BLASTP 7.6.0


Query=fugu4_571346 |jgi|Takru4|571346|e_gw2.306.1.1
        (509 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002snt |2|BC098301|Q4KMX1|Q4KMX1_HUMAN|LRRTM4|NM_024993|...    691   9e-199
hg18||uc002snq |2|AK122612|Q6UXJ7|Q6UXJ7_HUMAN|UNQ3075|NA|NA|GFH...    689   2e-198
hg18||uc002snr |2|AY358324|Q6UXJ7|Q6UXJ7_HUMAN|UNQ3075|NA|NA|GFH...    689   2e-198
hg18||uc002sns |2|NM_024993|Q4FZ98|Q4FZ98_HUMAN|LRRTM4|NM_024993...    688   6e-198
hg18||uc002sok |2|NM_178839|Q86UE6|LRRT1_HUMAN|LRRTM1|NM_178839|...    473   3e-133
hg18||uc001jmy |10|AY358315|Q86VH5-2|Q86VH5-2|LRRTM3|NM_178011|N...    451   9e-127
hg18||uc001jmz |10|NM_178011|Q86VH5|LRRT3_HUMAN|LRRTM3|NM_178011...    451   9e-127
hg18||uc003ldk |5|NM_015564|O43300|LRRT2_HUMAN|LRRTM2|NM_015564|...    371   1e-102
hg18||uc001jmy |10|AY358315|Q86VH5-2|Q86VH5-2|LRRTM3|NM_178011|N...    136   9e-032
hg18||uc001jmz |10|NM_178011|Q86VH5|LRRT3_HUMAN|LRRTM3|NM_178011...    136   1e-031
hg18||uc003ftt |3|NM_130830|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|...    123   7e-028
hg18||uc003ftu |3|BC101065|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|N...    123   7e-028
hg18||uc002cmy |16|NM_004970|P35858|ALS_HUMAN|IGFALS|NM_004970|N...    121   3e-027
hg18||uc002cmy |16|NM_004970|P35858|ALS_HUMAN|IGFALS|NM_004970|N...    120   6e-027
hg18||uc003ftt |3|NM_130830|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|...    120   6e-027
hg18||uc003ftu |3|BC101065|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|N...    120   6e-027
hg18||uc002cmy |16|NM_004970|P35858|ALS_HUMAN|IGFALS|NM_004970|N...    116   7e-026
hg18||uc002mau |19|NM_052972|P02750|A2GL_HUMAN|LRG1|NM_052972|NP...    111   2e-024
hg18||uc003szt |7|NM_014817|NA|NA|KIAA0644|NM_014817|NP_055632|h...    111   2e-024
hg18||uc003fts |3|NM_001080513|P22792|CPN2_HUMAN|CPN2|NM_0010805...    111   3e-024
hg18||uc002cmy |16|NM_004970|P35858|ALS_HUMAN|IGFALS|NM_004970|N...    106   7e-023
hg18||uc003szt |7|NM_014817|NA|NA|KIAA0644|NM_014817|NP_055632|h...    102   1e-021
hg18||uc003mab |5|NM_003062|O75094|SLIT3_HUMAN|SLIT3|NM_003062|N...    101   2e-021
hg18||uc003gpr |4|NM_004787|O94813|SLIT2_HUMAN|SLIT2|NM_004787|N...     99   9e-021
hg18||uc003gps |4|AF055585|O94813-3|O94813-3|SLIT2|NM_004787|NP_...     99   9e-021
hg18||uc003ftt |3|NM_130830|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|...     99   2e-020
hg18||uc003ftu |3|BC101065|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|N...     99   2e-020
hg18||uc001kmw |10|NM_003061|Q5VW17|Q5VW17_HUMAN|SLIT1|NM_003061...     97   4e-020
hg18||uc003fts |3|NM_001080513|P22792|CPN2_HUMAN|CPN2|NM_0010805...     97   4e-020
hg18||uc003ftt |3|NM_130830|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|...     97   6e-020
hg18||uc003ftu |3|BC101065|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|N...     97   6e-020
hg18||uc002cwj |16|NM_138440|Q6EMK4|VASN_HUMAN|VASN|NM_138440|NP...     95   2e-019
hg18||uc001hbe |1|NM_006338|O75325|LRRN5_HUMAN|LRRN2|NM_006338|N...     93   8e-019
hg18||uc001hbf |1|NM_201630|O75325|LRRN5_HUMAN|LRRN2|NM_201630|N...     93   8e-019
hg18||uc001hbg |1|AL833565|O75325|LRRN5_HUMAN|LRRN2|NM_201630|NP...     93   8e-019
hg18||uc003dmx |3|NM_015541|Q96JA1|LRIG1_HUMAN|LRIG1|NM_015541|N...     92   1e-018
hg18||uc003vfs |7|NM_018334|Q9H3W5|LRRN3_HUMAN|LRRN3|NM_018334|N...     91   2e-018
hg18||uc003vft |7|AK001991|Q9H3W5|LRRN3_HUMAN|LRRN3|NM_018334|NP...     91   2e-018
hg18||uc003vfu |7|AY358280|Q9H3W5|LRRN3_HUMAN|LRRN3|NM_018334|NP...     91   2e-018
hg18||uc001edf |1|NM_014813|O94898|LRIG2_HUMAN|LRIG2|NM_014813|N...     91   3e-018
hg18||uc001mrk |11|DQ895687|Q8N537|Q8N537_HUMAN|LGR4|NM_018490|N...     91   4e-018
hg18||uc003ipz |4|NM_021634|Q2M215|Q2M215_HUMAN|RXFP1|NM_021634|...     91   4e-018
hg18||uc002ftp |17|NM_178568|Q86UN2|R4RL1_HUMAN|RTN4RL1|NM_17856...     90   5e-018
hg18||uc003ftv |3|NM_004488|P40197|GPV_HUMAN|GP5|NM_004488|NP_00...     90   5e-018
hg18||uc001edf |1|NM_014813|O94898|LRIG2_HUMAN|LRIG2|NM_014813|N...     89   9e-018
hg18||uc001mrj |11|NM_018490|Q59ER8|Q59ER8_HUMAN|LGR4|NM_018490|...     89   2e-017
hg18||uc001qjt |12|NM_001039029|Q8N967|LRTM2_HUMAN|LRTM2|NM_0010...     89   2e-017
hg18||uc001qju |12|AK124687|Q8N967|LRTM2_HUMAN|LRTM2|NM_00103902...     89   2e-017
hg18||uc003mab |5|NM_003062|O75094|SLIT3_HUMAN|SLIT3|NM_003062|N...     89   2e-017
hg18||uc001sqr |12|NM_153377|Q6UXM1|LRIG3_HUMAN|LRIG3|NM_153377|...     88   2e-017
hg18||uc002cmy |16|NM_004970|P35858|ALS_HUMAN|IGFALS|NM_004970|N...     88   2e-017
hg18||uc003mac |5|BC023515|NA|NA|MEGF5|NA|NA|Homo sapiens mRNA f...     88   2e-017
hg18||uc002cmy |16|NM_004970|P35858|ALS_HUMAN|IGFALS|NM_004970|N...     87   5e-017
hg18||uc001hbe |1|NM_006338|O75325|LRRN5_HUMAN|LRRN2|NM_006338|N...     87   6e-017
hg18||uc001hbf |1|NM_201630|O75325|LRRN5_HUMAN|LRRN2|NM_201630|N...     87   6e-017
hg18||uc001hbg |1|AL833565|O75325|LRRN5_HUMAN|LRRN2|NM_201630|NP...     87   6e-017
hg18||uc001sqr |12|NM_153377|Q6UXM1|LRIG3_HUMAN|LRIG3|NM_153377|...     87   6e-017
hg18||uc002mau |19|NM_052972|P02750|A2GL_HUMAN|LRG1|NM_052972|NP...     87   6e-017
hg18||uc003bpv |3|AK023273|Q6UXK5|LRRN1_HUMAN|LRRN1|NM_020873|NP...     86   1e-016
hg18||uc003gpr |4|NM_004787|O94813|SLIT2_HUMAN|SLIT2|NM_004787|N...     86   1e-016
hg18||uc003gps |4|AF055585|O94813-3|O94813-3|SLIT2|NM_004787|NP_...     86   1e-016
hg18||uc001kmw |10|NM_003061|Q5VW17|Q5VW17_HUMAN|SLIT1|NM_003061...     85   2e-016
hg18||uc003bpt |3|NM_020873|Q6UXK5|LRRN1_HUMAN|LRRN1|NM_020873|N...     84   5e-016
hg18||uc004clp |9|NM_001013653|Q5VSG2|Q5VSG2_HUMAN|LOC389816|NM_...     83   9e-016
hg18||uc003fts |3|NM_001080513|P22792|CPN2_HUMAN|CPN2|NM_0010805...     82   1e-015
hg18||uc003ftv |3|NM_004488|P40197|GPV_HUMAN|GP5|NM_004488|NP_00...     82   1e-015
hg18||uc003zqu |9|AY358114|Q9BZ20|Q9BZ20_HUMAN|LINGO2|NM_152570|...     80   4e-015
hg18||uc003zqv |9|NM_152570|Q9BZ20|Q9BZ20_HUMAN|LINGO2|NM_152570...     80   4e-015
hg18||uc002bct |15|NM_032808|Q96FE5|Q96FE5_HUMAN|LINGO1|NM_03280...     79   1e-014
hg18||uc002bcu |15|BC068558|Q8N3K5|Q8N3K5_HUMAN|LINGO1|NM_032808...     79   1e-014
hg18||uc002cwj |16|NM_138440|Q6EMK4|VASN_HUMAN|VASN|NM_138440|NP...     79   2e-014
hg18||uc003ftv |3|NM_004488|P40197|GPV_HUMAN|GP5|NM_004488|NP_00...     79   2e-014
hg18||uc003mab |5|NM_003062|O75094|SLIT3_HUMAN|SLIT3|NM_003062|N...     78   3e-014
hg18||uc003ezb |3|NM_178822|Q6WRI0|Q6WRI0_HUMAN|IGSF10|NM_178822...     77   4e-014
hg18||uc004dfh |X|NM_022567|Q9GZU5|NYX_HUMAN|NYX|NM_022567|NP_07...     76   1e-013
hg18||uc004dfi |X|AF254868|Q2M1S4|Q2M1S4_HUMAN|NYX|NM_022567|NP_...     76   1e-013
hg18||uc001swl |12|NM_003667|O75473|LGR5_HUMAN|LGR5|NM_003667|NP...     75   2e-013
hg18||uc001swm |12|BC096326|Q4VAM0|Q4VAM0_HUMAN|LGR5|NM_003667|N...     75   2e-013
hg18||uc004clp |9|NM_001013653|Q5VSG2|Q5VSG2_HUMAN|LOC389816|NM_...     75   2e-013
hg18||uc003zdm |8|NM_001024678|Q50LG9|LRC24_HUMAN|LRRC24|NM_0010...     75   2e-013
hg18||uc003fts |3|NM_001080513|P22792|CPN2_HUMAN|CPN2|NM_0010805...     71   3e-012
hg18||uc001wvm |14|NM_152447|Q96NI6|LRFN5_HUMAN|LRFN5|NM_152447|...     71   3e-012
hg18||uc003cxj |3|NM_198722|Q86WK7|AMGO3_HUMAN|AMIGO3|NM_198722|...     70   4e-012
hg18||uc003dhl |3|NM_020678|Q9HBL6|Q9HBL6_HUMAN|LRTM1|NM_020678|...     70   6e-012
hg18||uc003ftv |3|NM_004488|P40197|GPV_HUMAN|GP5|NM_004488|NP_00...     69   1e-011
hg18||uc004fbx |X|NM_173078|Q8IW52|SLIK4_HUMAN|SLITRK4|NM_173078...     69   2e-011
hg18||uc004fby |X|AX747312|Q8IW52|SLIK4_HUMAN|SLITRK4|NM_173078|...     69   2e-011
hg18||uc003gpr |4|NM_004787|O94813|SLIT2_HUMAN|SLIT2|NM_004787|N...     67   6e-011
hg18||uc003gps |4|AF055585|O94813-3|O94813-3|SLIT2|NM_004787|NP_...     67   6e-011
hg18||uc003mab |5|NM_003062|O75094|SLIT3_HUMAN|SLIT3|NM_003062|N...     66   8e-011
hg18||uc003xki |8|AK027296|NA|NA|KIAA1531|NA|NA|Homo sapiens mRN...     66   8e-011
hg18||uc003xkj |8|NM_032777|Q96PE1|GP124_HUMAN|GPR124|NM_032777|...     66   8e-011
hg18||uc001ezf |1|NM_001004432|Q6UY18|Q6UY18_HUMAN|LINGO4|NM_001...     66   1e-010
hg18||uc001kmw |10|NM_003061|Q5VW17|Q5VW17_HUMAN|SLIT1|NM_003061...     66   1e-010
hg18||uc001wvm |14|NM_152447|Q96NI6|LRFN5_HUMAN|LRFN5|NM_152447|...     66   1e-010
hg18||uc002cmy |16|NM_004970|P35858|ALS_HUMAN|IGFALS|NM_004970|N...     66   1e-010
hg18||uc003zdm |8|NM_001024678|Q50LG9|LRC24_HUMAN|LRRC24|NM_0010...     64   3e-010
hg18||uc001hnv |1|BC109119|Q32MI3|Q32MI3_HUMAN|TLR5|NM_003268|NP...     64   4e-010

>hg18||uc002snt
        |2|BC098301|Q4KMX1|Q4KMX1_HUMAN|LRRTM4|NM_024993|NP_079269|leucine rich
        repeat transmembrane neuronal 4

          Length = 519

 Score =  691 bits (1781), Expect = 9e-199
 Identities = 335/497 (67%), Positives = 402/497 (80%), Gaps = 8/497 (1%)

Query:  12 SERPCPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHLIW 71
           ..| |||.|||||||||||| || |.|.|.||| .|||||.||.  |.. || ||| |||
Sbjct:  31 AQRACPKNCRCDGKIVYCESHAFADIPENISGGSQGLSLRFNSIQKLKSNQFAGLNQLIW 90

Query:  72 LYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQ 131
           ||||||||.|||  ||||.|||||||||||||| ||| ||||||||||||||||||| ||
Sbjct:  91 LYLDHNYISSVDEDAFQGIRRLKELILSSNKITYLHNKTFHPVPNLRNLDLSYNKLQTLQ 150

Query: 132 PGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTE 191
             ||.|||||. ||.|||||| ||.|.|||||||.|||||||||||..||||.||.|| |
Sbjct: 151 SEQFKGLRKLIILHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLSRNAFAGLLKLKE 210

Query: 192 LHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEID 251
           |||||||||||||.|||||.|||..|||||||||.||||||||.|.  |||||||.  |.
Sbjct: 211 LHLEHNQFSKINFAHFPRLFNLRSIYLQWNRIRSISQGLTWTWSSLHNLDLSGNDIQGIE 270

Query: 252 AAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTTISLAGNVWDCGPAICPLVAWLRNF 311
              ..|||||| ||||||||||.||| |.||||| .|.|.||.|.|  .||||  ||.||
Sbjct: 271 PGTFKCLPNLQKLNLDSNKLTNISQETVNAWISLISITLSGNMWECSRSICPLFYWLKNF 330

Query: 312 RGPKETTMICASPKKAQGEKVMDAVDAFGVCQTDSAATLTVNITPTQSRLPAQTEQHPII 371
           .| ||.||||| ||  ||||| |||. . .|           .   .| |  || | |.|
Sbjct: 331 KGNKESTMICAGPKHIQGEKVSDAVETYNICSEVQV------VNTERSHLVPQTPQKPLI 384

Query: 372 LTSPTRTRKGGEGSVQGPTSPAITRPVVPPSEQDLEPVSFHKIVAGSVALFLSVAMILLV 431
           .  ||  .     |     ||.     .| .||. | ||||||.||||||||||||||||
Sbjct: 385 IPRPTIFKPDVTQSTFETPSPS-PGFQIPGAEQEYEHVSFHKIIAGSVALFLSVAMILLV 443

Query: 432 IYVSWKRYPSSVKQLQEHSXXXXXXXXXXXETEQTLSSPLQEYYVDYKPTNSEAMDVLVN 491
           |||||||||.|.||||.||           |.|. ..|||||||||||||||| ||. ||
Sbjct: 444 IYVSWKRYPASMKQLQQHS-LMKRRRKKARESERQMNSPLQEYYVDYKPTNSETMDISVN 502

Query: 492 GTGPCTYTISGSRECEV 508
           |.|||||||||||||||
Sbjct: 503 GSGPCTYTISGSRECEV 519

>hg18||uc002snq |2|AK122612|Q6UXJ7|Q6UXJ7_HUMAN|UNQ3075|NA|NA|GFHL3075

          Length = 590

 Score =  689 bits (1778), Expect = 2e-198
 Identities = 334/497 (67%), Positives = 402/497 (80%), Gaps = 8/497 (1%)

Query:  12 SERPCPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHLIW 71
           ..| |||.|||||||||||| || |.|.|.||| .|||||.||.  |.. || ||| |||
Sbjct:  30 AQRACPKNCRCDGKIVYCESHAFADIPENISGGSQGLSLRFNSIQKLKSNQFAGLNQLIW 89

Query:  72 LYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQ 131
           ||||||||.|||  ||||.|||||||||||||| ||| ||||||||||||||||||| ||
Sbjct:  90 LYLDHNYISSVDEDAFQGIRRLKELILSSNKITYLHNKTFHPVPNLRNLDLSYNKLQTLQ 149

Query: 132 PGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTE 191
             ||.|||||. ||.|||||| ||.|.|||||||.|||||||||||..||||.||.|| |
Sbjct: 150 SEQFKGLRKLIILHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLSRNAFAGLLKLKE 209

Query: 192 LHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEID 251
           |||||||||||||.|||||.|||..|||||||||.||||||||.|.  |||||||.  |.
Sbjct: 210 LHLEHNQFSKINFAHFPRLFNLRSIYLQWNRIRSISQGLTWTWSSLHNLDLSGNDIQGIE 269

Query: 252 AAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTTISLAGNVWDCGPAICPLVAWLRNF 311
              ..|||||| ||||||||||.||| |.||||| .|.|.||.|.|  .||||  ||.||
Sbjct: 270 PGTFKCLPNLQKLNLDSNKLTNISQETVNAWISLISITLSGNMWECSRSICPLFYWLKNF 329

Query: 312 RGPKETTMICASPKKAQGEKVMDAVDAFGVCQTDSAATLTVNITPTQSRLPAQTEQHPII 371
           .| ||.||||| ||  ||||| |||. . .|           .   .| |  || | |.|
Sbjct: 330 KGNKESTMICAGPKHIQGEKVSDAVETYNICSEVQV------VNTERSHLVPQTPQKPLI 383

Query: 372 LTSPTRTRKGGEGSVQGPTSPAITRPVVPPSEQDLEPVSFHKIVAGSVALFLSVAMILLV 431
           .  ||  .     |     ||.     .| .||. | ||||||.||||||||||||||||
Sbjct: 384 IPRPTIFKPDVTQSTFETPSPS-PGFQIPGAEQEYEHVSFHKIIAGSVALFLSVAMILLV 442

Query: 432 IYVSWKRYPSSVKQLQEHSXXXXXXXXXXXETEQTLSSPLQEYYVDYKPTNSEAMDVLVN 491
           |||||||||.|.||||.||           |.|. ..|||||||||||||||| ||. ||
Sbjct: 443 IYVSWKRYPASMKQLQQHS-LMKRRRKKARESERQMNSPLQEYYVDYKPTNSETMDISVN 501

Query: 492 GTGPCTYTISGSRECEV 508
           |.||||||||||||||.
Sbjct: 502 GSGPCTYTISGSRECEM 518

>hg18||uc002snr |2|AY358324|Q6UXJ7|Q6UXJ7_HUMAN|UNQ3075|NA|NA|GFHL3075

          Length = 590

 Score =  689 bits (1778), Expect = 2e-198
 Identities = 334/497 (67%), Positives = 402/497 (80%), Gaps = 8/497 (1%)

Query:  12 SERPCPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHLIW 71
           ..| |||.|||||||||||| || |.|.|.||| .|||||.||.  |.. || ||| |||
Sbjct:  30 AQRACPKNCRCDGKIVYCESHAFADIPENISGGSQGLSLRFNSIQKLKSNQFAGLNQLIW 89

Query:  72 LYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQ 131
           ||||||||.|||  ||||.|||||||||||||| ||| ||||||||||||||||||| ||
Sbjct:  90 LYLDHNYISSVDEDAFQGIRRLKELILSSNKITYLHNKTFHPVPNLRNLDLSYNKLQTLQ 149

Query: 132 PGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTE 191
             ||.|||||. ||.|||||| ||.|.|||||||.|||||||||||..||||.||.|| |
Sbjct: 150 SEQFKGLRKLIILHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLSRNAFAGLLKLKE 209

Query: 192 LHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEID 251
           |||||||||||||.|||||.|||..|||||||||.||||||||.|.  |||||||.  |.
Sbjct: 210 LHLEHNQFSKINFAHFPRLFNLRSIYLQWNRIRSISQGLTWTWSSLHNLDLSGNDIQGIE 269

Query: 252 AAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTTISLAGNVWDCGPAICPLVAWLRNF 311
              ..|||||| ||||||||||.||| |.||||| .|.|.||.|.|  .||||  ||.||
Sbjct: 270 PGTFKCLPNLQKLNLDSNKLTNISQETVNAWISLISITLSGNMWECSRSICPLFYWLKNF 329

Query: 312 RGPKETTMICASPKKAQGEKVMDAVDAFGVCQTDSAATLTVNITPTQSRLPAQTEQHPII 371
           .| ||.||||| ||  ||||| |||. . .|           .   .| |  || | |.|
Sbjct: 330 KGNKESTMICAGPKHIQGEKVSDAVETYNICSEVQV------VNTERSHLVPQTPQKPLI 383

Query: 372 LTSPTRTRKGGEGSVQGPTSPAITRPVVPPSEQDLEPVSFHKIVAGSVALFLSVAMILLV 431
           .  ||  .     |     ||.     .| .||. | ||||||.||||||||||||||||
Sbjct: 384 IPRPTIFKPDVTQSTFETPSPS-PGFQIPGAEQEYEHVSFHKIIAGSVALFLSVAMILLV 442

Query: 432 IYVSWKRYPSSVKQLQEHSXXXXXXXXXXXETEQTLSSPLQEYYVDYKPTNSEAMDVLVN 491
           |||||||||.|.||||.||           |.|. ..|||||||||||||||| ||. ||
Sbjct: 443 IYVSWKRYPASMKQLQQHS-LMKRRRKKARESERQMNSPLQEYYVDYKPTNSETMDISVN 501

Query: 492 GTGPCTYTISGSRECEV 508
           |.||||||||||||||.
Sbjct: 502 GSGPCTYTISGSRECEM 518

>hg18||uc002sns
        |2|NM_024993|Q4FZ98|Q4FZ98_HUMAN|LRRTM4|NM_024993|NP_079269|leucine
        rich repeat transmembrane neuronal 4

          Length = 518

 Score =  688 bits (1774), Expect = 6e-198
 Identities = 334/497 (67%), Positives = 401/497 (80%), Gaps = 8/497 (1%)

Query:  12 SERPCPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHLIW 71
           ..| |||.|||||||||||| ||  .|.|.||| .|||||.||.  |.. || ||| |||
Sbjct:  30 AQRACPKNCRCDGKIVYCESHAFAGIPENISGGSQGLSLRFNSIQKLKSNQFAGLNQLIW 89

Query:  72 LYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQ 131
           ||||||||.|||  ||||.|||||||||||||| ||| ||||||||||||||||||| ||
Sbjct:  90 LYLDHNYISSVDEDAFQGIRRLKELILSSNKITYLHNKTFHPVPNLRNLDLSYNKLQTLQ 149

Query: 132 PGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTE 191
             ||.|||||. ||.|||||| ||.|.|||||||.|||||||||||..||||.||.|| |
Sbjct: 150 SEQFKGLRKLIILHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLSRNAFAGLLKLKE 209

Query: 192 LHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEID 251
           |||||||||||||.|||||.|||..|||||||||.||||||||.|.  |||||||.  |.
Sbjct: 210 LHLEHNQFSKINFAHFPRLFNLRSIYLQWNRIRSISQGLTWTWSSLHNLDLSGNDIQGIE 269

Query: 252 AAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTTISLAGNVWDCGPAICPLVAWLRNF 311
              ..|||||| ||||||||||.||| |.||||| .|.|.||.|.|  .||||  ||.||
Sbjct: 270 PGTFKCLPNLQKLNLDSNKLTNISQETVNAWISLISITLSGNMWECSRSICPLFYWLKNF 329

Query: 312 RGPKETTMICASPKKAQGEKVMDAVDAFGVCQTDSAATLTVNITPTQSRLPAQTEQHPII 371
           .| ||.||||| ||  ||||| |||. . .|           .   .| |  || | |.|
Sbjct: 330 KGNKESTMICAGPKHIQGEKVSDAVETYNICSEVQV------VNTERSHLVPQTPQKPLI 383

Query: 372 LTSPTRTRKGGEGSVQGPTSPAITRPVVPPSEQDLEPVSFHKIVAGSVALFLSVAMILLV 431
           .  ||  .     |     ||.     .| .||. | ||||||.||||||||||||||||
Sbjct: 384 IPRPTIFKPDVTQSTFETPSPS-PGFQIPGAEQEYEHVSFHKIIAGSVALFLSVAMILLV 442

Query: 432 IYVSWKRYPSSVKQLQEHSXXXXXXXXXXXETEQTLSSPLQEYYVDYKPTNSEAMDVLVN 491
           |||||||||.|.||||.||           |.|. ..|||||||||||||||| ||. ||
Sbjct: 443 IYVSWKRYPASMKQLQQHS-LMKRRRKKARESERQMNSPLQEYYVDYKPTNSETMDISVN 501

Query: 492 GTGPCTYTISGSRECEV 508
           |.|||||||||||||||
Sbjct: 502 GSGPCTYTISGSRECEV 518

>hg18||uc002sok
        |2|NM_178839|Q86UE6|LRRT1_HUMAN|LRRTM1|NM_178839|NP_849161|leucine rich
        repeat transmembrane neuronal 1

          Length = 522

 Score =  473 bits (1216), Expect = 3e-133
 Identities = 236/482 (48%), Positives = 330/482 (68%), Gaps = 9/482 (1%)

Query:  16 CPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLD 75
           ||. |||.|...|||.    . | ||| |  |||||||||  |||||| ||  | |||||
Sbjct:  39 CPQLCRCEGRLLYCEALNLTEAPHNLS-GLLGLSLRYNSLSELRAGQFTGLMQLTWLYLD 97

Query:  76 HNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQF 135
           ||.| || | ||| .||.||| ||||.|| | |||| |.||||..|||||||||| |  |
Sbjct:  98 HNHICSVQGDAFQKLRRVKELTLSSNQITQLPNTTFRPMPNLRSVDLSYNKLQALAPDLF 157

Query: 136 QGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLE 195
            ||||| .||.|.|... ||.|.|||||.|.|||.|||.|.|. ||.|.|| ||||||||
Sbjct: 158 HGLRKLTTLHMRANAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLE 217

Query: 196 HNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVY 255
           ||   |.||.||||| .| .| |. |..  .   | | | ...|.|||||..  ..  |.
Sbjct: 218 HNDLVKVNFAHFPRLISLHSLCLRRNKVAIVVSSLDWVW-NLEKMDLSGNEIEYMEPHVF 276

Query: 256 QCLPNLQTLNLDSNKLTNVSQEVVDAWISLTTISLAGNVWDCGPAICPLVAWLRNFRGPK 315
           . .|.||.| ||||.|| .   ....| |||.|.||||.||||  .| | .|| ||.|  
Sbjct: 277 ETVPHLQSLQLDSNRLTYIEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLNNFQGRY 336

Query: 316 ETTMICASPKKAQGEKVMDAVDAFGVCQTDSAATLTVNITPTQSRLPAQTEQHPIILTSP 375
           .  . ||||. |||| |.||| || .|.  .  |    ..   .|    ..  |   .| 
Sbjct: 337 DGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSGHLLSAVTNR----SDLGP-PASSA 391

Query: 376 TRTRKGGEGSVQGPTSPAITRPVVPPSEQDLEPVSFHKIVAGSVALFLSVAMILLVIYVS 435
           |    ||||   |   ||     .|  |     |  ||.| |..||  |  ...||.|||
Sbjct: 392 TTLADGGEGQHDGTFEPATV--ALPGGEHAENAVQIHKVVTGTMALIFSFLIVVLVLYVS 449

Query: 436 WKRYPSSVKQLQEHSXXXXXXXXXXXETEQTLSSPLQEYYVDYKPTNSEAMDVLVNGTGP 495
           || .|.|..||..                |  .   ||||||||| . |   |..|  | 
Sbjct: 450 WKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYVDYKPNHIEGALVIINEYGS 509

Query: 496 CT 497
           ||
Sbjct: 510 CT 511

>hg18||uc001jmy
        |10|AY358315|Q86VH5-2|Q86VH5-2|LRRTM3|NM_178011|NP_821079|leucine rich
        repeat transmembrane neuronal 3

          Length = 513

 Score =  451 bits (1160), Expect = 9e-127
 Identities = 207/334 (61%), Positives = 268/334 (80%), Gaps = 1/334 (0%)

Query:  10 SLSERPCPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHL 69
           | .|| ||| |||.||.|||||   ...| ..| || |||||||||  |.  || ||| |
Sbjct:  28 SSAERGCPKGCRCEGKMVYCESQKLQEIPSSISAGCLGLSLRYNSLQKLKYNQFKGLNQL 87

Query:  70 IWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQA 129
            |||||||.|...|  || |.|||||||||||.|.   | || || ||||||||||.| .
Sbjct:  88 TWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNTFRPVTNLRNLDLSYNQLHS 147

Query: 130 LQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKL 189
           |   ||.|||||||||.|||||. .|.|.|||||||| |||||||.||. || |.|...|
Sbjct: 148 LGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCRNLELLDLGYNRIRSLARNVFAGMIRL 207

Query: 190 TELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTE 249
            |||||||||||.| . |||| .|. ||||||.|  . | ..|||.|.|.||||||..  
Sbjct: 208 KELHLEHNQFSKLNLALFPRLVSLQNLYLQWNKISVIGQTMSWTWSSLQRLDLSGNEIEA 267

Query: 250 IDA-AVYQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTTISLAGNVWDCGPAICPLVAWL 308
               .|.||.|||| ||||||||| . ||..|.||||  ||||||.|.|   || || ||
Sbjct: 268 FSGPSVFQCVPNLQRLNLDSNKLTFIGQEILDSWISLNDISLAGNIWECSRNICSLVNWL 327

Query: 309 RNFRGPKETTMICASPKKAQGEKVMDAVDAFGVC 342
           ..|.| .| |.||||||. ||  |.|||  . .|
Sbjct: 328 KSFKGLRENTIICASPKELQGVNVIDAVKNYSIC 361

>hg18||uc001jmz
        |10|NM_178011|Q86VH5|LRRT3_HUMAN|LRRTM3|NM_178011|NP_821079|leucine
        rich repeat transmembrane neuronal 3

          Length = 581

 Score =  451 bits (1160), Expect = 9e-127
 Identities = 207/334 (61%), Positives = 268/334 (80%), Gaps = 1/334 (0%)

Query:  10 SLSERPCPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHL 69
           | .|| ||| |||.||.|||||   ...| ..| || |||||||||  |.  || ||| |
Sbjct:  28 SSAERGCPKGCRCEGKMVYCESQKLQEIPSSISAGCLGLSLRYNSLQKLKYNQFKGLNQL 87

Query:  70 IWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQA 129
            |||||||.|...|  || |.|||||||||||.|.   | || || ||||||||||.| .
Sbjct:  88 TWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNTFRPVTNLRNLDLSYNQLHS 147

Query: 130 LQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKL 189
           |   ||.|||||||||.|||||. .|.|.|||||||| |||||||.||. || |.|...|
Sbjct: 148 LGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCRNLELLDLGYNRIRSLARNVFAGMIRL 207

Query: 190 TELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTE 249
            |||||||||||.| . |||| .|. ||||||.|  . | ..|||.|.|.||||||..  
Sbjct: 208 KELHLEHNQFSKLNLALFPRLVSLQNLYLQWNKISVIGQTMSWTWSSLQRLDLSGNEIEA 267

Query: 250 IDA-AVYQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTTISLAGNVWDCGPAICPLVAWL 308
               .|.||.|||| ||||||||| . ||..|.||||  ||||||.|.|   || || ||
Sbjct: 268 FSGPSVFQCVPNLQRLNLDSNKLTFIGQEILDSWISLNDISLAGNIWECSRNICSLVNWL 327

Query: 309 RNFRGPKETTMICASPKKAQGEKVMDAVDAFGVC 342
           ..|.| .| |.||||||. ||  |.|||  . .|
Sbjct: 328 KSFKGLRENTIICASPKELQGVNVIDAVKNYSIC 361

>hg18||uc003ldk
        |5|NM_015564|O43300|LRRT2_HUMAN|LRRTM2|NM_015564|NP_056379|leucine rich
        repeat transmembrane neuronal 2

          Length = 516

 Score =  371 bits (952), Expect = 1e-102
 Identities = 177/347 (51%), Positives = 244/347 (70%), Gaps = 3/347 (0%)

Query:  16 CPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLD 75
           ||  |||.  . ||.|  |  ||     |  |||||.| .  |   ||   . | ||.||
Sbjct:  34 CPPKCRCEKLLFYCDSQGFHSVPNATDKGSLGLSLRHNHITELERDQFASFSQLTWLHLD 93

Query:  76 HNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQF 135
           || |..|   ||||. .|||||||||||  | ||||  . ||.|||||.|.| .| |  |
Sbjct:  94 HNQISTVKEDAFQGLYKLKELILSSNKIFYLPNTTFTQLINLQNLDLSFNQLSSLHPELF 153

Query: 136 QGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLE 195
            ||||| .||.|||||. .|.||| |||.||||||  |||||. || |.||.|| |||||
Sbjct: 154 YGLRKLQTLHLRSNSLRTIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLRELHLE 213

Query: 196 HNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVY 255
           ||| .||||.|| || .|  |.||||.| ... |. ||| ...||||.||..  ||  |.
Sbjct: 214 HNQLTKINFAHFLRLSSLHTLFLQWNKISNLTCGMEWTWGTLEKLDLTGNEIKAIDLTVF 273

Query: 256 QCLPNLQTLNLDSNKLTNVSQEVVDAWISLTTISLAGNVWDCGPAICPLVAWLRNFRGPK 315
           . .|||. | .|.||| ..  .....  ||||. |.||.|.|   || | .|| .|.|  
Sbjct: 274 ETMPNLKILLMDNNKLNSLDSKILNSLRSLTTVGLSGNLWECSARICALASWLGSFQGRW 333

Query: 316 ETTMICASPKKAQGEKVMDAVDAFGVCQTDSAATLTVNITPTQSRLP 362
           | ...| ||   ||| ..|||  | .|   |    || .  |  | |
Sbjct: 334 EHSILCHSPDHTQGEDILDAVHGFQLCWNLST---TVTVMATTYRDP 377

>hg18||uc001jmy
        |10|AY358315|Q86VH5-2|Q86VH5-2|LRRTM3|NM_178011|NP_821079|leucine rich
        repeat transmembrane neuronal 3

          Length = 513

 Score =  136 bits (341), Expect = 9e-032
 Identities = 72/134 (53%), Positives = 89/134 (66%), Gaps = 2/134 (1%)

Query: 375 PTRTRKGGEGSVQGPTSPAITRPVVPPSEQDLEPVSFHKIVAGSVALFLSVAMILLVIYV 434
           |   |   |     | .   | |  | .. | | .|||||.|||||||||| .|||||||
Sbjct: 382 PKLPRPKHESKPPLPPTVGATEP-GPETDADAEHISFHKIIAGSVALFLSVLVILLVIYV 440

Query: 435 SWKRYPSSVKQLQEHSXXXXXXXXXXXETEQTLSSPLQEYYVDYKPTNSEAMDVLVNGTG 494
           ||||||.|.||||. |             .| ..   ||.||||||||.|  ..|.||||
Sbjct: 441 SWKRYPASMKQLQQRSLMRRHRKKKRQSLKQ-MTPSTQEFYVDYKPTNTETSEMLLNGTG 499

Query: 495 PCTYTISGSRECEV 508
           ||||  ||||||||
Sbjct: 500 PCTYNKSGSRECEV 513

>hg18||uc001jmz
        |10|NM_178011|Q86VH5|LRRT3_HUMAN|LRRTM3|NM_178011|NP_821079|leucine
        rich repeat transmembrane neuronal 3

          Length = 581

 Score =  136 bits (340), Expect = 1e-031
 Identities = 71/134 (52%), Positives = 89/134 (66%), Gaps = 2/134 (1%)

Query: 375 PTRTRKGGEGSVQGPTSPAITRPVVPPSEQDLEPVSFHKIVAGSVALFLSVAMILLVIYV 434
           |   |   |     | .   | |  | .. | | .|||||.|||||||||| .|||||||
Sbjct: 382 PKLPRPKHESKPPLPPTVGATEP-GPETDADAEHISFHKIIAGSVALFLSVLVILLVIYV 440

Query: 435 SWKRYPSSVKQLQEHSXXXXXXXXXXXETEQTLSSPLQEYYVDYKPTNSEAMDVLVNGTG 494
           ||||||.|.||||. |             .| ..   ||.||||||||.|  ..|.||||
Sbjct: 441 SWKRYPASMKQLQQRSLMRRHRKKKRQSLKQ-MTPSTQEFYVDYKPTNTETSEMLLNGTG 499

Query: 495 PCTYTISGSRECEV 508
           ||||  |||||||.
Sbjct: 500 PCTYNKSGSRECEI 513

>hg18||uc003ftt
        |3|NM_130830|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|NP_570843|leucine rich
        repeat containing 15

          Length = 581

 Score =  123 bits (307), Expect = 7e-028
 Identities = 92/292 (31%), Positives = 135/292 (46%), Gaps = 2/292 (0%)

Query:  44 GCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKI 103
           |   |.|  |||  .    |  | .|  | |  | .| .    | |.  |.|| |  |.|
Sbjct: 174 GLTKLNLGKNSLTHISPRVFQHLGNLQVLRLYENRLTDIPMGTFDGLVNLQELALQQNQI 233

Query: 104 TSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCR 163
             |    ||   ||. | || | .  | |  |  | .|  | .  |||| . . .|    
Sbjct: 234 GLLSPGLFHNNHNLQRLYLSNNHISQLPPSIFMQLPQLNRLTLFGNSLKELSLGIFGPMP 293

Query: 164 NLEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRI 223
           ||  | |  | . |.  | || | .|  | |  || | |.   |  |  || | |  | .
Sbjct: 294 NLRELWLYDNHISSLPDNVFSNLRQLQVLILSRNQISFISPGAFNGLTELRELSLHTNAL 353

Query: 224 RSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWI 283
           . .   .    |..| . |  | | ..   ..  .  |  . | .|.| |.   . |   
Sbjct: 354 QDLDGNVFRMLANLQNISLQNNRLRQLPGNIFANVNGLMAIQLQNNQLENLPLGIFDHLG 413

Query: 284 SLTTISLAGNVWDCGPAICPLVAW--LRNFRGPKETTMICASPKKAQGEKVM 333
            |  . |  | | |   | ||  |  |   |   .|  .| ||   .|. ..
Sbjct: 414 KLCELRLYDNPWRCDSDILPLRNWLLLNQPRLGTDTVPVCFSPANVRGQSLI 465

>hg18||uc003ftu
        |3|BC101065|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|NP_570843|leucine rich
        repeat containing 15

          Length = 581

 Score =  123 bits (307), Expect = 7e-028
 Identities = 92/292 (31%), Positives = 135/292 (46%), Gaps = 2/292 (0%)

Query:  44 GCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKI 103
           |   |.|  |||  .    |  | .|  | |  | .| .    | |.  |.|| |  |.|
Sbjct: 174 GLTKLNLGKNSLTHISPRVFQHLGNLQVLRLYENRLTDIPMGTFDGLVNLQELALQQNQI 233

Query: 104 TSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCR 163
             |    ||   ||. | || | .  | |  |  | .|  | .  |||| . . .|    
Sbjct: 234 GLLSPGLFHNNHNLQRLYLSNNHISQLPPSIFMQLPQLNRLTLFGNSLKELSLGIFGPMP 293

Query: 164 NLEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRI 223
           ||  | |  | . |.  | || | .|  | |  || | |.   |  |  || | |  | .
Sbjct: 294 NLRELWLYDNHISSLPDNVFSNLRQLQVLILSRNQISFISPGAFNGLTELRELSLHTNAL 353

Query: 224 RSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWI 283
           . .   .    |..| . |  | | ..   ..  .  |  . | .|.| |.   . |   
Sbjct: 354 QDLDGNVFRMLANLQNISLQNNRLRQLPGNIFANVNGLMAIQLQNNQLENLPLGIFDHLG 413

Query: 284 SLTTISLAGNVWDCGPAICPLVAW--LRNFRGPKETTMICASPKKAQGEKVM 333
            |  . |  | | |   | ||  |  |   |   .|  .| ||   .|. ..
Sbjct: 414 KLCELRLYDNPWRCDSDILPLRNWLLLNQPRLGTDTVPVCFSPANVRGQSLI 465

>hg18||uc002cmy
        |16|NM_004970|P35858|ALS_HUMAN|IGFALS|NM_004970|NP_004961|insulin-like
        growth factor binding protein, acid

          Length = 605

 Score =  121 bits (302), Expect = 3e-027
 Identities = 89/273 (32%), Positives = 133/273 (48%), Gaps = 7/273 (2%)

Query:   9 PSLSERP-CPKSCRC------DGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAG 61
           |  .| | || .| |      |   |.| |     .|  . || . | |  |.| |.   
Sbjct:  33 PGEAEGPACPAACVCSYDDDADELSVFCSSRNLTRLPDGVPGGTQALWLDGNNLSSVPPA 92

Query:  62 QFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLD 121
            |  |. | .| |    . |..  |  |.  |  | |  |.. ||   ||   | | .| 
Sbjct:  93 AFQNLSSLGFLNLQGGQLGSLEPQALLGLENLCHLHLERNQLRSLALGTFAHTPALASLG 152

Query: 122 LSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRN 181
           || |.|  |. | |.||  |  |..  ||| ..|   |.   .|  | |  |||  .   
Sbjct: 153 LSNNRLSRLEDGLFEGLGSLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQPA 212

Query: 182 AFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLD 241
            |||| .| || |  |    |  . | .|  |. |||  | | ... |      ... ||
Sbjct: 213 LFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLD 272

Query: 242 LSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNV 274
           || | .  .    .  |  |. | |  | . ..
Sbjct: 273 LSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASL 305

>hg18||uc002cmy
        |16|NM_004970|P35858|ALS_HUMAN|IGFALS|NM_004970|NP_004961|insulin-like
        growth factor binding protein, acid

          Length = 605

 Score =  120 bits (299), Expect = 6e-027
 Identities = 79/246 (32%), Positives = 121/246 (49%)

Query:  48 LSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLH 107
           | |  | |  |  | | ||  |  | |  | .  .   ||.|.  |.||.|. |..  | 
Sbjct: 151 LGLSNNRLSRLEDGLFEGLGSLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQ 210

Query: 108 NTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEF 167
              |  .  || |||| | |.|..   |  | .|  |..  | .  |    |   . | .
Sbjct: 211 PALFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLDRNLIAAVAPGAFLGLKALRW 270

Query: 168 LDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMS 227
           ||| .||.  .  . | ||. |  | | ||  . .    |  |. |  | |  |||| ..
Sbjct: 271 LDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLA 330

Query: 228 QGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTT 287
           .        .. | |  | | |. |  .  | |.  .||  | | |. ..|      | .
Sbjct: 331 ERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHS 390

Query: 288 ISLAGN 293
           . | |.
Sbjct: 391 LHLEGS 396

>hg18||uc003ftt
        |3|NM_130830|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|NP_570843|leucine rich
        repeat containing 15

          Length = 581

 Score =  120 bits (299), Expect = 6e-027
 Identities = 79/246 (32%), Positives = 119/246 (48%)

Query:  48 LSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLH 107
           | .  | |  .  | |  |  | .| | .| .  .    |||.  |. |.||||..  . 
Sbjct:  82 LRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQGLDSLESLLLSSNQLLQIQ 141

Query: 108 NTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEF 167
              |    ||. | |  | |. .  | |  |  |  |..  |||  .  |.||   ||. 
Sbjct: 142 PAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVGLTKLNLGKNSLTHISPRVFQHLGNLQV 201

Query: 168 LDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMS 227
           | |  |||  |    | ||| | || |. ||   ..   |   .||. |||  | |  . 
Sbjct: 202 LRLYENRLTDIPMGTFDGLVNLQELALQQNQIGLLSPGLFHNNHNLQRLYLSNNHISQLP 261

Query: 228 QGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTT 287
             .      . .| | || | |.   ..  .|||. | |  | ....   |      |  
Sbjct: 262 PSIFMQLPQLNRLTLFGNSLKELSLGIFGPMPNLRELWLYDNHISSLPDNVFSNLRQLQV 321

Query: 288 ISLAGN 293
           . |. |
Sbjct: 322 LILSRN 327

>hg18||uc003ftu
        |3|BC101065|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|NP_570843|leucine rich
        repeat containing 15

          Length = 581

 Score =  120 bits (299), Expect = 6e-027
 Identities = 79/246 (32%), Positives = 119/246 (48%)

Query:  48 LSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLH 107
           | .  | |  .  | |  |  | .| | .| .  .    |||.  |. |.||||..  . 
Sbjct:  82 LRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQGLDSLESLLLSSNQLLQIQ 141

Query: 108 NTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEF 167
              |    ||. | |  | |. .  | |  |  |  |..  |||  .  |.||   ||. 
Sbjct: 142 PAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVGLTKLNLGKNSLTHISPRVFQHLGNLQV 201

Query: 168 LDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMS 227
           | |  |||  |    | ||| | || |. ||   ..   |   .||. |||  | |  . 
Sbjct: 202 LRLYENRLTDIPMGTFDGLVNLQELALQQNQIGLLSPGLFHNNHNLQRLYLSNNHISQLP 261

Query: 228 QGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTT 287
             .      . .| | || | |.   ..  .|||. | |  | ....   |      |  
Sbjct: 262 PSIFMQLPQLNRLTLFGNSLKELSLGIFGPMPNLRELWLYDNHISSLPDNVFSNLRQLQV 321

Query: 288 ISLAGN 293
           . |. |
Sbjct: 322 LILSRN 327

>hg18||uc002cmy
        |16|NM_004970|P35858|ALS_HUMAN|IGFALS|NM_004970|NP_004961|insulin-like
        growth factor binding protein, acid

          Length = 605

 Score =  116 bits (290), Expect = 7e-026
 Identities = 76/232 (32%), Positives = 116/232 (50%)

Query:  48 LSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLH 107
           | |  | . ..  | |.||  | || | || .  .    | |.  |. | || | | || 
Sbjct: 247 LYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLR 306

Query: 108 NTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEF 167
             ||  .  |  | | .|... |    |.|| .|  | .  | |. |    |    |.  
Sbjct: 307 PRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAV 366

Query: 168 LDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMS 227
           ..|  | ||..    | || ||  |||| .   .|    |  |  || |.|. | .  . 
Sbjct: 367 MNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIE 426

Query: 228 QGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVSQEVV 279
           .   |  | . .|||. | || .   ..| |  |. | |  |.|  .  . .
Sbjct: 427 EQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADAL 478

>hg18||uc002mau
        |19|NM_052972|P02750|A2GL_HUMAN|LRG1|NM_052972|NP_443204|leucine-rich
        alpha-2-glycoprotein 1

          Length = 347

 Score =  111 bits (277), Expect = 2e-024
 Identities = 75/262 (28%), Positives = 121/262 (46%), Gaps = 7/262 (2%)

Query:  79 ITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGL 138
           .| .     ||  .|.|| |||| . ||      ||| || |||. | |  | || ||  
Sbjct:  80 LTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQAS 139

Query: 139 RKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQ 198
             | .| .. | |... .      . |  |||  |||| .     .    |  | |  ||
Sbjct: 140 ATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQ 199

Query: 199 FSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCL 258
              .          |  |.|. |... . . |      .. | |.|| |  . |  .| |
Sbjct: 200 LETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGL 259

Query: 259 PNLQTLNLDSNKLTNVSQEVVDA-----WISLTTISLAGNVWDCGPAICPLVAWLRNFRG 313
             |  |.| .| | .| . .  .     |       ..|| | |   .  |  ||.  . 
Sbjct: 260 RQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKD 319

Query: 314 P--KETTMICASPKKAQGEKVM 333
               .    || |.  .|. ..
Sbjct: 320 KMFSQNDTRCAGPEAVKGQTLL 341

>hg18||uc003szt |7|NM_014817|NA|NA|KIAA0644|NM_014817|NP_055632|hypothetical
        protein LOC9865

          Length = 811

 Score =  111 bits (277), Expect = 2e-024
 Identities = 89/297 (29%), Positives = 141/297 (47%), Gaps = 6/297 (2%)

Query:  46 EGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITS 105
           | | |  | | .|  |    |  |  || . | |. .   .|.|.  | .| |  | . .
Sbjct: 110 EELYLGNNLLQALAPGTLAPLRKLRILYANGNEISRLSRGSFEGLESLVKLRLDGNALGA 169

Query: 106 LHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLK--IVPMRLFQDCR 163
           | .  | |. ||  | |  |... |    |  | ||  |.. .| |.  .     |   |
Sbjct: 170 LPDAVFAPLGNLLYLHLESNRIRFLGKNAFAQLGKLRFLNLSANELQPSLRHAATFAPLR 229

Query: 164 NLEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRI 223
           .|  | |  | |. .    |  | .|  | |  || . .    |  |  || | |. ||.
Sbjct: 230 SLSSLILSANNLQHLGPRIFQHLPRLGLLSLRGNQLTHLAPEAFWGLEALRELRLEGNRL 289

Query: 224 RSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWI 283
             .   |     |.. ||||||.|. .  | .  |  |. |.| .| |. .| ..  |  
Sbjct: 290 SQLPTALLEPLHSLEALDLSGNELSALHPATFGHLGRLRELSLRNNALSALSGDIFAASP 349

Query: 284 SLTTISLAGNVWDCGPAICPLVAWLRNFRGPKETTMI---CASPKKAQGEKVMDAVD 337
           .|  . | || | |   .  |  |. ..        .   |  |   .| | .| .|
Sbjct: 350 ALYRLDLDGNGWTCDCRLRGLKRWMGDWHSQGRLLTVFVQCRHPPALRG-KYLDYLD 405

>hg18||uc003fts
        |3|NM_001080513|P22792|CPN2_HUMAN|CPN2|NM_001080513|NP_001073982|carbox
        ypeptidase N, polypeptide 2, 83kD

          Length = 545

 Score =  111 bits (276), Expect = 3e-024
 Identities = 76/267 (28%), Positives = 126/267 (47%), Gaps = 3/267 (1%)

Query:   5 LAANPSLSERPCPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFV 64
           | | |.   .|||  | |  . |.|       || ..    . .     |  .|    | 
Sbjct:  14 LLARPA---QPCPMGCDCFVQEVFCSDEELATVPLDIPPYTKNIIFVETSFTTLETRAFG 70

Query:  65 GLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSY 124
              .|  .   .  .      || |. ||..| .. .   .|    |  . .|  | |..
Sbjct:  71 SNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNLTSLGKLTLNF 130

Query: 125 NKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFS 184
           | |.||  | || |  | |||.. | |. .| ||||   .|. |.|  | |  .    | 
Sbjct: 131 NMLEALPEGLFQHLAALESLHLQGNQLQALPRRLFQPLTHLKTLNLAQNLLAQLPEELFH 190

Query: 185 GLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSG 244
            |  |  | | .|  | .    | .| .|. |.|  | |  .   .      ...| |  
Sbjct: 191 PLTSLQTLKLSNNALSGLPQGVFGKLGSLQELFLDSNNISELPPQVFSQLFCLERLWLQR 250

Query: 245 NDLTEIDAAVYQCLPNLQTLNLDSNKL 271
           | .| .  ...  | ||  |.|  | |
Sbjct: 251 NAITHLPLSIFASLGNLTFLSLQWNML 277

>hg18||uc002cmy
        |16|NM_004970|P35858|ALS_HUMAN|IGFALS|NM_004970|NP_004961|insulin-like
        growth factor binding protein, acid

          Length = 605

 Score =  106 bits (264), Expect = 7e-023
 Identities = 75/251 (29%), Positives = 117/251 (46%)

Query:  43 GGCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNK 102
           |    | |  | |  |.   | ||  |  | |  | . ..    |  . ||..| |  | 
Sbjct: 194 GSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLDRNL 253

Query: 103 ITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDC 162
           | ..    |  .  || ||||.|..  |    | ||  |  | .  |..  .  | |.| 
Sbjct: 254 IAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLRPRTFKDL 313

Query: 163 RNLEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNR 222
             || | ||.||.| .   .| || .|  | |.|||  ..    |  | |.  . |  | 
Sbjct: 314 HFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSGNC 373

Query: 223 IRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVSQEVVDAW 282
           .|.. . .      .  | | |. |  |    .  |  |. | |  | |  . .. .   
Sbjct: 374 LRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGL 433

Query: 283 ISLTTISLAGN 293
             |  . |  |
Sbjct: 434 AELLELDLTSN 444

>hg18||uc003szt |7|NM_014817|NA|NA|KIAA0644|NM_014817|NP_055632|hypothetical
        protein LOC9865

          Length = 811

 Score =  102 bits (254), Expect = 1e-021
 Identities = 74/222 (33%), Positives = 110/222 (49%), Gaps = 2/222 (0%)

Query:  74 LDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPG 133
           |  |.||..    |  . .|. | |  |.| |||  ||  .  |  | |  | |||| ||
Sbjct:  66 LGGNFITNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQALAPG 125

Query: 134 QFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELH 193
               ||||  |.   | .  .    |.   .|  | |  | | ..    |. |  |  ||
Sbjct: 126 TLAPLRKLRILYANGNEISRLSRGSFEGLESLVKLRLDGNALGALPDAVFAPLGNLLYLH 185

Query: 194 LEHNQFSKINFSHFPRLYNLRALYLQWNRIR-SMSQGLTWT-WASIQKLDLSGNDLTEID 251
           || |.   .  . | .|  || | |  | .. |.    |.    |.  | || |.|  . 
Sbjct: 186 LESNRIRFLGKNAFAQLGKLRFLNLSANELQPSLRHAATFAPLRSLSSLILSANNLQHLG 245

Query: 252 AAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTTISLAGN 293
             ..| || |  |.|  |.||... |      .|  . | ||
Sbjct: 246 PRIFQHLPRLGLLSLRGNQLTHLAPEAFWGLEALRELRLEGN 287

>hg18||uc003mab |5|NM_003062|O75094|SLIT3_HUMAN|SLIT3|NM_003062|NP_003053|slit
        homolog 3

          Length = 1523

 Score =  101 bits (251), Expect = 2e-021
 Identities = 55/182 (30%), Positives = 91/182 (50%)

Query:  16 CPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLD 75
           ||  | |    | |     | ||. .    | | |  |..  .    | || .|  |.|.
Sbjct:  34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLE 93

Query:  76 HNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQF 135
            | .. ..  ||| ...|. | |. ||.  |    |   | |  |||| |..| .    |
Sbjct:  94 DNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAF 153

Query: 136 QGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLE 195
           .|.  . .| . .| .  .    |.  |.|| | |  | .  |   .|. . |.  | | 
Sbjct: 154 RGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLH 213

Query: 196 HN 197
            |
Sbjct: 214 SN 215

>hg18||uc003gpr |4|NM_004787|O94813|SLIT2_HUMAN|SLIT2|NM_004787|NP_004778|slit
        homolog 2

          Length = 1529

 Score =  99 bits (246), Expect = 9e-021
 Identities = 59/193 (30%), Positives = 93/193 (48%)

Query:   5 LAANPSLSERPCPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFV 64
           ||    .. . ||  | | |  | |   | | ||.|.    | | |  |..  .    | 
Sbjct:  17 LAILNKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFA 76

Query:  65 GLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSY 124
           || ||  | |  | |....  ||| .. |. | |. | .       |     |  |||| 
Sbjct:  77 GLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSE 136

Query: 125 NKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFS 184
           |..||.    |.|   . .| .  | .  .    |.  |.|| | |  | .  ..  .|.
Sbjct: 137 NQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFN 196

Query: 185 GLVKLTELHLEHN 197
            . ||    |  |
Sbjct: 197 HMPKLRTFRLHSN 209

>hg18||uc003gps |4|AF055585|O94813-3|O94813-3|SLIT2|NM_004787|NP_004778|slit
        homolog 2

          Length = 1521

 Score =  99 bits (246), Expect = 9e-021
 Identities = 59/193 (30%), Positives = 93/193 (48%)

Query:   5 LAANPSLSERPCPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFV 64
           ||    .. . ||  | | |  | |   | | ||.|.    | | |  |..  .    | 
Sbjct:  17 LAILNKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFA 76

Query:  65 GLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSY 124
           || ||  | |  | |....  ||| .. |. | |. | .       |     |  |||| 
Sbjct:  77 GLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSE 136

Query: 125 NKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFS 184
           |..||.    |.|   . .| .  | .  .    |.  |.|| | |  | .  ..  .|.
Sbjct: 137 NQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFN 196

Query: 185 GLVKLTELHLEHN 197
            . ||    |  |
Sbjct: 197 HMPKLRTFRLHSN 209

>hg18||uc003ftt
        |3|NM_130830|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|NP_570843|leucine rich
        repeat containing 15

          Length = 581

 Score =  99 bits (244), Expect = 2e-020
 Identities = 70/222 (31%), Positives = 108/222 (48%)

Query:  72 LYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQ 131
           | . . .|| ..   |  .  |  | .  |... .    |  . .|| | |. |||| | 
Sbjct:  58 LQILNTHITELNESPFLNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLP 117

Query: 132 PGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTE 191
            | ||||  | || . || |  .    |  | ||. | |  | |  |   ||  || ||.
Sbjct: 118 IGLFQGLDSLESLLLSSNQLLQIQPAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVGLTK 177

Query: 192 LHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEID 251
           |.|  |  . |.   |  | ||. | |  ||.  .  |      ..|.| |  | .  . 
Sbjct: 178 LNLGKNSLTHISPRVFQHLGNLQVLRLYENRLTDIPMGTFDGLVNLQELALQQNQIGLLS 237

Query: 252 AAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTTISLAGN 293
             ..    ||| | | .| .. .   .      |  ..| ||
Sbjct: 238 PGLFHNNHNLQRLYLSNNHISQLPPSIFMQLPQLNRLTLFGN 279

>hg18||uc003ftu
        |3|BC101065|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|NP_570843|leucine rich
        repeat containing 15

          Length = 581

 Score =  99 bits (244), Expect = 2e-020
 Identities = 70/222 (31%), Positives = 108/222 (48%)

Query:  72 LYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQ 131
           | . . .|| ..   |  .  |  | .  |... .    |  . .|| | |. |||| | 
Sbjct:  58 LQILNTHITELNESPFLNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLP 117

Query: 132 PGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTE 191
            | ||||  | || . || |  .    |  | ||. | |  | |  |   ||  || ||.
Sbjct: 118 IGLFQGLDSLESLLLSSNQLLQIQPAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVGLTK 177

Query: 192 LHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEID 251
           |.|  |  . |.   |  | ||. | |  ||.  .  |      ..|.| |  | .  . 
Sbjct: 178 LNLGKNSLTHISPRVFQHLGNLQVLRLYENRLTDIPMGTFDGLVNLQELALQQNQIGLLS 237

Query: 252 AAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTTISLAGN 293
             ..    ||| | | .| .. .   .      |  ..| ||
Sbjct: 238 PGLFHNNHNLQRLYLSNNHISQLPPSIFMQLPQLNRLTLFGN 279

>hg18||uc001kmw |10|NM_003061|Q5VW17|Q5VW17_HUMAN|SLIT1|NM_003061|NP_003052|slit
        homolog 1

          Length = 1534

 Score =  97 bits (240), Expect = 4e-020
 Identities = 62/197 (31%), Positives = 91/197 (46%), Gaps = 3/197 (1%)

Query:   4 WL---AANPSLSERPCPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRA 60
           ||   ||   |    ||  | | |  | |  .  . .|||.    | | |  |..  .  
Sbjct:  19 WLLLWAAAWRLGASACPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITRIHK 78

Query:  61 GQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNL 120
             | ||  |  | |  | | .|.  ||  .. |. | |. |..  |    |     |  |
Sbjct:  79 NDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHMLPELLFQNNQALSRL 138

Query: 121 DLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITR 180
           ||| | .||.    |.|   | .| .  | .  .    |.  | || | |  | . .|  
Sbjct: 139 DLSENAIQAIPRKAFRGATDLKNLRLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPV 198

Query: 181 NAFSGLVKLTELHLEHN 197
           ..|. . ||    |  |
Sbjct: 199 SSFNHMPKLRTFRLHSN 215

>hg18||uc003fts
        |3|NM_001080513|P22792|CPN2_HUMAN|CPN2|NM_001080513|NP_001073982|carbox
        ypeptidase N, polypeptide 2, 83kD

          Length = 545

 Score =  97 bits (240), Expect = 4e-020
 Identities = 75/271 (27%), Positives = 123/271 (45%), Gaps = 2/271 (0%)

Query:  25 KIVYCESSAFRDVPKNLSG--GCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSV 82
           |.|.  .   .  |    |    | | .  .| ..|    |  |  |  | |. | . ..
Sbjct:  77 KVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNLTSLGKLTLNFNMLEAL 136

Query:  83 DGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLL 142
               || .  |. | |  |.. .|    | |. .|. |.|. | |  |    |  |  | 
Sbjct: 137 PEGLFQHLAALESLHLQGNQLQALPRRLFQPLTHLKTLNLAQNLLAQLPEELFHPLTSLQ 196

Query: 143 SLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKI 202
           .| . .|.|  .|  .|    .|. | |  | .  .    || |  |  | |. |  . .
Sbjct: 197 TLKLSNNALSGLPQGVFGKLGSLQELFLDSNNISELPPQVFSQLFCLERLWLQRNAITHL 256

Query: 203 NFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQ 262
             | |  | ||  | |||| .| .  ||      .  | |. | |  .    .  | ||.
Sbjct: 257 PLSIFASLGNLTFLSLQWNMLRVLPAGLFAHTPCLVGLSLTHNQLETVAEGTFAHLSNLR 316

Query: 263 TLNLDSNKLTNVSQEVVDAWISLTTISLAGN 293
           .| |  | .|..   .      |  . |  |
Sbjct: 317 SLMLSYNAITHLPAGIFRDLEELVKLYLGSN 347

>hg18||uc003ftt
        |3|NM_130830|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|NP_570843|leucine rich
        repeat containing 15

          Length = 581

 Score =  97 bits (239), Expect = 6e-020
 Identities = 77/261 (29%), Positives = 118/261 (45%), Gaps = 5/261 (1%)

Query:  33 AFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRR 92
           |||..     |    |||  | |  |  | | ||. |  | |  | .  .    |     
Sbjct:  96 AFRNL-----GSLRYLSLANNKLQVLPIGLFQGLDSLESLLLSSNQLLQIQPAHFSQCSN 150

Query:  93 LKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLK 152
           |||| |  | .  . .  |  .  |  |.|  | |  . |  || |  |  | .  | | 
Sbjct: 151 LKELQLHGNHLEYIPDGAFDHLVGLTKLNLGKNSLTHISPRVFQHLGNLQVLRLYENRLT 210

Query: 153 IVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYN 212
            .||  |    ||. | |  |..  ..   |     |  |.| .|  |..  | | .|  
Sbjct: 211 DIPMGTFDGLVNLQELALQQNQIGLLSPGLFHNNHNLQRLYLSNNHISQLPPSIFMQLPQ 270

Query: 213 LRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLT 272
           |  | |  | .. .| |.     ....| |  | .. .   |.  |  || | |  |...
Sbjct: 271 LNRLTLFGNSLKELSLGIFGPMPNLRELWLYDNHISSLPDNVFSNLRQLQVLILSRNQIS 330

Query: 273 NVSQEVVDAWISLTTISLAGN 293
            .|    .    |  .||  |
Sbjct: 331 FISPGAFNGLTELRELSLHTN 351

>hg18||uc003ftu
        |3|BC101065|Q8TF66|LRC15_HUMAN|LRRC15|NM_130830|NP_570843|leucine rich
        repeat containing 15

          Length = 581

 Score =  97 bits (239), Expect = 6e-020
 Identities = 77/261 (29%), Positives = 118/261 (45%), Gaps = 5/261 (1%)

Query:  33 AFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRR 92
           |||..     |    |||  | |  |  | | ||. |  | |  | .  .    |     
Sbjct:  96 AFRNL-----GSLRYLSLANNKLQVLPIGLFQGLDSLESLLLSSNQLLQIQPAHFSQCSN 150

Query:  93 LKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLK 152
           |||| |  | .  . .  |  .  |  |.|  | |  . |  || |  |  | .  | | 
Sbjct: 151 LKELQLHGNHLEYIPDGAFDHLVGLTKLNLGKNSLTHISPRVFQHLGNLQVLRLYENRLT 210

Query: 153 IVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYN 212
            .||  |    ||. | |  |..  ..   |     |  |.| .|  |..  | | .|  
Sbjct: 211 DIPMGTFDGLVNLQELALQQNQIGLLSPGLFHNNHNLQRLYLSNNHISQLPPSIFMQLPQ 270

Query: 213 LRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLT 272
           |  | |  | .. .| |.     ....| |  | .. .   |.  |  || | |  |...
Sbjct: 271 LNRLTLFGNSLKELSLGIFGPMPNLRELWLYDNHISSLPDNVFSNLRQLQVLILSRNQIS 330

Query: 273 NVSQEVVDAWISLTTISLAGN 293
            .|    .    |  .||  |
Sbjct: 331 FISPGAFNGLTELRELSLHTN 351

>hg18||uc002cwj
        |16|NM_138440|Q6EMK4|VASN_HUMAN|VASN|NM_138440|NP_612449|slit-like 2

          Length = 673

 Score =  95 bits (235), Expect = 2e-019
 Identities = 69/198 (34%), Positives = 103/198 (52%), Gaps = 5/198 (2%)

Query:  96 LILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVP 155
           | .  | || |   .|  .| |. |||| |.. .|  | || |  | .| . .| |  . 
Sbjct:  57 LYVFENGITMLDAGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEIT 116

Query: 156 MRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRA 215
              |.  | || | || ||.| |   ||  | .| || |. |.   .     |||     
Sbjct: 117 NETFRGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLL---L 173

Query: 216 LYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVS 275
           | |  | . ..  |.  | |... | |.|  | ..|  ..  | ||  |..  |.|  | 
Sbjct: 174 LDLSHNSLLALEPGILDT-ANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERV- 231

Query: 276 QEVVDAWISLTTISLAGN 293
             |.     || . ||||
Sbjct: 232 PPVIRGLRGLTRLRLAGN 249

>hg18||uc001hbe
        |1|NM_006338|O75325|LRRN5_HUMAN|LRRN2|NM_006338|NP_006329|leucine rich
        repeat neuronal 2

          Length = 713

 Score =  93 bits (229), Expect = 8e-019
 Identities = 64/234 (27%), Positives = 114/234 (48%), Gaps = 18/234 (7%)

Query:  48 LSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLH 107
           | | .| |  .    | ||..|. |.|. | . ..|   |. .  |. |..  ||. .. 
Sbjct: 146 LYLNHNQLYRIAPRAFSGLSNLLRLHLNSNLLRAIDSRWFEMLPNLEILMIGGNKVDAIL 205

Query: 108 NTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEF 167
           .  | |. |||.| |.   |. .     .||. | ||    | |  || |  .    |.|
Sbjct: 206 DMNFRPLANLRSLVLAGMNLREISDYALEGLQSLESLSFYDNQLARVPRRALEQVPGLKF 265

Query: 168 LDLGYNRLRSITRNAFSGLVKLTELHLEH-------NQFSKINFSHFPRL---YNLRALY 217
           |||  | |. .    |. .. | || | .       ..|. .|     .|    | |  .
Sbjct: 266 LDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVSIDKFALVNLPELTKLDITNNPRLSF 325

Query: 218 LQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKL 271
           .       . |        .. | |. | |. .     . ||||| . |  | .
Sbjct: 326 IHPRAFHHLPQ--------METLMLNNNALSALHQQTVESLPNLQEVGLHGNPI 371

>hg18||uc001hbf
        |1|NM_201630|O75325|LRRN5_HUMAN|LRRN2|NM_201630|NP_963924|leucine rich
        repeat neuronal 2

          Length = 713

 Score =  93 bits (229), Expect = 8e-019
 Identities = 64/234 (27%), Positives = 114/234 (48%), Gaps = 18/234 (7%)

Query:  48 LSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLH 107
           | | .| |  .    | ||..|. |.|. | . ..|   |. .  |. |..  ||. .. 
Sbjct: 146 LYLNHNQLYRIAPRAFSGLSNLLRLHLNSNLLRAIDSRWFEMLPNLEILMIGGNKVDAIL 205

Query: 108 NTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEF 167
           .  | |. |||.| |.   |. .     .||. | ||    | |  || |  .    |.|
Sbjct: 206 DMNFRPLANLRSLVLAGMNLREISDYALEGLQSLESLSFYDNQLARVPRRALEQVPGLKF 265

Query: 168 LDLGYNRLRSITRNAFSGLVKLTELHLEH-------NQFSKINFSHFPRL---YNLRALY 217
           |||  | |. .    |. .. | || | .       ..|. .|     .|    | |  .
Sbjct: 266 LDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVSIDKFALVNLPELTKLDITNNPRLSF 325

Query: 218 LQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKL 271
           .       . |        .. | |. | |. .     . ||||| . |  | .
Sbjct: 326 IHPRAFHHLPQ--------METLMLNNNALSALHQQTVESLPNLQEVGLHGNPI 371

>hg18||uc001hbg |1|AL833565|O75325|LRRN5_HUMAN|LRRN2|NM_201630|NP_963924|leucine
        rich repeat neuronal 2

          Length = 713

 Score =  93 bits (229), Expect = 8e-019
 Identities = 64/234 (27%), Positives = 114/234 (48%), Gaps = 18/234 (7%)

Query:  48 LSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLH 107
           | | .| |  .    | ||..|. |.|. | . ..|   |. .  |. |..  ||. .. 
Sbjct: 146 LYLNHNQLYRIAPRAFSGLSNLLRLHLNSNLLRAIDSRWFEMLPNLEILMIGGNKVDAIL 205

Query: 108 NTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEF 167
           .  | |. |||.| |.   |. .     .||. | ||    | |  || |  .    |.|
Sbjct: 206 DMNFRPLANLRSLVLAGMNLREISDYALEGLQSLESLSFYDNQLARVPRRALEQVPGLKF 265

Query: 168 LDLGYNRLRSITRNAFSGLVKLTELHLEH-------NQFSKINFSHFPRL---YNLRALY 217
           |||  | |. .    |. .. | || | .       ..|. .|     .|    | |  .
Sbjct: 266 LDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVSIDKFALVNLPELTKLDITNNPRLSF 325

Query: 218 LQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKL 271
           .       . |        .. | |. | |. .     . ||||| . |  | .
Sbjct: 326 IHPRAFHHLPQ--------METLMLNNNALSALHQQTVESLPNLQEVGLHGNPI 371

>hg18||uc003dmx
        |3|NM_015541|Q96JA1|LRIG1_HUMAN|LRIG1|NM_015541|NP_056356|leucine-rich
        repeats and immunoglobulin-like

          Length = 1093

 Score =  92 bits (228), Expect = 1e-018
 Identities = 72/252 (28%), Positives = 124/252 (49%), Gaps = 5/252 (1%)

Query:  46 EGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGV-RRLKELILSSNKIT 104
           | | |  |..  .|   |     .  | |  | | ...  || |. | |  | || |.||
Sbjct: 142 EVLDLSLNNITEVRNTCFPHGPPIKELNLAGNRIGTLELGAFDGLSRSLLTLRLSKNRIT 201

Query: 105 SLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRN 164
            |    |  .| |  |||. |... ..   ||||  |  | .. |..  .    |     
Sbjct: 202 QLPVRAF-KLPRLTQLDLNRNRIRLIEGLTFQGLNSLEVLKLQRNNISKLTDGAFWGLSK 260

Query: 165 LEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIR 224
           .  | | || |  .   .  ||  | .||| .|  ..|.   .     |  | | .| . 
Sbjct: 261 MHVLHLEYNSLVEVNSGSLYGLTALHQLHLSNNSIARIHRKGWSFCQKLHELVLSFNNLT 320

Query: 225 SMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWI- 283
            . .      .|.  | || | .. |    .. | .|. |.|| |...   ..   |.  
Sbjct: 321 RLDEESLAELSSLSVLRLSHNSISHIAEGAFKGLRSLRVLDLDHNEISGTIEDTSGAFSG 380

Query: 284 --SLTTISLAGN 293
             ||. ..| ||
Sbjct: 381 LDSLSKLTLFGN 392

>hg18||uc003vfs
        |7|NM_018334|Q9H3W5|LRRN3_HUMAN|LRRN3|NM_018334|NP_060804|leucine rich
        repeat neuronal 3

          Length = 708

 Score =  91 bits (225), Expect = 2e-018
 Identities = 69/250 (27%), Positives = 122/250 (48%), Gaps = 5/250 (2%)

Query:  27 VYCESSAFRDVP-KNLS--GGCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVD 83
           || | .   ..| | ||     . | . .| | ..  | |.||..|. |.|. | .  ..
Sbjct: 121 VYLEENKLTELPEKCLSELSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMIN 180

Query:  84 GMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLS 143
              |  .  |. |..  | |  . .  | |. |||.| ..   |  .      ||  | |
Sbjct: 181 SKWFDALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIAGINLTEIPDNALVGLENLES 240

Query: 144 LHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLEH-NQFSKI 202
           .    | |  ||    |   ||.||||  | .  | |  || .. | || . .  .   |
Sbjct: 241 ISFYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISI 300

Query: 203 NFSHFPRLYNLRALYLQWN-RIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNL 261
           .      | .|| .    | |.  .     .    .. | |. | |. .     . ||||
Sbjct: 301 DSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNL 360

Query: 262 QTLNLDSNKL 271
           . ... || .
Sbjct: 361 KEISIHSNPI 370

>hg18||uc003vft |7|AK001991|Q9H3W5|LRRN3_HUMAN|LRRN3|NM_018334|NP_060804|leucine
        rich repeat neuronal 3

          Length = 708

 Score =  91 bits (225), Expect = 2e-018
 Identities = 69/250 (27%), Positives = 122/250 (48%), Gaps = 5/250 (2%)

Query:  27 VYCESSAFRDVP-KNLS--GGCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVD 83
           || | .   ..| | ||     . | . .| | ..  | |.||..|. |.|. | .  ..
Sbjct: 121 VYLEENKLTELPEKCLSELSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMIN 180

Query:  84 GMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLS 143
              |  .  |. |..  | |  . .  | |. |||.| ..   |  .      ||  | |
Sbjct: 181 SKWFDALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIAGINLTEIPDNALVGLENLES 240

Query: 144 LHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLEH-NQFSKI 202
           .    | |  ||    |   ||.||||  | .  | |  || .. | || . .  .   |
Sbjct: 241 ISFYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISI 300

Query: 203 NFSHFPRLYNLRALYLQWN-RIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNL 261
           .      | .|| .    | |.  .     .    .. | |. | |. .     . ||||
Sbjct: 301 DSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNL 360

Query: 262 QTLNLDSNKL 271
           . ... || .
Sbjct: 361 KEISIHSNPI 370

>hg18||uc003vfu |7|AY358280|Q9H3W5|LRRN3_HUMAN|LRRN3|NM_018334|NP_060804|leucine
        rich repeat neuronal 3

          Length = 708

 Score =  91 bits (225), Expect = 2e-018
 Identities = 69/250 (27%), Positives = 122/250 (48%), Gaps = 5/250 (2%)

Query:  27 VYCESSAFRDVP-KNLS--GGCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVD 83
           || | .   ..| | ||     . | . .| | ..  | |.||..|. |.|. | .  ..
Sbjct: 121 VYLEENKLTELPEKCLSELSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMIN 180

Query:  84 GMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLS 143
              |  .  |. |..  | |  . .  | |. |||.| ..   |  .      ||  | |
Sbjct: 181 SKWFDALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIAGINLTEIPDNALVGLENLES 240

Query: 144 LHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLEH-NQFSKI 202
           .    | |  ||    |   ||.||||  | .  | |  || .. | || . .  .   |
Sbjct: 241 ISFYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISI 300

Query: 203 NFSHFPRLYNLRALYLQWN-RIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNL 261
           .      | .|| .    | |.  .     .    .. | |. | |. .     . ||||
Sbjct: 301 DSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNL 360

Query: 262 QTLNLDSNKL 271
           . ... || .
Sbjct: 361 KEISIHSNPI 370

>hg18||uc001edf
        |1|NM_014813|O94898|LRIG2_HUMAN|LRIG2|NM_014813|NP_055628|leucine-rich
        repeats and immunoglobulin-like

          Length = 1065

 Score =  91 bits (224), Expect = 3e-018
 Identities = 66/252 (26%), Positives = 131/252 (51%), Gaps = 6/252 (2%)

Query:  46 EGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGV-RRLKELILSSNKIT 104
           | | |  | .  ..   |  .  | .| | .| ||...   |  .   |  . |. |...
Sbjct: 147 ESLDLSSNIISEIKTSSFPRM-QLKYLNLSNNRITTLEAGCFDNLSSSLLVVKLNRNRMS 205

Query: 105 SLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRN 164
            .    |  .|.|. |.|  |... ..   ||||  | || .. | .  .    |    |
Sbjct: 206 MIPPKIF-KLPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNN 264

Query: 165 LEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIR 224
           .| |.| .| |  . .    ||  | .|..  |   .|.   .     |  | | .|.. 
Sbjct: 265 MEELELEHNNLTRVNKGWLYGLRMLQQLYVSQNAIERISPDAWEFCQRLSELDLSYNQLT 324

Query: 225 SMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVSQEVVDAWIS 284
            . .      . ...|.|  | .| |   |.. | |||||.| .|...   ..  .|.  
Sbjct: 325 RLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNEISWAIEDASEAFAG 384

Query: 285 LTTIS---LAGN 293
           ||...   | ||
Sbjct: 385 LTSLTKLILQGN 396

>hg18||uc001mrk
        |11|DQ895687|Q8N537|Q8N537_HUMAN|LGR4|NM_018490|NP_060960|leucine-rich
        repeat-containing G protein-coupled

          Length = 927

 Score =  91 bits (223), Expect = 4e-018
 Identities = 72/258 (27%), Positives = 121/258 (46%), Gaps = 4/258 (1%)

Query:  38 PKNLSG--GCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKE 95
           || |||    . |.|. | | .. .    ||. |  | || |.||||   .|.|. .|. 
Sbjct:  74 PKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRH 133

Query:  96 LILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVP 155
           | |  | .| .       .| |. | |. ||. ..    |  |  |. ||. .| .. . 
Sbjct: 134 LWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLS 193

Query: 156 MRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRA 215
              |    ||| ||| || |    . |   |  | ||    |  | |    |     || 
Sbjct: 194 QHCFDGLDNLETLDLNYNNLGEFPQ-AIKALPSLKELGFHSNSISVIPDGAFDGNPLLRT 252

Query: 216 LYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVS 275
           ..|  | .  .        . .  | . |  . .    .   . .|..| |   |.... 
Sbjct: 253 IHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTV-HLESLTLTGTKISSIP 311

Query: 276 QEVVDAWISLTTISLAGN 293
             .      | |. |. |
Sbjct: 312 NNLCQEQKMLRTLDLSYN 329

>hg18||uc003ipz
        |4|NM_021634|Q2M215|Q2M215_HUMAN|RXFP1|NM_021634|NP_067647|leucine-rich
        repeat-containing G protein-coupled

          Length = 757

 Score =  91 bits (223), Expect = 4e-018
 Identities = 67/196 (34%), Positives = 95/196 (48%), Gaps = 6/196 (3%)

Query:  25 KIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSV-D 83
           .| . .   | |. .      | | .  | |  .    | ||| || | | .| .| . |
Sbjct: 185 RITFLKPGVFEDLHR-----LEWLIIEDNHLSRISPPTFYGLNSLILLVLMNNVLTRLPD 239

Query:  84 GMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLS 143
               | . ||  | |  | | .| | ||    ||  | .  ||.  |    |  |.||  
Sbjct: 240 KPLCQHMPRLHWLDLEGNHIHNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDE 299

Query: 144 LHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKIN 203
           | . || .. .|  .|.| . |  |.| || .. |  | |  ||||  | ||  . | | 
Sbjct: 300 LDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQ 359

Query: 204 FSHFPRLYNLRALYLQ 219
              |  | ||  .| .
Sbjct: 360 QRMFRPLMNLSHIYFK 375

>hg18||uc002ftp
        |17|NM_178568|Q86UN2|R4RL1_HUMAN|RTN4RL1|NM_178568|NP_848663|reticulon
        4 receptor-like 1

          Length = 441

 Score =  90 bits (222), Expect = 5e-018
 Identities = 87/320 (27%), Positives = 134/320 (41%), Gaps = 13/320 (4%)

Query:  76 HNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQF 135
           ||.    .|.     |    . | .|.|  |    | |   .  | .  | .  . |  |
Sbjct:  43 HNFAAIPEGIPVDSER----VFLQNNRIGLLQPGHFSPA--MVTLWIYSNNITYIHPSTF 96

Query: 136 QGLRKLLSLHIRSN-SLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHL 194
           .|   |  | .  |  |. .    ||    |  | |    | ..    | ||  |  |.|
Sbjct:  97 EGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGVFGGLHSLQYLYL 156

Query: 195 EHNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAV 254
           . |    .    |  | ||  |.|  |.. |.  |      .. .| |  | |  .    
Sbjct: 157 QDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGPGTFRGLVNLDRLLLHENQLQWVHHKA 216

Query: 255 YQCLPNLQTLNLDSNKLTNVSQEVVDAWISLTTISLAGNVWDCGPAICPLVAWLRNFRGP 314
           .  |  | || | .| |. .  | .    .|  . | || ||||     |  ||. ||| 
Sbjct: 217 FHDLRRLTTLFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRG- 275

Query: 315 KETTMICASPKKAQGE--KVMDAVDAFGVCQTDSAATLTVNITPTQSRLPAQTEQHPIIL 372
             . . | ||    |.  |.. | | |  |   ..     . | | .   |. | |    
Sbjct: 276 SSSAVPCVSPGLRHGQDLKLLRAED-FRNCTGPASPHQIKSHTLTTTDRAARKEHHS--P 332

Query: 373 TSPTRTRKGGEGSVQGPTSP 392
             |||..    |   |   |
Sbjct: 333 HGPTRSKGHPHGPRPGHRKP 352

>hg18||uc003ftv
        |3|NM_004488|P40197|GPV_HUMAN|GP5|NM_004488|NP_004479|glycoprotein V
        (platelet)

          Length = 560

 Score =  90 bits (222), Expect = 5e-018
 Identities = 75/266 (28%), Positives = 114/266 (42%), Gaps = 10/266 (3%)

Query:  15 PCPKSCRCDGK-IVYCESS-----AFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNH 68
           ||| .|.|  .    |        .   .| ||.     . |       |..  | |.  
Sbjct:  20 PCPPACKCVFRDAAQCSGGDVARISALGLPTNLT----HILLFGMGRGVLQSQSFSGMTV 75

Query:  69 LIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQ 128
           |  | .  ..|..|    |  . .|| | || |||| |       .  |  | | .| |.
Sbjct:  76 LQRLMISDSHISAVAPGTFSDLIKLKTLRLSRNKITHLPGALLDKMVLLEQLFLDHNALR 135

Query: 129 ALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVK 188
            .    || |  |  | .  | |  .|  || .  ||. |||  | |  . .       |
Sbjct: 136 GIDQNMFQKLVNLQELALNQNQLDFLPASLFTNLENLKLLDLSGNNLTHLPKGLLGAQAK 195

Query: 189 LTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLT 248
           |  | |  |.   ..      |  |  |    | |||.. |      ..  | || | | 
Sbjct: 196 LERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDRLPNLSSLTLSRNHLA 255

Query: 249 EIDAAVYQCLPNLQTLNLDSNKLTNV 274
            . .|..    ||  | |  | |  .
Sbjct: 256 FLPSALFLHSHNLTLLTLFENPLAEL 281

>hg18||uc001edf
        |1|NM_014813|O94898|LRIG2_HUMAN|LRIG2|NM_014813|NP_055628|leucine-rich
        repeats and immunoglobulin-like

          Length = 1065

 Score =  89 bits (220), Expect = 9e-018
 Identities = 62/184 (33%), Positives = 92/184 (50%), Gaps = 3/184 (1%)

Query:  48 LSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLH 107
           | .. | .  |. | | |||..  | |.|| .| |.     |.| |..| .| | |  . 
Sbjct: 244 LKMQRNGISKLKDGAFFGLNNMEELELEHNNLTRVNKGWLYGLRMLQQLYVSQNAIERIS 303

Query: 108 NTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEF 167
              .     |  ||||||.|  |    | ||  |  |..  | .  .   .|.   ||. 
Sbjct: 304 PDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQT 363

Query: 168 LDLGYNRLR---SITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIR 224
           |||  | .         ||.||  ||.| |. ||   |    |  | .|  | |  | | 
Sbjct: 364 LDLRNNEISWAIEDASEAFAGLTSLTKLILQGNQIKSITKKAFIGLESLEHLDLNNNAIM 423

Query: 225 SMSQ 228
           |. .
Sbjct: 424 SIQE 427

>hg18||uc001mrj
        |11|NM_018490|Q59ER8|Q59ER8_HUMAN|LGR4|NM_018490|NP_060960|leucine-rich
        repeat-containing G protein-coupled

          Length = 951

 Score =  89 bits (218), Expect = 2e-017
 Identities = 71/258 (27%), Positives = 121/258 (46%), Gaps = 4/258 (1%)

Query:  38 PKNLSG--GCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKE 95
           || |||    . |.|. | | .. .    ||. |  | || |.||||   .|.|. .|. 
Sbjct:  98 PKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRH 157

Query:  96 LILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVP 155
           | |  | .| .       .| |. | |. ||. ..    |  |  |. ||. .| .. . 
Sbjct: 158 LWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRGLS 217

Query: 156 MRLFQDCRNLEFLDLGYNRLRSITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRA 215
              |    ||| ||| || |    . |      | ||    |  | |    |     || 
Sbjct: 218 QHCFDGLDNLETLDLSYNNLGEFPQ-AIKARPSLKELGFHSNSISVIPDGAFDGNPLLRT 276

Query: 216 LYLQWNRIRSMSQGLTWTWASIQKLDLSGNDLTEIDAAVYQCLPNLQTLNLDSNKLTNVS 275
           ..|  | .  .    .   . .  | . |  . .    .   . .|..| |   |.... 
Sbjct: 277 IHLYDNPLSFVGNSASHNLSDLHSLVIRGASMVQQFPNLTGTV-HLESLTLTGTKISSIP 335

Query: 276 QEVVDAWISLTTISLAGN 293
             .      | |. |. |
Sbjct: 336 NNLCQEQKMLRTLDLSYN 353

>hg18||uc001qjt
        |12|NM_001039029|Q8N967|LRTM2_HUMAN|LRTM2|NM_001039029|NP_001034118|leu
        cine-rich repeats and transmembrane domains

          Length = 370

 Score =  89 bits (218), Expect = 2e-017
 Identities = 59/172 (34%), Positives = 82/172 (47%), Gaps = 2/172 (1%)

Query:   4 WLAANPSLSERPCPKSCRCDGKI--VYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAG 61
           |.|     .   || ||.|| .   | |       || ..      | |  | | .| . 
Sbjct:  27 WIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLTTVPPDVPAATRTLLLLNNKLSALPSW 86

Query:  62 QFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLD 121
            |  |. |  | | .|..  .    |  .  | || | .| | .|        | ||.||
Sbjct:  87 AFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTELQLRNNSIRTLDRDLLRHSPLLRHLD 146

Query: 122 LSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYN 173
           || | |  | || | ||  | || .||| |. .    |.   ||. | .| |
Sbjct: 147 LSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDN 198

>hg18||uc001qju
        |12|AK124687|Q8N967|LRTM2_HUMAN|LRTM2|NM_001039029|NP_001034118|leucine
        -rich repeats and transmembrane domains

          Length = 370

 Score =  89 bits (218), Expect = 2e-017
 Identities = 59/172 (34%), Positives = 82/172 (47%), Gaps = 2/172 (1%)

Query:   4 WLAANPSLSERPCPKSCRCDGKI--VYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAG 61
           |.|     .   || ||.|| .   | |       || ..      | |  | | .| . 
Sbjct:  27 WIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLTTVPPDVPAATRTLLLLNNKLSALPSW 86

Query:  62 QFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLD 121
            |  |. |  | | .|..  .    |  .  | || | .| | .|        | ||.||
Sbjct:  87 AFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTELQLRNNSIRTLDRDLLRHSPLLRHLD 146

Query: 122 LSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYN 173
           || | |  | || | ||  | || .||| |. .    |.   ||. | .| |
Sbjct: 147 LSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDN 198

>hg18||uc003mab |5|NM_003062|O75094|SLIT3_HUMAN|SLIT3|NM_003062|NP_003053|slit
        homolog 3

          Length = 1523

 Score =  89 bits (218), Expect = 2e-017
 Identities = 50/158 (31%), Positives = 78/158 (49%)

Query:  16 CPKSCRCDGKIVYCESSAFRDVPKNLSGGCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLD 75
           ||  | |   || |      ..| ||  |   . |  ||. .. || |     |  . . 
Sbjct: 280 CPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDIS 339

Query:  76 HNYITSVDGMAFQGVRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQF 135
            | |. .   ||||.. |  |.|  |||| .    |  . .|. | |. ||.  |.   |
Sbjct: 340 KNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTF 399

Query: 136 QGLRKLLSLHIRSNSLKIVPMRLFQDCRNLEFLDLGYN 173
           | |. |  | .  | |. .   ||   .... | |  |
Sbjct: 400 QDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQN 437

>hg18||uc001sqr
        |12|NM_153377|Q6UXM1|LRIG3_HUMAN|LRIG3|NM_153377|NP_700356|leucine-rich
        repeats and immunoglobulin-like

          Length = 1119

 Score =  88 bits (217), Expect = 2e-017
 Identities = 66/208 (31%), Positives = 96/208 (46%), Gaps = 3/208 (1%)

Query:  43 GGCEGLSLRYNSLVSLRAGQFVGLNHLIWLYLDHNYITSVDGMAFQGVRRLKELILSSNK 102
           |  . | .. | .  |  | | ||...  | |||| .| .      |.  |.|| || | 
Sbjct: 239 GALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNA 298

Query: 103 ITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLLSLHIRSNSLKIVPMRLFQDC 162
           |  .    .     |  |||..| |  |    | ||  | .||| .| .  .    |.  
Sbjct: 299 INRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGL 358

Query: 163 RNLEFLDLGYNRLR---SITRNAFSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQ 219
            .|. |||  | .         ||||| ||  | |. |.   |    |  |  |  | | 
Sbjct: 359 SSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLS 418

Query: 220 WNRIRSMSQGLTWTWASIQKLDLSGNDL 247
            | | |.          .|.| |. . |
Sbjct: 419 DNAIMSLQGNAFSQMKKLQQLHLNTSSL 446

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0