BLASTP 7.6.0


Query=fugu4_571213 |jgi|Takru4|571213|e_gw2.243.51.1
        (154 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc004ded |X|NM_001034853|Q3KN84|Q3KN84_HUMAN|RPGR|NM_00103...     28   4.968
hg18||uc004ded |X|NM_001034853|Q3KN84|Q3KN84_HUMAN|RPGR|NM_00103...     27   8.474

>hg18||uc004ded
        |X|NM_001034853|Q3KN84|Q3KN84_HUMAN|RPGR|NM_001034853|NP_001030025|reti
        nitis pigmentosa GTPase regulator isoform C

          Length = 1152

 Score =  28 bits (60), Expect = 4.968
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query:  41 ELQKIDQMEFEAAQRNEAAHKNVTEEQKDDSGHHHGEGEK 80
           | .| |  | |  .| .   |   .| ..     |||||.
Sbjct: 701 EWKKRDGEEQEQKEREQGHQKERNQEMEEGGEEEHGEGEE 740

>hg18||uc004ded
        |X|NM_001034853|Q3KN84|Q3KN84_HUMAN|RPGR|NM_001034853|NP_001030025|reti
        nitis pigmentosa GTPase regulator isoform C

          Length = 1152

 Score =  27 bits (58), Expect = 8.474
 Identities = 20/83 (24%), Positives = 34/83 (40%), Gaps = 6/83 (7%)

Query:  28 EEDGVAAQHDGLTELQKIDQMEFEAAQRNEAAHKNVTEEQKDDSGHHHGEGEKNCCVLEM 87
           ||.|   . .|  . .. .  | |  .  |       ||. .  |   ||||      | 
Sbjct: 844 EEEGEGEEEEGEGKGEE-EGEEGEGEEEGEEGEGEGEEEEGEGEGEEEGEGEG-----EE 897

Query:  88 TDQGGDLSEQRSGTSHAPEGNSR 110
            .  |.  |.  |     ||  .
Sbjct: 898 EEGEGEGEEEGEGEGEEEEGEGK 920

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0