 523

 Score =  28 bits (61), Expect = 9.402
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 5/89 (5%)

Query:  40 EFSNLELLSLINVGLSSVAEIPXXXXXXXXXXSDNRISGGLEVLAERLVNLTHLNLSGNK 99
           .| ||  | | |  .  .  .           | | |   .| | . ||||  |.|  |.
Sbjct:  63 QFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIE-TIEGL-DTLVNLEDLSLFNNR 120

Query: 100 FKDISTLEPLKKLPQLKSLDLFNCEVTNL 128
              | .|. | |   |. | | |  . |.
Sbjct: 121 ISKIDSLDALVK---LQVLSLGNNRIDNM 146

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0