BLASTP 7.6.0


Query=fugu4_571220 |jgi|Takru4|571220|e_gw2.243.41.1
        (399 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003dzf |3|NM_199512|Q76M96|Q76M96_HUMAN|CCDC80|NM_199512...    108   2e-023
hg18||uc003dzg |3|NM_199511|Q76M96|Q76M96_HUMAN|CCDC80|NM_199511...    108   2e-023
hg18||uc003dzh |3|AY726593|Q76M96|Q76M96_HUMAN|CCDC80|NM_199512|...    108   2e-023
hg18||uc003dzf |3|NM_199512|Q76M96|Q76M96_HUMAN|CCDC80|NM_199512...     39   0.014
hg18||uc003dzg |3|NM_199511|Q76M96|Q76M96_HUMAN|CCDC80|NM_199511...     39   0.014
hg18||uc003dzh |3|AY726593|Q76M96|Q76M96_HUMAN|CCDC80|NM_199512|...     39   0.014
hg18||uc001ujy |12|NM_175066|Q8N8A6|DDX51_HUMAN|DDX51|NM_175066|...     29   8.252

>hg18||uc003dzf
        |3|NM_199512|Q76M96|Q76M96_HUMAN|CCDC80|NM_199512|NP_955806|steroid-sen
        sitive protein 1

          Length = 950

 Score =  108 bits (268), Expect = 2e-023
 Identities = 59/147 (40%), Positives = 93/147 (63%), Gaps = 7/147 (4%)

Query:  71 DFLAEFAGKRRLWVITAPSHNSPYLRMMEKQLEELDQRALNCRLAERDTFIITVIQNAMM 130
           . || |||| |.|||.||  .  | |.|   |..     . | ||||    | .   |  
Sbjct: 140 NILASFAGKNRVWVISAPHASEGYYRLMMSLLKD----DVYCELAERHIQQIVLFHQAGE 195

Query: 131 E-GRIQKTTPAGEATVESLDPDMVTKLLHYLDLSGSERDFTMLVVKKNLRTSERFPYPVR 189
           | |.... |  |.   . ||| .. ||. .| |   .  | |...|| |.  ||.|||||
Sbjct: 196 EGGKVRRITSEGQILEQPLDPSLIPKLMSFLKLEKGK--FGMVLLKKTLQVEERYPYPVR 253

Query: 190 VEAVLELIDQFPMRKLEKMTRKGKHQR 216
           .||. |.||| |.|..||. .||  |.
Sbjct: 254 LEAMYEVIDQGPIRRIEKIRQKGFVQK 280

>hg18||uc003dzg
        |3|NM_199511|Q76M96|Q76M96_HUMAN|CCDC80|NM_199511|NP_955805|steroid-sen
        sitive protein 1

          Length = 950

 Score =  108 bits (268), Expect = 2e-023
 Identities = 59/147 (40%), Positives = 93/147 (63%), Gaps = 7/147 (4%)

Query:  71 DFLAEFAGKRRLWVITAPSHNSPYLRMMEKQLEELDQRALNCRLAERDTFIITVIQNAMM 130
           . || |||| |.|||.||  .  | |.|   |..     . | ||||    | .   |  
Sbjct: 140 NILASFAGKNRVWVISAPHASEGYYRLMMSLLKD----DVYCELAERHIQQIVLFHQAGE 195

Query: 131 E-GRIQKTTPAGEATVESLDPDMVTKLLHYLDLSGSERDFTMLVVKKNLRTSERFPYPVR 189
           | |.... |  |.   . ||| .. ||. .| |   .  | |...|| |.  ||.|||||
Sbjct: 196 EGGKVRRITSEGQILEQPLDPSLIPKLMSFLKLEKGK--FGMVLLKKTLQVEERYPYPVR 253

Query: 190 VEAVLELIDQFPMRKLEKMTRKGKHQR 216
           .||. |.||| |.|..||. .||  |.
Sbjct: 254 LEAMYEVIDQGPIRRIEKIRQKGFVQK 280

>hg18||uc003dzh
        |3|AY726593|Q76M96|Q76M96_HUMAN|CCDC80|NM_199512|NP_955806|steroid-sens
        itive protein 1

          Length = 838

 Score =  108 bits (268), Expect = 2e-023
 Identities = 59/147 (40%), Positives = 93/147 (63%), Gaps = 7/147 (4%)

Query:  71 DFLAEFAGKRRLWVITAPSHNSPYLRMMEKQLEELDQRALNCRLAERDTFIITVIQNAMM 130
           . || |||| |.|||.||  .  | |.|   |..     . | ||||    | .   |  
Sbjct: 140 NILASFAGKNRVWVISAPHASEGYYRLMMSLLKD----DVYCELAERHIQQIVLFHQAGE 195

Query: 131 E-GRIQKTTPAGEATVESLDPDMVTKLLHYLDLSGSERDFTMLVVKKNLRTSERFPYPVR 189
           | |.... |  |.   . ||| .. ||. .| |   .  | |...|| |.  ||.|||||
Sbjct: 196 EGGKVRRITSEGQILEQPLDPSLIPKLMSFLKLEKGK--FGMVLLKKTLQVEERYPYPVR 253

Query: 190 VEAVLELIDQFPMRKLEKMTRKGKHQR 216
           .||. |.||| |.|..||. .||  |.
Sbjct: 254 LEAMYEVIDQGPIRRIEKIRQKGFVQK 280

>hg18||uc003dzf
        |3|NM_199512|Q76M96|Q76M96_HUMAN|CCDC80|NM_199512|NP_955806|steroid-sen
        sitive protein 1

          Length = 950

 Score =  39 bits (88), Expect = 0.014
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 10/65 (15%)

Query:  71 DFLAEFAGKRRLWVITAP-SHNSPYLRMMEKQLEELDQRALNCRLAERDTFIITV---IQ 126
           | |  | ||||| .|||| . |. |..  .. ||        |..| |   .||.   . 
Sbjct: 614 DLLGSFEGKRRLLLITAPKAENNMYVQQRDEYLESF------CKMATRKISVITIFGPVN 667

Query: 127 NAMME 131
           |. |.
Sbjct: 668 NSTMK 672

>hg18||uc003dzg
        |3|NM_199511|Q76M96|Q76M96_HUMAN|CCDC80|NM_199511|NP_955805|steroid-sen
        sitive protein 1

          Length = 950

 Score =  39 bits (88), Expect = 0.014
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 10/65 (15%)

Query:  71 DFLAEFAGKRRLWVITAP-SHNSPYLRMMEKQLEELDQRALNCRLAERDTFIITV---IQ 126
           | |  | ||||| .|||| . |. |..  .. ||        |..| |   .||.   . 
Sbjct: 614 DLLGSFEGKRRLLLITAPKAENNMYVQQRDEYLESF------CKMATRKISVITIFGPVN 667

Query: 127 NAMME 131
           |. |.
Sbjct: 668 NSTMK 672

>hg18||uc003dzh
        |3|AY726593|Q76M96|Q76M96_HUMAN|CCDC80|NM_199512|NP_955806|steroid-sens
        itive protein 1

          Length = 838

 Score =  39 bits (88), Expect = 0.014
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 10/65 (15%)

Query:  71 DFLAEFAGKRRLWVITAP-SHNSPYLRMMEKQLEELDQRALNCRLAERDTFIITV---IQ 126
           | |  | ||||| .|||| . |. |..  .. ||        |..| |   .||.   . 
Sbjct: 614 DLLGSFEGKRRLLLITAPKAENNMYVQQRDEYLESF------CKMATRKISVITIFGPVN 667

Query: 127 NAMME 131
           |. |.
Sbjct: 668 NSTMK 672

>hg18||uc001ujy |12|NM_175066|Q8N8A6|DDX51_HUMAN|DDX51|NM_175066|NP_778236|DEAD
        (Asp-Glu-Ala-Asp) box polypeptide 51

          Length = 666

 Score =  29 bits (64), Expect = 8.252
 Identities = 25/80 (31%), Positives = 32/80 (40%), Gaps = 5/80 (6%)

Query: 235 TMKRRVVPSPRRTGNTTSAGPQTQPAPDKKAALKRRIQDILNGRSRFVIRKVPAAGSSRS 294
           | .||    |||      | | .  ||  |   ..   .     |       |.||||  
Sbjct:  64 TRRRR---RPRRRRRVNDAEPGSPEAPQGKR--RKADGEDAGAESNEEAPGEPSAGSSEE 118

Query: 295 GGRTPSAGQGGAAPSPPSTT 314
               ||||    ||   ||.
Sbjct: 119 AQGGPSAGSSEEAPGVRSTS 138

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0