BLASTP 7.6.0


Query=fugu4_571596 |jgi|Takru4|571596|e_gw2.179.15.1
        (574 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003xfb |8|NM_001386|Q16555|DPYL2_HUMAN|DPYSL2|NM_001386|...   1015   3e-296
hg18||uc003xfa |8|AB209195|Q59GB4|Q59GB4_HUMAN|DPYSL2|NM_001386|...    950   9e-277
hg18||uc003lon |5|NM_001387|Q14195|DPYL3_HUMAN|DPYSL3|NM_001387|...    869   3e-252
hg18||uc001lla |10|NM_006426|O14531|DPYL4_HUMAN|DPYSL4|NM_006426...    862   2e-250
hg18||uc003gip |4|AK127754|Q14194|DPYL1_HUMAN|CRMP1|NM_001313|NP...    857   6e-249
hg18||uc003giq |4|NM_001313|Q14194|DPYL1_HUMAN|CRMP1|NM_001313|N...    857   6e-249
hg18||uc003loo |5|BC077077|Q6DEN2|Q6DEN2_HUMAN|DPYSL3|NA|NA|DPYS...    848   5e-246
hg18||uc003gio |4|AK122754|Q4W5F1|Q4W5F1_HUMAN|CRMP1|NM_001313|N...    839   3e-243
hg18||uc003gir |4|BC009987|Q4W5F1|Q4W5F1_HUMAN|CRMP1|NM_001313|N...    839   3e-243
hg18||uc003gis |4|NM_001014809|A0EJG6|A0EJG6_HUMAN|CRMP1|NM_0010...    839   3e-243
hg18||uc003gin |4|CR608807|NA|NA|CRMP1|NA|NA|Homo sapiens cDNA F...    647   2e-185
hg18||uc003yly |8|NM_001385|Q14117|DPYS_HUMAN|DPYS|NM_001385|NP_...    601   1e-171
hg18||uc002rhu |2|NM_020134|Q9BPU6|DPYL5_HUMAN|DPYSL5|NM_020134|...    573   2e-163
hg18||uc002rhv |2|BC002874|Q9BPU6|DPYL5_HUMAN|DPYSL5|NM_020134|N...    573   2e-163
hg18||uc002rji |2|NM_004341|P27708|PYR1_HUMAN|CAD|NM_004341|NP_0...     49   2e-005
hg18||uc003ydg |8|NM_198584|Q8N1Q1|CAH13_HUMAN|CA13|NM_198584|NP...     31   3.420
hg18||uc001vas |13|NM_015070|Q5T200-2|Q5T200-2|ZC3H13|NM_015070|...     30   7.620
hg18||uc001vat |13|AK056422|Q5T200-2|Q5T200-2|ZC3H13|NM_015070|N...     30   7.620

>hg18||uc003xfb
        |8|NM_001386|Q16555|DPYL2_HUMAN|DPYSL2|NM_001386|NP_001377|dihydropyrim
        idinase-like 2

          Length = 572

 Score =  1015 bits (2622), Expect = 3e-296
 Identities = 490/570 (85%), Positives = 533/570 (93%)

Query:   4 YQGKKNIPRITSDRLLIKGGKIVNDDQSFCADIYMEDGVIKQIGENLIVPGGVKTIDAHG 63
           ||||||||||||||||||||||||||||| ||||||||.|||||||||||||||||.|| 
Sbjct:   3 YQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHS 62

Query:  64 RMLMPGGIDVHTRFQMPDRGMTSADDFYQGTKAALAGGTTMIIDHVVPEPGVSLLSAFEQ 123
           ||..||||||||||||||.||||||||.||||||||||||||||||||||| |||.||.|
Sbjct:  63 RMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQ 122

Query: 124 WRGWADSKACCDYSLHIDITEWHKGIQEEMEMLVKDHGVNSFLVYLAYKDIFQLTDSQVY 183
           || |||||.|||||||.||.||||||||||| |||||||||||||.|.|| ||||| |.|
Sbjct: 123 WREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIY 182

Query: 184 EVFSVIRDLGAVAQVHAENGDIVAEEQRRILEQGITGPEGHVLSHPEEVEAEAVNRSVTV 243
           || |||||.||.||||||||||.||||.|||. ||||||||||| |||||||||||..|.
Sbjct: 183 EVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITI 242

Query: 244 ANQTNCPLYITKVMSKSAADVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAYV 303
           |||||||||||||||||.|.||||||||||||||||||||||||||||||||||||||.|
Sbjct: 243 ANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFV 302

Query: 304 XXXXXXXXXXXXXYLNSLLSCGDLQVTGSAHCPFNTAQRAVGKDDFSLIPEGVNGTEERM 363
                        .|||||||||||||||||| |||||.|||||.|.||||| |||||||
Sbjct: 303 TSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERM 362

Query: 364 SIIWDKCVVTGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVLWDPDTTKIISA 423
           |.|||| |||||||||||||||||||||.|||||||||||||||||||.||||. | |||
Sbjct: 363 SVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISA 422

Query: 424 KSHNSSVEYNIFEGTEVRGGPLVVISQGKIVLEEGTLHATEGSGRFVPRKPFPDYVYKRI 483
           |.||||.||||||| | || |||||||||||||.|||| ||||||..|||||||.|||||
Sbjct: 423 KTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRI 482

Query: 484 KARSRLAELRGVPRGLYDGPVCEVSITPKAMTPASSAKTSPAKQPNQPVRNLHQSGFSLS 543
           |||||||||||||||||||||||||.||| .|||||||||||||   |||||||||||||
Sbjct: 483 KARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLS 542

Query: 544 GAQVDDNIPRRPTQRIVAPPGGKANITSLG 573
           |||.||||||| ||||||||||.|||||||
Sbjct: 543 GAQIDDNIPRRTTQRIVAPPGGRANITSLG 572

>hg18||uc003xfa
        |8|AB209195|Q59GB4|Q59GB4_HUMAN|DPYSL2|NM_001386|NP_001377|dihydropyrim
        idinase-like 2

          Length = 536

 Score =  950 bits (2454), Expect = 9e-277
 Identities = 457/536 (85%), Positives = 500/536 (93%)

Query:  38 MEDGVIKQIGENLIVPGGVKTIDAHGRMLMPGGIDVHTRFQMPDRGMTSADDFYQGTKAA 97
           ||||.|||||||||||||||||.|| ||..||||||||||||||.||||||||.||||||
Sbjct:   1 MEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAA 60

Query:  98 LAGGTTMIIDHVVPEPGVSLLSAFEQWRGWADSKACCDYSLHIDITEWHKGIQEEMEMLV 157
           ||||||||||||||||| |||.||.||| |||||.|||||||.||.||||||||||| ||
Sbjct:  61 LAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALV 120

Query: 158 KDHGVNSFLVYLAYKDIFQLTDSQVYEVFSVIRDLGAVAQVHAENGDIVAEEQRRILEQG 217
           |||||||||||.|.|| ||||| |.||| |||||.||.||||||||||.||||.|||. |
Sbjct: 121 KDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLG 180

Query: 218 ITGPEGHVLSHPEEVEAEAVNRSVTVANQTNCPLYITKVMSKSAADVIAQARKKGTVVYG 277
           |||||||||| |||||||||||..|.|||||||||||||||||.|.||||||||||||||
Sbjct: 181 ITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYG 240

Query: 278 EPITASLGTDGSHYWSKNWAKAAAYVXXXXXXXXXXXXXYLNSLLSCGDLQVTGSAHCPF 337
           ||||||||||||||||||||||||.|             .|||||||||||||||||| |
Sbjct: 241 EPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTF 300

Query: 338 NTAQRAVGKDDFSLIPEGVNGTEERMSIIWDKCVVTGKMDENQFVAVTSTNAAKIFNLYP 397
           ||||.|||||.|.||||| ||||||||.|||| |||||||||||||||||||||.|||||
Sbjct: 301 NTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYP 360

Query: 398 RKGRIAVGSDADLVLWDPDTTKIISAKSHNSSVEYNIFEGTEVRGGPLVVISQGKIVLEE 457
           ||||||||||||||.||||. | ||||.||||.||||||| | || |||||||||||||.
Sbjct: 361 RKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLED 420

Query: 458 GTLHATEGSGRFVPRKPFPDYVYKRIKARSRLAELRGVPRGLYDGPVCEVSITPKAMTPA 517
           |||| ||||||..|||||||.||||||||||||||||||||||||||||||.||| .|||
Sbjct: 421 GTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPA 480

Query: 518 SSAKTSPAKQPNQPVRNLHQSGFSLSGAQVDDNIPRRPTQRIVAPPGGKANITSLG 573
           ||||||||||   ||||||||||||||||.||||||| ||||||||||.|||||||
Sbjct: 481 SSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG 536

>hg18||uc003lon
        |5|NM_001387|Q14195|DPYL3_HUMAN|DPYSL3|NM_001387|NP_001378|dihydropyrim
        idinase-like 3

          Length = 570

 Score =  869 bits (2243), Expect = 3e-252
 Identities = 408/569 (71%), Positives = 497/569 (87%), Gaps = 2/569 (0%)

Query:   4 YQGKKNIPRITSDRLLIKGGKIVNDDQSFCADIYMEDGVIKQIGENLIVPGGVKTIDAHG 63
           ||||||||||||||||||||.|||||||| ||||||||.|||||.|||||||||||.|.|
Sbjct:   3 YQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANG 62

Query:  64 RMLMPGGIDVHTRFQMPDRGMTSADDFYQGTKAALAGGTTMIIDHVVPEPGVSLLSAFEQ 123
           .|..|||||||| |||| .|||. |||.||||||||||||||||||||||  ||  |.|.
Sbjct:  63 KMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEK 122

Query: 124 WRGWADSKACCDYSLHIDITEWHKGIQEEMEMLVKDHGVNSFLVYLAYKDIFQLTDSQVY 183
           || ||| |.||||.||.||| |.  ...|.. |.|| |||||.||.||||..|......|
Sbjct: 123 WREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELY 182

Query: 184 EVFSVIRDLGAVAQVHAENGDIVAEEQRRILEQGITGPEGHVLSHPEEVEAEAVNRSVTV 243
           |.|. . .|||.||||||||||.|.|| |.|| ||||||||||| |||.||||| |..|.
Sbjct: 183 EIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPEGHVLSRPEELEAEAVFRAITI 242

Query: 244 ANQTNCPLYITKVMSKSAADVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAYV 303
           |.|||||||.||||||||||.|.|||||| ||.||||||||| ||.||||||||||||.|
Sbjct: 243 ASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFV 302

Query: 304 XXXXXXXXXXXXXYLNSLLSCGDLQVTGSAHCPFNTAQRAVGKDDFSLIPEGVNGTEERM 363
                        |.||||. ||||..||||| |.|||.|.|||.|. |||| || ||||
Sbjct: 303 TSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERM 362

Query: 364 SIIWDKCVVTGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVLWDPDTTKIISA 423
           |.|||| | ||||||||||||||||||||||||||||||.||||.|||.||||  ||.||
Sbjct: 363 SVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIVSA 422

Query: 424 KSHNSSVEYNIFEGTEVRGGPLVVISQGKIVLEEGTLHATEGSGRFVPRKPFPDYVYKRI 483
           |.| |. ||||||| |.|| ||||| ||||.||.| || |.|.|||.|  || |||||||
Sbjct: 423 KNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRI 482

Query: 484 KARSRLAELRGVPRGLYDGPVCEVSITPKAMTPASSAKTSPAKQPNQPVRNLHQSGFSLS 543
           ||| ..|.|  ||||.||||| ... |||  ||| ||. || . || |||||||||||||
Sbjct: 483 KARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTR-PNPPVRNLHQSGFSLS 541

Query: 544 GAQVDDNIPRRPTQRIVAPPGGKANITSL 572
           | |||. . |  ..||||||||..|||||
Sbjct: 542 GTQVDEGV-RSASKRIVAPPGGRSNITSL 569

>hg18||uc001lla
        |10|NM_006426|O14531|DPYL4_HUMAN|DPYSL4|NM_006426|NP_006417|dihydropyri
        midinase-like 4

          Length = 572

 Score =  862 bits (2227), Expect = 2e-250
 Identities = 415/569 (72%), Positives = 486/569 (85%)

Query:   4 YQGKKNIPRITSDRLLIKGGKIVNDDQSFCADIYMEDGVIKQIGENLIVPGGVKTIDAHG 63
           .||||.|||||||||||.||.|||||||| ||...|||.|||||||||||||.|||||||
Sbjct:   3 FQGKKSIPRITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIGENLIVPGGIKTIDAHG 62

Query:  64 RMLMPGGIDVHTRFQMPDRGMTSADDFYQGTKAALAGGTTMIIDHVVPEPGVSLLSAFEQ 123
            |..|||.||||| |||  ||| |||| ||||||||||||||.||| |. |||||.|.|.
Sbjct:  63 LMVLPGGVDVHTRLQMPVLGMTPADDFCQGTKAALAGGTTMILDHVFPDTGVSLLAAYER 122

Query: 124 WRGWADSKACCDYSLHIDITEWHKGIQEEMEMLVKDHGVNSFLVYLAYKDIFQLTDSQVY 183
           ||  ||| ||||||||.||| ||. |.||.| |||. |||||||..||||  | .|||.|
Sbjct: 123 WRERADSAACCDYSLHVDITRWHESIKEELEALVKEKGVNSFLVFMAYKDRCQCSDSQMY 182

Query: 184 EVFSVIRDLGAVAQVHAENGDIVAEEQRRILEQGITGPEGHVLSHPEEVEAEAVNRSVTV 243
           |.||.||||||.||||||||||| |||.|.|| ||||||||||||||||||||| |.||.
Sbjct: 183 EIFSIIRDLGALAQVHAENGDIVEEEQKRLLELGITGPEGHVLSHPEEVEAEAVYRAVTI 242

Query: 244 ANQTNCPLYITKVMSKSAADVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAYV 303
           | | |||||.|||||| ||| ||||...| ||.|||||||||||||||||||||||||.|
Sbjct: 243 AKQANCPLYVTKVMSKGAADAIAQAKRRGVVVFGEPITASLGTDGSHYWSKNWAKAAAFV 302

Query: 304 XXXXXXXXXXXXXYLNSLLSCGDLQVTGSAHCPFNTAQRAVGKDDFSLIPEGVNGTEERM 363
                        .|  ||| ||||||||||| | |||.|||||.|.||||| || ||||
Sbjct: 303 TSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCTFTTAQKAVGKDNFALIPEGTNGIEERM 362

Query: 364 SIIWDKCVVTGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVLWDPDTTKIISA 423
           |..|.||| .||||||.|||||||||||||| ||||||.|||||||||.|.|  ||||||
Sbjct: 363 SMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNPKATKIISA 422

Query: 424 KSHNSSVEYNIFEGTEVRGGPLVVISQGKIVLEEGTLHATEGSGRFVPRKPFPDYVYKRI 483
           |.|| .|||||||| | || | ||||||.. ||.| .  | |.||||||| |||.|||||
Sbjct: 423 KTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVYKRI 482

Query: 484 KARSRLAELRGVPRGLYDGPVCEVSITPKAMTPASSAKTSPAKQPNQPVRNLHQSGFSLS 543
           |||.||||. ||||||||||| || .  |  . | .  . | |    |||||||||||||
Sbjct: 483 KARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLS 542

Query: 544 GAQVDDNIPRRPTQRIVAPPGGKANITSL 572
           |.| ||.| ||  |.|.|||||..|||||
Sbjct: 543 GSQADDHIARRTAQKIMAPPGGRSNITSL 571

>hg18||uc003gip
        |4|AK127754|Q14194|DPYL1_HUMAN|CRMP1|NM_001313|NP_001304|collapsin
        response mediator protein 1 isoform 2

          Length = 572

 Score =  857 bits (2214), Expect = 6e-249
 Identities = 404/570 (70%), Positives = 489/570 (85%)

Query:   4 YQGKKNIPRITSDRLLIKGGKIVNDDQSFCADIYMEDGVIKQIGENLIVPGGVKTIDAHG 63
           |||||.|| |||||||||||.|.|||||  ||.|.|||.|||||||||||||||||.|.|
Sbjct:   3 YQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANG 62

Query:  64 RMLMPGGIDVHTRFQMPDRGMTSADDFYQGTKAALAGGTTMIIDHVVPEPGVSLLSAFEQ 123
           ||..||||||.|  | | .|||.||||.|||.||| ||||||||||||||| |||..||.
Sbjct:  63 RMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEK 122

Query: 124 WRGWADSKACCDYSLHIDITEWHKGIQEEMEMLVKDHGVNSFLVYLAYKDIFQLTDSQVY 183
           |   ||.|.|||||||.||| |. |..||.|.||.| ||||| ||.||||..|..|||.|
Sbjct: 123 WHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLY 182

Query: 184 EVFSVIRDLGAVAQVHAENGDIVAEEQRRILEQGITGPEGHVLSHPEEVEAEAVNRSVTV 243
           | |. .. ||||  |||||||..|.||.|||| |||||||| || |||.||||| |..|.
Sbjct: 183 EAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITI 242

Query: 244 ANQTNCPLYITKVMSKSAADVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAYV 303
           | . |||.||||||||||||.|| ||||| .|.|||| |||||||.||||||||||||.|
Sbjct: 243 AGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFV 302

Query: 304 XXXXXXXXXXXXXYLNSLLSCGDLQVTGSAHCPFNTAQRAVGKDDFSLIPEGVNGTEERM 363
                        || |||.||||||||| |||..|||.|||||.|.|||||||| ||||
Sbjct: 303 TSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERM 362

Query: 364 SIIWDKCVVTGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVLWDPDTTKIISA 423
           ...||| | |||||||||||||||||||||||||||||||||||||.|.||||  | |.|
Sbjct: 363 TVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITA 422

Query: 424 KSHNSSVEYNIFEGTEVRGGPLVVISQGKIVLEEGTLHATEGSGRFVPRKPFPDYVYKRI 483
           ||| |.|||||||| |  | ||||||||||| |.| ..  .| |||.||| ||...|.|.
Sbjct: 423 KSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRV 482

Query: 484 KARSRLAELRGVPRGLYDGPVCEVSITPKAMTPASSAKTSPAKQPNQPVRNLHQSGFSLS 543
           | |...  |.|| ||.||||| ||  |||  ||| |||.||.|    |.|||||| ||||
Sbjct: 483 KIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLS 542

Query: 544 GAQVDDNIPRRPTQRIVAPPGGKANITSLG 573
           |||.||| |||   ||||||||..||||||
Sbjct: 543 GAQIDDNNPRRTGHRIVAPPGGRSNITSLG 572

>hg18||uc003giq
        |4|NM_001313|Q14194|DPYL1_HUMAN|CRMP1|NM_001313|NP_001304|collapsin
        response mediator protein 1 isoform 2

          Length = 572

 Score =  857 bits (2214), Expect = 6e-249
 Identities = 404/570 (70%), Positives = 489/570 (85%)

Query:   4 YQGKKNIPRITSDRLLIKGGKIVNDDQSFCADIYMEDGVIKQIGENLIVPGGVKTIDAHG 63
           |||||.|| |||||||||||.|.|||||  ||.|.|||.|||||||||||||||||.|.|
Sbjct:   3 YQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANG 62

Query:  64 RMLMPGGIDVHTRFQMPDRGMTSADDFYQGTKAALAGGTTMIIDHVVPEPGVSLLSAFEQ 123
           ||..||||||.|  | | .|||.||||.|||.||| ||||||||||||||| |||..||.
Sbjct:  63 RMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEK 122

Query: 124 WRGWADSKACCDYSLHIDITEWHKGIQEEMEMLVKDHGVNSFLVYLAYKDIFQLTDSQVY 183
           |   ||.|.|||||||.||| |. |..||.|.||.| ||||| ||.||||..|..|||.|
Sbjct: 123 WHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLY 182

Query: 184 EVFSVIRDLGAVAQVHAENGDIVAEEQRRILEQGITGPEGHVLSHPEEVEAEAVNRSVTV 243
           | |. .. ||||  |||||||..|.||.|||| |||||||| || |||.||||| |..|.
Sbjct: 183 EAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITI 242

Query: 244 ANQTNCPLYITKVMSKSAADVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAYV 303
           | . |||.||||||||||||.|| ||||| .|.|||| |||||||.||||||||||||.|
Sbjct: 243 AGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFV 302

Query: 304 XXXXXXXXXXXXXYLNSLLSCGDLQVTGSAHCPFNTAQRAVGKDDFSLIPEGVNGTEERM 363
                        || |||.||||||||| |||..|||.|||||.|.|||||||| ||||
Sbjct: 303 TSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERM 362

Query: 364 SIIWDKCVVTGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVLWDPDTTKIISA 423
           ...||| | |||||||||||||||||||||||||||||||||||||.|.||||  | |.|
Sbjct: 363 TVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITA 422

Query: 424 KSHNSSVEYNIFEGTEVRGGPLVVISQGKIVLEEGTLHATEGSGRFVPRKPFPDYVYKRI 483
           ||| |.|||||||| |  | ||||||||||| |.| ..  .| |||.||| ||...|.|.
Sbjct: 423 KSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRV 482

Query: 484 KARSRLAELRGVPRGLYDGPVCEVSITPKAMTPASSAKTSPAKQPNQPVRNLHQSGFSLS 543
           | |...  |.|| ||.||||| ||  |||  ||| |||.||.|    |.|||||| ||||
Sbjct: 483 KIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLS 542

Query: 544 GAQVDDNIPRRPTQRIVAPPGGKANITSLG 573
           |||.||| |||   ||||||||..||||||
Sbjct: 543 GAQIDDNNPRRTGHRIVAPPGGRSNITSLG 572

>hg18||uc003loo |5|BC077077|Q6DEN2|Q6DEN2_HUMAN|DPYSL3|NA|NA|DPYSL3 protein

          Length = 684

 Score =  848 bits (2189), Expect = 5e-246
 Identities = 398/562 (70%), Positives = 488/562 (86%), Gaps = 2/562 (0%)

Query:  11 PRITSDRLLIKGGKIVNDDQSFCADIYMEDGVIKQIGENLIVPGGVKTIDAHGRMLMPGG 70
           |.  |||||||||.|||||||| ||||||||.|||||.|||||||||||.|.|.|..|||
Sbjct: 124 PKDKSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGG 183

Query:  71 IDVHTRFQMPDRGMTSADDFYQGTKAALAGGTTMIIDHVVPEPGVSLLSAFEQWRGWADS 130
           ||||| |||| .|||. |||.||||||||||||||||||||||  ||  |.|.|| ||| 
Sbjct: 184 IDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADG 243

Query: 131 KACCDYSLHIDITEWHKGIQEEMEMLVKDHGVNSFLVYLAYKDIFQLTDSQVYEVFSVIR 190
           |.||||.||.||| |.  ...|.. |.|| |||||.||.||||..|......||.|. . 
Sbjct: 244 KSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLG 303

Query: 191 DLGAVAQVHAENGDIVAEEQRRILEQGITGPEGHVLSHPEEVEAEAVNRSVTVANQTNCP 250
           .|||.||||||||||.|.|| |.|| ||||||||||| |||.||||| |..|.|.|||||
Sbjct: 304 ELGAIAQVHAENGDIIAQEQTRMLEMGITGPEGHVLSRPEELEAEAVFRAITIASQTNCP 363

Query: 251 LYITKVMSKSAADVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAYVXXXXXXX 310
           ||.||||||||||.|.|||||| ||.||||||||| ||.||||||||||||.|       
Sbjct: 364 LYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSP 423

Query: 311 XXXXXXYLNSLLSCGDLQVTGSAHCPFNTAQRAVGKDDFSLIPEGVNGTEERMSIIWDKC 370
                 |.||||. ||||..||||| |.|||.|.|||.|. |||| || |||||.|||| 
Sbjct: 424 DPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKA 483

Query: 371 VVTGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVLWDPDTTKIISAKSHNSSV 430
           | ||||||||||||||||||||||||||||||.||||.|||.||||  ||.|||.| |. 
Sbjct: 484 VATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIVSAKNHQSAA 543

Query: 431 EYNIFEGTEVRGGPLVVISQGKIVLEEGTLHATEGSGRFVPRKPFPDYVYKRIKARSRLA 490
           ||||||| |.|| ||||| ||||.||.| || |.|.|||.|  || |||||||||| ..|
Sbjct: 544 EYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMA 603

Query: 491 ELRGVPRGLYDGPVCEVSITPKAMTPASSAKTSPAKQPNQPVRNLHQSGFSLSGAQVDDN 550
           .|  ||||.||||| ... |||  ||| ||. || . || |||||||||||||| |||. 
Sbjct: 604 DLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTR-PNPPVRNLHQSGFSLSGTQVDEG 662

Query: 551 IPRRPTQRIVAPPGGKANITSL 572
           . |  ..||||||||..|||||
Sbjct: 663 V-RSASKRIVAPPGGRSNITSL 683

>hg18||uc003gio
        |4|AK122754|Q4W5F1|Q4W5F1_HUMAN|CRMP1|NM_001313|NP_001304|collapsin
        response mediator protein 1 isoform 2

          Length = 566

 Score =  839 bits (2165), Expect = 3e-243
 Identities = 395/559 (70%), Positives = 479/559 (85%)

Query:  15 SDRLLIKGGKIVNDDQSFCADIYMEDGVIKQIGENLIVPGGVKTIDAHGRMLMPGGIDVH 74
           |||||||||.|.|||||  ||.|.|||.|||||||||||||||||.|.|||..||||||.
Sbjct:   8 SDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVN 67

Query:  75 TRFQMPDRGMTSADDFYQGTKAALAGGTTMIIDHVVPEPGVSLLSAFEQWRGWADSKACC 134
           |  | | .|||.||||.|||.||| ||||||||||||||| |||..||.|   ||.|.||
Sbjct:  68 TYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCC 127

Query: 135 DYSLHIDITEWHKGIQEEMEMLVKDHGVNSFLVYLAYKDIFQLTDSQVYEVFSVIRDLGA 194
           |||||.||| |. |..||.|.||.| ||||| ||.||||..|..|||.|| |. .. |||
Sbjct: 128 DYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGA 187

Query: 195 VAQVHAENGDIVAEEQRRILEQGITGPEGHVLSHPEEVEAEAVNRSVTVANQTNCPLYIT 254
           |  |||||||..|.||.|||| |||||||| || |||.||||| |..|.| . |||.|||
Sbjct: 188 VILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYIT 247

Query: 255 KVMSKSAADVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAYVXXXXXXXXXXX 314
           |||||||||.|| ||||| .|.|||| |||||||.||||||||||||.|           
Sbjct: 248 KVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTT 307

Query: 315 XXYLNSLLSCGDLQVTGSAHCPFNTAQRAVGKDDFSLIPEGVNGTEERMSIIWDKCVVTG 374
             || |||.||||||||| |||..|||.|||||.|.|||||||| ||||...||| | ||
Sbjct: 308 PDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATG 367

Query: 375 KMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVLWDPDTTKIISAKSHNSSVEYNI 434
           |||||||||||||||||||||||||||||||||||.|.||||  | |.|||| |.|||||
Sbjct: 368 KMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNI 427

Query: 435 FEGTEVRGGPLVVISQGKIVLEEGTLHATEGSGRFVPRKPFPDYVYKRIKARSRLAELRG 494
           ||| |  | ||||||||||| |.| ..  .| |||.||| ||...|.|.| |...  |.|
Sbjct: 428 FEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQG 487

Query: 495 VPRGLYDGPVCEVSITPKAMTPASSAKTSPAKQPNQPVRNLHQSGFSLSGAQVDDNIPRR 554
           | ||.||||| ||  |||  ||| |||.||.|    |.|||||| |||||||.||| |||
Sbjct: 488 VSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRR 547

Query: 555 PTQRIVAPPGGKANITSLG 573
              ||||||||..||||||
Sbjct: 548 TGHRIVAPPGGRSNITSLG 566

>hg18||uc003gir
        |4|BC009987|Q4W5F1|Q4W5F1_HUMAN|CRMP1|NM_001313|NP_001304|collapsin
        response mediator protein 1 isoform 2

          Length = 567

 Score =  839 bits (2165), Expect = 3e-243
 Identities = 395/559 (70%), Positives = 479/559 (85%)

Query:  15 SDRLLIKGGKIVNDDQSFCADIYMEDGVIKQIGENLIVPGGVKTIDAHGRMLMPGGIDVH 74
           |||||||||.|.|||||  ||.|.|||.|||||||||||||||||.|.|||..||||||.
Sbjct:   9 SDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVN 68

Query:  75 TRFQMPDRGMTSADDFYQGTKAALAGGTTMIIDHVVPEPGVSLLSAFEQWRGWADSKACC 134
           |  | | .|||.||||.|||.||| ||||||||||||||| |||..||.|   ||.|.||
Sbjct:  69 TYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCC 128

Query: 135 DYSLHIDITEWHKGIQEEMEMLVKDHGVNSFLVYLAYKDIFQLTDSQVYEVFSVIRDLGA 194
           |||||.||| |. |..||.|.||.| ||||| ||.||||..|..|||.|| |. .. |||
Sbjct: 129 DYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGA 188

Query: 195 VAQVHAENGDIVAEEQRRILEQGITGPEGHVLSHPEEVEAEAVNRSVTVANQTNCPLYIT 254
           |  |||||||..|.||.|||| |||||||| || |||.||||| |..|.| . |||.|||
Sbjct: 189 VILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYIT 248

Query: 255 KVMSKSAADVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAYVXXXXXXXXXXX 314
           |||||||||.|| ||||| .|.|||| |||||||.||||||||||||.|           
Sbjct: 249 KVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTT 308

Query: 315 XXYLNSLLSCGDLQVTGSAHCPFNTAQRAVGKDDFSLIPEGVNGTEERMSIIWDKCVVTG 374
             || |||.||||||||| |||..|||.|||||.|.|||||||| ||||...||| | ||
Sbjct: 309 PDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATG 368

Query: 375 KMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVLWDPDTTKIISAKSHNSSVEYNI 434
           |||||||||||||||||||||||||||||||||||.|.||||  | |.|||| |.|||||
Sbjct: 369 KMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNI 428

Query: 435 FEGTEVRGGPLVVISQGKIVLEEGTLHATEGSGRFVPRKPFPDYVYKRIKARSRLAELRG 494
           ||| |  | ||||||||||| |.| ..  .| |||.||| ||...|.|.| |...  |.|
Sbjct: 429 FEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQG 488

Query: 495 VPRGLYDGPVCEVSITPKAMTPASSAKTSPAKQPNQPVRNLHQSGFSLSGAQVDDNIPRR 554
           | ||.||||| ||  |||  ||| |||.||.|    |.|||||| |||||||.||| |||
Sbjct: 489 VSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRR 548

Query: 555 PTQRIVAPPGGKANITSLG 573
              ||||||||..||||||
Sbjct: 549 TGHRIVAPPGGRSNITSLG 567

>hg18||uc003gis
        |4|NM_001014809|A0EJG6|A0EJG6_HUMAN|CRMP1|NM_001014809|NP_001014809|col
        lapsin response mediator protein 1 isoform 1

          Length = 686

 Score =  839 bits (2165), Expect = 3e-243
 Identities = 395/559 (70%), Positives = 479/559 (85%)

Query:  15 SDRLLIKGGKIVNDDQSFCADIYMEDGVIKQIGENLIVPGGVKTIDAHGRMLMPGGIDVH 74
           |||||||||.|.|||||  ||.|.|||.|||||||||||||||||.|.|||..||||||.
Sbjct: 128 SDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVN 187

Query:  75 TRFQMPDRGMTSADDFYQGTKAALAGGTTMIIDHVVPEPGVSLLSAFEQWRGWADSKACC 134
           |  | | .|||.||||.|||.||| ||||||||||||||| |||..||.|   ||.|.||
Sbjct: 188 TYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCC 247

Query: 135 DYSLHIDITEWHKGIQEEMEMLVKDHGVNSFLVYLAYKDIFQLTDSQVYEVFSVIRDLGA 194
           |||||.||| |. |..||.|.||.| ||||| ||.||||..|..|||.|| |. .. |||
Sbjct: 248 DYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGA 307

Query: 195 VAQVHAENGDIVAEEQRRILEQGITGPEGHVLSHPEEVEAEAVNRSVTVANQTNCPLYIT 254
           |  |||||||..|.||.|||| |||||||| || |||.||||| |..|.| . |||.|||
Sbjct: 308 VILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYIT 367

Query: 255 KVMSKSAADVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAYVXXXXXXXXXXX 314
           |||||||||.|| ||||| .|.|||| |||||||.||||||||||||.|           
Sbjct: 368 KVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTT 427

Query: 315 XXYLNSLLSCGDLQVTGSAHCPFNTAQRAVGKDDFSLIPEGVNGTEERMSIIWDKCVVTG 374
             || |||.||||||||| |||..|||.|||||.|.|||||||| ||||...||| | ||
Sbjct: 428 PDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATG 487

Query: 375 KMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVLWDPDTTKIISAKSHNSSVEYNI 434
           |||||||||||||||||||||||||||||||||||.|.||||  | |.|||| |.|||||
Sbjct: 488 KMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNI 547

Query: 435 FEGTEVRGGPLVVISQGKIVLEEGTLHATEGSGRFVPRKPFPDYVYKRIKARSRLAELRG 494
           ||| |  | ||||||||||| |.| ..  .| |||.||| ||...|.|.| |...  |.|
Sbjct: 548 FEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQG 607

Query: 495 VPRGLYDGPVCEVSITPKAMTPASSAKTSPAKQPNQPVRNLHQSGFSLSGAQVDDNIPRR 554
           | ||.||||| ||  |||  ||| |||.||.|    |.|||||| |||||||.||| |||
Sbjct: 608 VSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRR 667

Query: 555 PTQRIVAPPGGKANITSLG 573
              ||||||||..||||||
Sbjct: 668 TGHRIVAPPGGRSNITSLG 686

>hg18||uc003gin |4|CR608807|NA|NA|CRMP1|NA|NA|Homo sapiens cDNA FLJ37406 fis,
        clone BRAMY2028282, highly similar to DIHYDROPYRIMIDINASE RELATED
        PROTEIN-1

          Length = 490

 Score =  647 bits (1667), Expect = 2e-185
 Identities = 306/456 (67%), Positives = 374/456 (82%), Gaps = 4/456 (0%)

Query: 106 IDHVVPEPGVSLLSAFEQWRGWADSKACCDYSLHIDITEWHKGIQEEMEMLVKDHGVNSF 165
           ||||||||| |||..||.|   ||.|.|||||||.||| |. |..||.|.||.| |||||
Sbjct:  17 IDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSF 76

Query: 166 LVYLAYKDIFQLTDSQVYEVFSVIRDLGAVAQVHAENGDIVAEEQRRILEQGITGPEGHV 225
            ||.||||..|..|||.|| |. .. ||||  |||||||..|.||.|||| |||||||| 
Sbjct:  77 QVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHA 136

Query: 226 LSHPEEVEAEAVNRSVTVANQTNCPLYITKVMSKSAADVIAQARKKGTVVYGEPITASLG 285
           || |||.||||| |..|.| . |||.||||||||||||.|| ||||| .|.|||| ||||
Sbjct: 137 LSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLG 196

Query: 286 TDGSHYWSKNWAKAAAYVXXXXXXXXXXXXXYLNSLLSCGDLQVTGSAHCPFNTAQRAVG 345
           |||.||||||||||||.|             || |||.||||||||| |||..|||.|||
Sbjct: 197 TDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVG 256

Query: 346 KDDFSLIPEGVNGTEERMSIIWDKCVVTGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVG 405
           ||.|.|||||||| ||||...||| | |||||||||||||||||||||||||||||||||
Sbjct: 257 KDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVG 316

Query: 406 SDADLVLWDPDTTKIISAKSHNSSVEYNIFEGTEVRGGPLVVISQGKIVLEEGTLHATEG 465
           ||||.|.||||  | |.|||| |.|||||||| |  | ||||||||||| |.| ..  .|
Sbjct: 317 SDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKG 376

Query: 466 SGRFVPRKPFPDYVYKRIKARSRLAELRGVPRGLYDGPVCEVSITPKAMTPASSAKTSPA 525
            |||.||| ||...|.|.| |...  |.|| ||.||||| ||  |||  ||| |||.||.
Sbjct: 377 MGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPS 436

Query: 526 KQPNQPVRNLHQSGFSLSGAQVDDNIPRRPTQRIVA 561
           |    |.|||||| ||||        |  |  | .|
Sbjct: 437 KHQPPPIRNLHQSNFSLSALPE----PAAPENRTIA 468

>hg18||uc003yly
        |8|NM_001385|Q14117|DPYS_HUMAN|DPYS|NM_001385|NP_001376|dihydropyrimidi
        nase

          Length = 519

 Score =  601 bits (1548), Expect = 1e-171
 Identities = 290/514 (56%), Positives = 375/514 (72%), Gaps = 6/514 (1%)

Query:  17 RLLIKGGKIVNDDQSFCADIYMEDGVIKQIGENLIVPG----GVKTIDAHGRMLMPGGID 72
           ||||.||..|||| |  ||. .||||.. .| .|. ||    |.. .|| |....|||||
Sbjct:   6 RLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGGAPAGLRVLDAAGKLVLPGGID 65

Query:  73 VHTRFQMPDRGMTSADDFYQGTKAALAGGTTMIIDHVVPEPGVSLLSAFEQWRGWADSKA 132
            ||  | |  |  | |||.|||||||.||||||||  .|. | ||. ||| || ||| | 
Sbjct:  66 THTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLIEAFETWRSWADPKV 125

Query: 133 CCDYSLHIDITEWHKGIQEEMEMLVKDHGVNSFLVYLAYKDIFQLTDSQVYEVFSVIRDL 192
           |||||||. .| |   ..|||..||.| ||||| ...||||.. .|| ..|| ||  ...
Sbjct: 126 CCDYSLHVAVTWWSDQVKEEMKILVQDKGVNSFKMFMAYKDLYMVTDLELYEAFSRCKEI 185

Query: 193 GAVAQVHAENGDIVAEEQRRILEQGITGPEGHVLSHPEEVEAEAVNRSVTVANQTNCPLY 252
           ||.|||||||||..||  ...|  |||||||| |  || |||||  |..|.|.  |||||
Sbjct: 186 GAIAQVHAENGDLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLY 245

Query: 253 ITKVMSKSAADVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAYVXXXXXXXXX 312
           |  ||||||| ||| ||. | ||||||| |||||||.|||.| |  || .|         
Sbjct: 246 IVHVMSKSAAKVIADARRDGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPPLRPDP 305

Query: 313 XXXXYLNSLLSCGDLQVTGSAHCPFNTAQRAVGKDDFSLIPEGVNGTEERMSIIWDKCVV 372
               .| .||.  ||  ||. .| ||| |.|.|||||. || |||| |.|||.||.| | 
Sbjct: 306 STPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVH 365

Query: 373 TGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVLWDPDTTKIISAKSHNSSVEY 432
           .||||||.|||||||||||||||||||||||||||||.|.|||  |. ||||.|. .| .
Sbjct: 366 SGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHHQAVNF 425

Query: 433 NIFEGTEVRGGPLVVISQGKIVLEEGTLHATEGSGRFVPRKPFPDYVYKRIKARSRLAEL 492
           |||||    | ||| ||.||.| | |    | | |.|.||||| .|.||||| | |    
Sbjct: 426 NIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTP 485

Query: 493 RGVPRGLYDGPVCEVS--ITPKAMTPASSAKTSP 524
             | |  | | |  .   .| .  |  .  .  |
Sbjct: 486 TPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP 519

>hg18||uc002rhu
        |2|NM_020134|Q9BPU6|DPYL5_HUMAN|DPYSL5|NM_020134|NP_064519|dihydropyrim
        idinase-like 5

          Length = 564

 Score =  573 bits (1476), Expect = 2e-163
 Identities = 279/556 (50%), Positives = 387/556 (69%), Gaps = 3/556 (0%)

Query:  15 SDRLLIKGGKIVNDDQSFCADIYMEDGVIKQIGENLIVPGGVKTIDAHGRMLMPGGIDVH 74
           | |.||||||.|||| .  ||.|.|.|.|.|.|  |..||| | ||| |....|||||  
Sbjct:   7 SVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTS 66

Query:  75 TRFQMPDRGMTSADDFYQGTKAALAGGTTMIIDHVVPEPGVSLLSAFEQWRGWADSKACC 134
           | |       |  |||| |||||| ||||||| ||.|.   ||. |.|. || || | ||
Sbjct:  67 THFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCC 126

Query: 135 DYSLHIDITEWHKGIQEEMEMLVKDHGVNSFLVYLAYKDIFQLTDSQVYEVFSVIRDLGA 194
           ||.||. || |   .. ||| ||.. ||||| ... |||.. | ||..|.|    .|.||
Sbjct: 127 DYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVLHACKDIGA 186

Query: 195 VAQVHAENGDIVAEEQRRILEQGITGPEGHVLSHPEEVEAEAVNRSVTVANQTNCPLYIT 254
           .|.||||||..|||  .  |. |||||||  .| |||.|||| .| .|.||.|.||.|. 
Sbjct: 187 IARVHAENGELVAEGAKEALDLGITGPEGIEISRPEELEAEATHRVITIANRTHCPIYLV 246

Query: 255 KVMSKSAADVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAYVXXXXXXXXXXX 314
            | | || |||| |. .| ||  |  ||     | ||. ..|. |||||           
Sbjct: 247 NVSSISAGDVIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNT 306

Query: 315 XXYLNSLLSCGDLQVTGSAHCPFNTAQRAVGKDDFSLIPEGVNGTEERMSIIWDKCVVTG 374
             || |||.   | .  | | || | |.|.||.||. || ||.| ..|||.||.. || |
Sbjct: 307 STYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVIWERGVVGG 366

Query: 375 KMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVLWDPDTTKIISAKSHNSSVEYNI 434
           |||||.||||||.||||. |||||||||  |.|||.|.|||. || ||| .     ..|.
Sbjct: 367 KMDENRFVAVTSSNAAKLLNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQGGDFNL 426

Query: 435 FEGTEVRGGPLVVISQGKIVLEEGTLHATEGSGRFVPRKPFPDYVYKRIKARSRLAELRG 494
           .|     | ||| ||.|..| | |     ||.|.| | . ||| |||..  | .  ..||
Sbjct: 427 YENMRCHGVPLVTISRGRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRG 486

Query: 495 VPRGLYDGPVCEVSITPKAM--TPASSAKTSPAKQPNQPVRNLHQSGFSLSGAQVDDNIP 552
           | |  | | |  |    |    || .   | |  . .  .|.||.| |||||.|.||..|
Sbjct: 487 VDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTR-HGGMRDLHESSFSLSGSQIDDHVP 545

Query: 553 RRPTQRIVAPPGGKAN 568
           .| . ||.|||||...
Sbjct: 546 KRASARILAPPGGRSS 561

>hg18||uc002rhv
        |2|BC002874|Q9BPU6|DPYL5_HUMAN|DPYSL5|NM_020134|NP_064519|dihydropyrimi
        dinase-like 5

          Length = 564

 Score =  573 bits (1476), Expect = 2e-163
 Identities = 279/556 (50%), Positives = 387/556 (69%), Gaps = 3/556 (0%)

Query:  15 SDRLLIKGGKIVNDDQSFCADIYMEDGVIKQIGENLIVPGGVKTIDAHGRMLMPGGIDVH 74
           | |.||||||.|||| .  ||.|.|.|.|.|.|  |..||| | ||| |....|||||  
Sbjct:   7 SVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTS 66

Query:  75 TRFQMPDRGMTSADDFYQGTKAALAGGTTMIIDHVVPEPGVSLLSAFEQWRGWADSKACC 134
           | |       |  |||| |||||| ||||||| ||.|.   ||. |.|. || || | ||
Sbjct:  67 THFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCC 126

Query: 135 DYSLHIDITEWHKGIQEEMEMLVKDHGVNSFLVYLAYKDIFQLTDSQVYEVFSVIRDLGA 194
           ||.||. || |   .. ||| ||.. ||||| ... |||.. | ||..|.|    .|.||
Sbjct: 127 DYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVLHACKDIGA 186

Query: 195 VAQVHAENGDIVAEEQRRILEQGITGPEGHVLSHPEEVEAEAVNRSVTVANQTNCPLYIT 254
           .|.||||||..|||  .  |. |||||||  .| |||.|||| .| .|.||.|.||.|. 
Sbjct: 187 IARVHAENGELVAEGAKEALDLGITGPEGIEISRPEELEAEATHRVITIANRTHCPIYLV 246

Query: 255 KVMSKSAADVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAYVXXXXXXXXXXX 314
            | | || |||| |. .| ||  |  ||     | ||. ..|. |||||           
Sbjct: 247 NVSSISAGDVIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNT 306

Query: 315 XXYLNSLLSCGDLQVTGSAHCPFNTAQRAVGKDDFSLIPEGVNGTEERMSIIWDKCVVTG 374
             || |||.   | .  | | || | |.|.||.||. || ||.| ..|||.||.. || |
Sbjct: 307 STYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVIWERGVVGG 366

Query: 375 KMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVLWDPDTTKIISAKSHNSSVEYNI 434
           |||||.||||||.||||. |||||||||  |.|||.|.|||. || ||| .     ..|.
Sbjct: 367 KMDENRFVAVTSSNAAKLLNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQGGDFNL 426

Query: 435 FEGTEVRGGPLVVISQGKIVLEEGTLHATEGSGRFVPRKPFPDYVYKRIKARSRLAELRG 494
           .|     | ||| ||.|..| | |     ||.|.| | . ||| |||..  | .  ..||
Sbjct: 427 YENMRCHGVPLVTISRGRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRG 486

Query: 495 VPRGLYDGPVCEVSITPKAM--TPASSAKTSPAKQPNQPVRNLHQSGFSLSGAQVDDNIP 552
           | |  | | |  |    |    || .   | |  . .  .|.||.| |||||.|.||..|
Sbjct: 487 VDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTR-HGGMRDLHESSFSLSGSQIDDHVP 545

Query: 553 RRPTQRIVAPPGGKAN 568
           .| . ||.|||||...
Sbjct: 546 KRASARILAPPGGRSS 561

>hg18||uc002rji
        |2|NM_004341|P27708|PYR1_HUMAN|CAD|NM_004341|NP_004332|carbamoylphospha
        te synthetase 2/aspartate

          Length = 2225

 Score =  49 bits (115), Expect = 2e-005
 Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 4/116 (3%)

Query:   33 CADIYMEDGVIKQIGENLIVPGGVKTIDAHGRMLMPGGIDVHTRFQMPDRGMTSADDFYQ 92
            |  ...|   . |||    .   |  . .   . .|| ||||   . |  | |  .||  
Sbjct: 1432 CTKLFVE--ALGQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREP--GGTHKEDFAS 1487

Query:   93 GTKAALAGGTTMIIDHVVPEPGVSLLSAFEQWRGWADSKACCDYSLHIDITEWHKG 148
            || |||||| ||.       | .    |    .  |.. | ||..| .  .  . |
Sbjct: 1488 GTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAG 1543

>hg18||uc003ydg
        |8|NM_198584|Q8N1Q1|CAH13_HUMAN|CA13|NM_198584|NP_940986|carbonic
        anhydrase XIII

          Length = 262

 Score =  31 bits (69), Expect = 3.420
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 411 VLWDPDTTKIISAKSHNSSVEYNIFEGTEV-RGGPL 445
           . .|| . ||||   |. .|...  |   | |||||
Sbjct:  50 IKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPL 85

>hg18||uc001vas |13|NM_015070|Q5T200-2|Q5T200-2|ZC3H13|NM_015070|NP_055885|zinc
        finger CCCH-type containing 13

          Length = 1564

 Score =  30 bits (66), Expect = 7.620
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 8/50 (16%)

Query: 522 TSPAKQPNQPVRNLHQSGFSLSGAQVDDNIP-----RRPT---QRIVAPP 563
           |||| | . |. . | |  | ||. .  . |     | |.   || . ||
Sbjct: 317 TSPAGQHHSPISSRHHSSSSQSGSSIQRHSPSPRRKRTPSPSYQRTLTPP 366

>hg18||uc001vat |13|AK056422|Q5T200-2|Q5T200-2|ZC3H13|NM_015070|NP_055885|zinc
        finger CCCH-type containing 13

          Length = 1265

 Score =  30 bits (66), Expect = 7.620
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 8/50 (16%)

Query: 522 TSPAKQPNQPVRNLHQSGFSLSGAQVDDNIP-----RRPT---QRIVAPP 563
           |||| | . |. . | |  | ||. .  . |     | |.   || . ||
Sbjct: 317 TSPAGQHHSPISSRHHSSSSQSGSSIQRHSPSPRRKRTPSPSYQRTLTPP 366

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0