BLASTP 7.6.0


Query=fugu4_571098 |jgi|Takru4|571098|e_gw2.133.61.1
        (784 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003ypp |8|NM_145647|Q2M2J9|Q2M2J9_HUMAN|WDR67|NM_145647|...    532   9e-151
hg18||uc003yps |8|AK025686|NA|NA|WDR67|NM_145647|NP_663622|WD re...    421   3e-117
hg18||uc003ypo |8|BC105800|Q3KRB0|Q3KRB0_HUMAN|WDR67|NM_145647|N...    255   3e-067
hg18||uc003ypp |8|NM_145647|Q2M2J9|Q2M2J9_HUMAN|WDR67|NM_145647|...    255   3e-067
hg18||uc003ypt |8|CR594827|NA|NA|WDR67|NM_145647|NP_663622|WD re...    228   4e-059
hg18||uc003ypu |8|BC027237|NA|NA|WDR67|NM_145647|NP_663622|WD re...    228   4e-059
hg18||uc003ypo |8|BC105800|Q3KRB0|Q3KRB0_HUMAN|WDR67|NM_145647|N...    144   7e-034
hg18||uc003ypp |8|NM_145647|Q2M2J9|Q2M2J9_HUMAN|WDR67|NM_145647|...    144   7e-034
hg18||uc003ypo |8|BC105800|Q3KRB0|Q3KRB0_HUMAN|WDR67|NM_145647|N...     93   1e-018
hg18||uc002veq |2|NM_024532|Q8N0X2|SPG16_HUMAN|SPAG16|NM_024532|...     51   6e-006
hg18||uc002ver |2|BC025379|Q4G1A2|Q4G1A2_HUMAN|SPAG16|NA|NA|SPAG...     51   6e-006
hg18||uc001cix |1|NM_001255|Q12834|CDC20_HUMAN|CDC20|NM_001255|N...     43   0.002
hg18||uc001ciy |1|BC000624|Q12834|CDC20_HUMAN|CDC20|NM_001255|NP...     43   0.002
hg18||uc002vpn |2|NM_178821|Q8N136|WDR69_HUMAN|WDR69|NM_178821|N...     43   0.002
hg18||uc002asm |15|NM_005078|Q04726|TLE3_HUMAN|TLE3|NM_005078|NP...     39   0.024
hg18||uc002cow |16|NM_032271|Q6Q0C0|TRAF7_HUMAN|TRAF7|NM_032271|...     39   0.031
hg18||uc002ask |15|AK096779|Q04726-3|Q04726-3|TLE3|NM_005078|NP_...     38   0.040
hg18||uc002asl |15|BC041831|Q04726-4|Q04726-4|TLE3|NM_005078|NP_...     38   0.040
hg18||uc002asn |15|AB046767|Q04726-2|Q04726-2|TLE3|NM_005078|NP_...     38   0.040
hg18||uc002aso |15|AY583460|Q6PI57|Q6PI57_HUMAN|TLE3|NM_005078|N...     38   0.040
hg18||uc002asp |15|AY583459|Q04726-3|Q04726-3|TLE3|NM_005078|NP_...     38   0.040
hg18||uc001bso |1|NM_004814|Q96DI7|WDR57_HUMAN|WDR57|NM_004814|N...     35   0.260
hg18||uc001ehj |1|NM_006784|Q9UNX4|WDR3_HUMAN|WDR3|NM_006784|NP_...     35   0.444

>hg18||uc003ypp |8|NM_145647|Q2M2J9|Q2M2J9_HUMAN|WDR67|NM_145647|NP_663622|WD
        repeat domain 67

          Length = 1066

 Score =  532 bits (1369), Expect = 9e-151
 Identities = 256/425 (60%), Positives = 324/425 (76%), Gaps = 4/425 (0%)

Query: 346 QTLGVLSQDGVMQFINIQTCKLLFHMGSRRNPINTVAIGPNGRHMAAIMDNGSINVYNIQ 405
           | ||||||||.|.|||.||||||| .||    |.. || |.||..|.||.|||.|.|..|
Sbjct: 277 QVLGVLSQDGIMRFINMQTCKLLFEIGSLDEGISSSAISPHGRYIASIMENGSLNIYSVQ 336

Query: 406 SLTQGIHKPPSSQVAVISGGDDDQ-ELPKLKVRDRPDVLLKSAKRSGRQSQAKI---SPG 461
           .||| |.|||   | ||    ...     ||..     . . ||    . | .|      
Sbjct: 337 ALTQEINKPPPPLVKVIEDLPNNKLSSSDLKMKVTSGRVQQPAKSRESKMQTRILKQDLT 396

Query: 462 FSLDDKENEQAACLNKKRMVALLKEFGEYPAKYRMFVWRSLLLLPENYTAYSCLTDKGPH 521
              . |.||    |||||.  ||| .|||| |||||.||||| ||||.||.| | ||| |
Sbjct: 397 GDFESKKNELPDGLNKKRLQILLKGYGEYPTKYRMFIWRSLLQLPENHTAFSTLIDKGTH 456

Query: 522 SAFLTLHNKYPIKSHRLQRCLQRVLSALAHWAAIFGEVEYLPLIAFPFVKLFQNNPLLCF 581
            ||| |  |||||| .| | ||| |||||||. || .  ||||.||||||||||| |.||
Sbjct: 457 VAFLNLQKKYPIKSRKLLRVLQRTLSALAHWSVIFSDTPYLPLLAFPFVKLFQNNQLICF 516

Query: 582 EVLATFIVNWCQHWFEYFPNPPLNILCMVENVLAHHDKELLQHLVGCGITSQLYVWPLLE 641
           ||.|| |.||||||||||||||.||| |.||||| |||||||| .   |||||| |||||
Sbjct: 517 EVIATLIINWCQHWFEYFPNPPINILSMIENVLAFHDKELLQHFIDHDITSQLYAWPLLE 576

Query: 642 TLFSEVLTRDEWLRLFDSVFSNHPSFLLMACVAYITCCRGPLLHCTQKHDFEYFFHHRNT 701
           |.|||||||.|||.|||..||||||||||  |||  | | ||| |  | |||.|||||| 
Sbjct: 577 TVFSEVLTREEWLKLFDNIFSNHPSFLLMTVVAYNICSRTPLLSCNLKDDFEFFFHHRNN 636

Query: 702 LNMGMMIKEAYRIMDSTPSDIHPRNMLSDFTPLPKGHYPVFNHYPEFIVEYQNREREKIR 761
           |.. ..|.. | .|..||.|||| .||. |  | || ||||| ||.|||.|| .|||.||
Sbjct: 637 LDINVVIRQVYHLMETTPTDIHPDSMLNVFVALTKGQYPVFNQYPKFIVDYQTQERERIR 696

Query: 762 LEEME 766
            .|..
Sbjct: 697 NDELD 701

>hg18||uc003yps |8|AK025686|NA|NA|WDR67|NM_145647|NP_663622|WD repeat domain 67

          Length = 700

 Score =  421 bits (1080), Expect = 3e-117
 Identities = 210/347 (60%), Positives = 256/347 (73%), Gaps = 16/347 (4%)

Query: 357 MQFINIQTCKLLFHMGSRRNPINTVAIGPNGRHMAAIMDNGSINVYNIQSLTQGIHKPPS 416
           |.|||.||||||| .||    |.. || |.||..|.||.|||.|.|..|.||| |.||| 
Sbjct:   1 MRFINMQTCKLLFEIGSLDEGISSSAISPHGRYIASIMENGSLNIYSVQALTQEINKPPP 60

Query: 417 SQVAVISGGDDDQELPK-------LKVRDRPDVLLKSAKRSGRQSQAKI---SPGFSLDD 466
             | ||      ..|||       ||..     . . ||    . | .|         . 
Sbjct:  61 PLVKVI------EDLPKNKLSSSDLKMKVTSGRVQQPAKSRESKMQTRILKQDLTGDFES 114

Query: 467 KENEQAACLNKKRMVALLKEFGEYPAKYRMFVWRSLLLLPENYTAYSCLTDKGPHSAFLT 526
           |.||    |||||.  ||| .|||| |||||.||||| ||||.||.| | ||| | ||| 
Sbjct: 115 KKNELPDGLNKKRLQILLKGYGEYPTKYRMFIWRSLLQLPENHTAFSTLIDKGTHVAFLN 174

Query: 527 LHNKYPIKSHRLQRCLQRVLSALAHWAAIFGEVEYLPLIAFPFVKLFQNNPLLCFEVLAT 586
           |  |||||| .| | ||| |||||||. || .  ||||.||||||||||| |.||||.||
Sbjct: 175 LQKKYPIKSRKLLRVLQRTLSALAHWSVIFSDTPYLPLLAFPFVKLFQNNQLICFEVIAT 234

Query: 587 FIVNWCQHWFEYFPNPPLNILCMVENVLAHHDKELLQHLVGCGITSQLYVWPLLETLFSE 646
            |.||||||||||||||.||| |.||||| |||||||| .   |||||| ||||||.|||
Sbjct: 235 LIINWCQHWFEYFPNPPINILSMIENVLAFHDKELLQHFIDHDITSQLYAWPLLETVFSE 294

Query: 647 VLTRDEWLRLFDSVFSNHPSFLLMACVAYITCCRGPLLHCTQKHDFE 693
           ||||.|||.|||..||||||||||  |||  | | ||| |  | |||
Sbjct: 295 VLTREEWLKLFDNIFSNHPSFLLMTVVAYNICSRTPLLSCNLKDDFE 341

>hg18||uc003ypo |8|BC105800|Q3KRB0|Q3KRB0_HUMAN|WDR67|NM_145647|NP_663622|WD
        repeat domain 67

          Length = 349

 Score =  255 bits (649), Expect = 3e-067
 Identities = 122/179 (68%), Positives = 143/179 (79%)

Query: 137 IVDEACYSASIFLADTKQMISWMRGHEGAVSFISVHSSGRYAISTSVDTAQLWDLDTFQR 196
           .|  | ||   |   ||...||||||| .|  ||||.||.|||.|| |||||||||||||
Sbjct: 100 LVALADYSIKCFDTVTKELVSWMRGHESSVFSISVHASGKYAITTSSDTAQLWDLDTFQR 159

Query: 197 KRKLTVRQPVDIQRVFFLPFSNTILSCFSDDSIFAWESDTLSCKYQLPVPDSGSQISYKA 256
           |||| .|| | ||.||||| |||||||| |.|||||| ||| |||||| |   | | || 
Sbjct: 160 KRKLNIRQSVGIQKVFFLPLSNTILSCFKDNSIFAWECDTLFCKYQLPAPPESSSILYKV 219

Query: 257 FAVSHDGRSLAAGGRSNLIHLWCLDSQQLVRVIQMPTQVRTVRQLEFLADCFDRGANQV 315
           |||. ||| |||||.|| .|||||...|| |.|||||.|| .| |||| | || |.|||
Sbjct: 220 FAVTRDGRILAAGGKSNHLHLWCLEARQLFRIIQMPTKVRAIRHLEFLPDSFDAGSNQV 278

>hg18||uc003ypp |8|NM_145647|Q2M2J9|Q2M2J9_HUMAN|WDR67|NM_145647|NP_663622|WD
        repeat domain 67

          Length = 1066

 Score =  255 bits (649), Expect = 3e-067
 Identities = 122/179 (68%), Positives = 143/179 (79%)

Query: 137 IVDEACYSASIFLADTKQMISWMRGHEGAVSFISVHSSGRYAISTSVDTAQLWDLDTFQR 196
           .|  | ||   |   ||...||||||| .|  ||||.||.|||.|| |||||||||||||
Sbjct: 100 LVALADYSIKCFDTVTKELVSWMRGHESSVFSISVHASGKYAITTSSDTAQLWDLDTFQR 159

Query: 197 KRKLTVRQPVDIQRVFFLPFSNTILSCFSDDSIFAWESDTLSCKYQLPVPDSGSQISYKA 256
           |||| .|| | ||.||||| |||||||| |.|||||| ||| |||||| |   | | || 
Sbjct: 160 KRKLNIRQSVGIQKVFFLPLSNTILSCFKDNSIFAWECDTLFCKYQLPAPPESSSILYKV 219

Query: 257 FAVSHDGRSLAAGGRSNLIHLWCLDSQQLVRVIQMPTQVRTVRQLEFLADCFDRGANQV 315
           |||. ||| |||||.|| .|||||...|| |.|||||.|| .| |||| | || |.|||
Sbjct: 220 FAVTRDGRILAAGGKSNHLHLWCLEARQLFRIIQMPTKVRAIRHLEFLPDSFDAGSNQV 278

>hg18||uc003ypt |8|CR594827|NA|NA|WDR67|NM_145647|NP_663622|WD repeat domain 67

          Length = 458

 Score =  228 bits (579), Expect = 4e-059
 Identities = 102/158 (64%), Positives = 129/158 (81%)

Query: 609 MVENVLAHHDKELLQHLVGCGITSQLYVWPLLETLFSEVLTRDEWLRLFDSVFSNHPSFL 668
           |.||||| |||||||| .   |||||| ||||||.|||||||.|||.|||..||||||||
Sbjct:   1 MIENVLAFHDKELLQHFIDHDITSQLYAWPLLETVFSEVLTREEWLKLFDNIFSNHPSFL 60

Query: 669 LMACVAYITCCRGPLLHCTQKHDFEYFFHHRNTLNMGMMIKEAYRIMDSTPSDIHPRNML 728
           ||  |||  | | ||| |  | |||.|||||| |.. ..|.. | .|..||.|||| .||
Sbjct:  61 LMTVVAYNICSRTPLLSCNLKDDFEFFFHHRNNLDINVVIRQVYHLMETTPTDIHPDSML 120

Query: 729 SDFTPLPKGHYPVFNHYPEFIVEYQNREREKIRLEEME 766
           . |  | || ||||| ||.|||.|| .|||.|| .|..
Sbjct: 121 NVFVALTKGQYPVFNQYPKFIVDYQTQERERIRNDELD 158

>hg18||uc003ypu |8|BC027237|NA|NA|WDR67|NM_145647|NP_663622|WD repeat domain 67

          Length = 458

 Score =  228 bits (579), Expect = 4e-059
 Identities = 102/158 (64%), Positives = 129/158 (81%)

Query: 609 MVENVLAHHDKELLQHLVGCGITSQLYVWPLLETLFSEVLTRDEWLRLFDSVFSNHPSFL 668
           |.||||| |||||||| .   |||||| ||||||.|||||||.|||.|||..||||||||
Sbjct:   1 MIENVLAFHDKELLQHFIDHDITSQLYAWPLLETVFSEVLTREEWLKLFDNIFSNHPSFL 60

Query: 669 LMACVAYITCCRGPLLHCTQKHDFEYFFHHRNTLNMGMMIKEAYRIMDSTPSDIHPRNML 728
           ||  |||  | | ||| |  | |||.|||||| |.. ..|.. | .|..||.|||| .||
Sbjct:  61 LMTVVAYNICSRTPLLSCNLKDDFEFFFHHRNNLDINVVIRQVYHLMETTPTDIHPDSML 120

Query: 729 SDFTPLPKGHYPVFNHYPEFIVEYQNREREKIRLEEME 766
           . |  | || ||||| ||.|||.|| .|||.|| .|..
Sbjct: 121 NVFVALTKGQYPVFNQYPKFIVDYQTQERERIRNDELD 158

>hg18||uc003ypo |8|BC105800|Q3KRB0|Q3KRB0_HUMAN|WDR67|NM_145647|NP_663622|WD
        repeat domain 67

          Length = 349

 Score =  144 bits (361), Expect = 7e-034
 Identities = 67/112 (59%), Positives = 84/112 (75%), Gaps = 4/112 (3%)

Query:   1 MEVTDIGNKDEGKVWHRKPGPG--KGLLATVVRTVQ--RAKTVRFLHVAFDATGDVFLAG 56
           |. ||.|||. ||.||||| |    |..  ..        | .|||.|||| |||  .||
Sbjct:   1 MQSTDLGNKESGKIWHRKPSPATRDGIIVNIIHNTSDYHPKVLRFLNVAFDGTGDCLIAG 60

Query:  57 DHHGNIYVFDIGRNRFHLVQKTGQACTALAFNLHRTTELLVALADHTIKCFD 108
           || |||||||.  |||.|||.| |||||||||| | .| ||||||..|||||
Sbjct:  61 DHQGNIYVFDLHGNRFNLVQRTAQACTALAFNLRRKSEFLVALADYSIKCFD 112

>hg18||uc003ypp |8|NM_145647|Q2M2J9|Q2M2J9_HUMAN|WDR67|NM_145647|NP_663622|WD
        repeat domain 67

          Length = 1066

 Score =  144 bits (361), Expect = 7e-034
 Identities = 67/112 (59%), Positives = 84/112 (75%), Gaps = 4/112 (3%)

Query:   1 MEVTDIGNKDEGKVWHRKPGPG--KGLLATVVRTVQ--RAKTVRFLHVAFDATGDVFLAG 56
           |. ||.|||. ||.||||| |    |..  ..        | .|||.|||| |||  .||
Sbjct:   1 MQSTDLGNKESGKIWHRKPSPATRDGIIVNIIHNTSDYHPKVLRFLNVAFDGTGDCLIAG 60

Query:  57 DHHGNIYVFDIGRNRFHLVQKTGQACTALAFNLHRTTELLVALADHTIKCFD 108
           || |||||||.  |||.|||.| |||||||||| | .| ||||||..|||||
Sbjct:  61 DHQGNIYVFDLHGNRFNLVQRTAQACTALAFNLRRKSEFLVALADYSIKCFD 112

>hg18||uc003ypo |8|BC105800|Q3KRB0|Q3KRB0_HUMAN|WDR67|NM_145647|NP_663622|WD
        repeat domain 67

          Length = 349

 Score =  93 bits (229), Expect = 1e-018
 Identities = 42/68 (61%), Positives = 59/68 (86%)

Query: 346 QTLGVLSQDGVMQFINIQTCKLLFHMGSRRNPINTVAIGPNGRHMAAIMDNGSINVYNIQ 405
           | ||||||||.|.|||.||||||| .||    |.. || |.||..|.||.|||.|.|..|
Sbjct: 277 QVLGVLSQDGIMRFINMQTCKLLFEIGSLDEGISSSAISPHGRYIASIMENGSLNIYSVQ 336

Query: 406 SLTQGIHK 413
           .||| |.|
Sbjct: 337 ALTQEINK 344

>hg18||uc002veq |2|NM_024532|Q8N0X2|SPG16_HUMAN|SPAG16|NM_024532|NP_078808|sperm
        associated antigen 16 isoform 1

          Length = 631

 Score =  51 bits (120), Expect = 6e-006
 Identities = 35/132 (26%), Positives = 65/132 (49%), Gaps = 8/132 (6%)

Query: 161 GHEGAVSFISVHSSGRYAISTSVD-TAQLWDLDTFQRKRKLTVRQPVDIQRVFFLPFSNT 219
           ||  ||   . || | .  |.|.| |...||... .| |         .  . | |||||
Sbjct: 434 GHSRAVWSCTWHSCGNFVASSSLDKTSKIWDVNS-ERCRCTLYGHTDSVNSIEFFPFSNT 492

Query: 220 ILSCFSDDSIFAWESDTLSCKYQLPVPDSGSQISYKAFAVSHDGRSLAAGGRSNLIHLWC 279
           .|.  .| ..  |.. |  |.  |     |   |         |  .|.     .  || 
Sbjct: 493 LLTSSADKTLSIWDARTGICEQSL----YGHMHSINDAIFDPRGHMIASCDACGVTKLW- 547

Query: 280 LDSQQLVRVIQM 291
            | ..|. .. .
Sbjct: 548 -DFRKLLPIVSI 558

>hg18||uc002ver |2|BC025379|Q4G1A2|Q4G1A2_HUMAN|SPAG16|NA|NA|SPAG16 protein

          Length = 577

 Score =  51 bits (120), Expect = 6e-006
 Identities = 35/132 (26%), Positives = 65/132 (49%), Gaps = 8/132 (6%)

Query: 161 GHEGAVSFISVHSSGRYAISTSVD-TAQLWDLDTFQRKRKLTVRQPVDIQRVFFLPFSNT 219
           ||  ||   . || | .  |.|.| |...||... .| |         .  . | |||||
Sbjct: 380 GHSRAVWSCTWHSCGNFVASSSLDKTSKIWDVNS-ERCRCTLYGHTDSVNSIEFFPFSNT 438

Query: 220 ILSCFSDDSIFAWESDTLSCKYQLPVPDSGSQISYKAFAVSHDGRSLAAGGRSNLIHLWC 279
           .|.  .| ..  |.. |  |.  |     |   |         |  .|.     .  || 
Sbjct: 439 LLTSSADKTLSIWDARTGICEQSL----YGHMHSINDAIFDPRGHMIASCDACGVTKLW- 493

Query: 280 LDSQQLVRVIQM 291
            | ..|. .. .
Sbjct: 494 -DFRKLLPIVSI 504

>hg18||uc001cix |1|NM_001255|Q12834|CDC20_HUMAN|CDC20|NM_001255|NP_001246|cell
        division cycle 20

          Length = 499

 Score =  43 bits (99), Expect = 0.002
 Identities = 39/144 (27%), Positives = 61/144 (42%), Gaps = 6/144 (4%)

Query: 135 ALIVDEACYSASIFLADTKQMISWMRGHEGAVSFISVHSSGRYAISTSVDTAQLWDLDTF 194
           |. .| . |  |    |  |..   .  |   |   .      |. ||    ||||.   
Sbjct: 199 AVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQ 258

Query: 195 QRKRKLTVRQPVDIQRVFFLPFSNTILSCFSDDSIFAWESDTLSCKYQLPVPDSGSQISY 254
           .| | .|        ||  | ... |||  |  |      |    .. .      ||   
Sbjct: 259 KRLRNMTSHS----ARVGSLSWNSYILSSGS-RSGHIHHHDVRVAEHHVATLSGHSQ-EV 312

Query: 255 KAFAVSHDGRSLAAGGRSNLIHLW 278
                . ||| ||.||  ||...|
Sbjct: 313 CGLRWAPDGRHLASGGNDNLVNVW 336

>hg18||uc001ciy |1|BC000624|Q12834|CDC20_HUMAN|CDC20|NM_001255|NP_001246|cell
        division cycle 20

          Length = 499

 Score =  43 bits (99), Expect = 0.002
 Identities = 39/144 (27%), Positives = 61/144 (42%), Gaps = 6/144 (4%)

Query: 135 ALIVDEACYSASIFLADTKQMISWMRGHEGAVSFISVHSSGRYAISTSVDTAQLWDLDTF 194
           |. .| . |  |    |  |..   .  |   |   .      |. ||    ||||.   
Sbjct: 199 AVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQ 258

Query: 195 QRKRKLTVRQPVDIQRVFFLPFSNTILSCFSDDSIFAWESDTLSCKYQLPVPDSGSQISY 254
           .| | .|        ||  | ... |||  |  |      |    .. .      ||   
Sbjct: 259 KRLRNMTSHS----ARVGSLSWNSYILSSGS-RSGHIHHHDVRVAEHHVATLSGHSQ-EV 312

Query: 255 KAFAVSHDGRSLAAGGRSNLIHLW 278
                . ||| ||.||  ||...|
Sbjct: 313 CGLRWAPDGRHLASGGNDNLVNVW 336

>hg18||uc002vpn |2|NM_178821|Q8N136|WDR69_HUMAN|WDR69|NM_178821|NP_849143|WD
        repeat domain 69

          Length = 415

 Score =  43 bits (99), Expect = 0.002
 Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 144 SASIFLADTKQMISWMRGHEGAVSFISVHSSGRYAISTSVD-TAQLWDLDTFQ 195
           .| || | |.. |. . |||| .| || .  | . .. | | ||..||  | |
Sbjct: 326 TARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQ 378

>hg18||uc002asm
        |15|NM_005078|Q04726|TLE3_HUMAN|TLE3|NM_005078|NP_005069|transducin-lik
        e enhancer protein 3

          Length = 772

 Score =  39 bits (89), Expect = 0.024
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 12/115 (10%)

Query: 171 VHSSGR-YAISTSVDTAQLWDL--DTFQRKRKLTVRQPVDIQRVFFLPFSNTILSCFSDD 227
           .|  ||   .     |  .|||   | . | .||   |     .   | .    || || 
Sbjct: 540 LHPDGRTLIVGGEGSTLTIWDLASPTPRIKAELTSSAPA-CYALAISPDAKVCFSCCSDG 598

Query: 228 SIFAWE--SDTLSCKYQLPVPDSGSQISYKAFAVSHDGRSLAAGGRSNLIHLWCL 280
           .|  |.  . ||  ..|      |         .||||  |  ||  | .  | |
Sbjct: 599 NIAVWDLHNQTLVRQFQ------GHTDGASCIDISHDGTKLWTGGLDNTVRSWDL 647

>hg18||uc002cow |16|NM_032271|Q6Q0C0|TRAF7_HUMAN|TRAF7|NM_032271|NP_115647|ring
        finger and WD repeat domain 1

          Length = 670

 Score =  39 bits (88), Expect = 0.031
 Identities = 34/138 (24%), Positives = 64/138 (46%), Gaps = 14/138 (10%)

Query: 154 QMISWMRGHEGAVSFISVHSSGRYAISTSVDTAQLWDL--DTFQRKRKLTVRQPVDIQRV 211
           | .. .| |.  |   .. ||     | |.   ..||.     . |..||         |
Sbjct: 470 QKVNTIRAHDNPV--CTLVSSHNVLFSGSLKAIKVWDIVGTELKLKKELTGLN----HWV 523

Query: 212 FFLPFSNTILSCFSDDSIFAWESDTLSCKYQLPVPDSGSQISYKAFAVSHDGRSLAAGGR 271
             |  . . |   |  .|  |.  || | . |    ||  .    ....     .  |  
Sbjct: 524 RALVAAQSYLYSGSYQTIKIWDIRTLDCIHVLQT--SGGSV----YSIAVTNHHIVCGTY 577

Query: 272 SNLIHLWCLDSQQLVRVI 289
            ||||.| ..|.. || .
Sbjct: 578 ENLIHVWDIESKEQVRTL 595

>hg18||uc002ask
        |15|AK096779|Q04726-3|Q04726-3|TLE3|NM_005078|NP_005069|transducin-like
        enhancer protein 3

          Length = 699

 Score =  38 bits (87), Expect = 0.040
 Identities = 30/106 (28%), Positives = 43/106 (40%), Gaps = 11/106 (10%)

Query: 179 ISTSVDTAQLWDL--DTFQRKRKLTVRQPVDIQRVFFLPFSNTILSCFSDDSIFAWE--S 234
           .     |  .|||   | . | .||   |     .   | .    || || .|  |.  .
Sbjct: 476 VGGEASTLTIWDLASPTPRIKAELTSSAPA-CYALAISPDAKVCFSCCSDGNIAVWDLHN 534

Query: 235 DTLSCKYQLPVPDSGSQISYKAFAVSHDGRSLAAGGRSNLIHLWCL 280
            ||  ..|      |         .||||  |  ||  | .  | |
Sbjct: 535 QTLVRQFQ------GHTDGASCIDISHDGTKLWTGGLDNTVRSWDL 574

>hg18||uc002asl
        |15|BC041831|Q04726-4|Q04726-4|TLE3|NM_005078|NP_005069|transducin-like
        enhancer protein 3

          Length = 772

 Score =  38 bits (87), Expect = 0.040
 Identities = 30/106 (28%), Positives = 43/106 (40%), Gaps = 11/106 (10%)

Query: 179 ISTSVDTAQLWDL--DTFQRKRKLTVRQPVDIQRVFFLPFSNTILSCFSDDSIFAWE--S 234
           .     |  .|||   | . | .||   |     .   | .    || || .|  |.  .
Sbjct: 549 VGGEASTLTIWDLASPTPRIKAELTSSAPA-CYALAISPDAKVCFSCCSDGNIAVWDLHN 607

Query: 235 DTLSCKYQLPVPDSGSQISYKAFAVSHDGRSLAAGGRSNLIHLWCL 280
            ||  ..|      |         .||||  |  ||  | .  | |
Sbjct: 608 QTLVRQFQ------GHTDGASCIDISHDGTKLWTGGLDNTVRSWDL 647

>hg18||uc002asn
        |15|AB046767|Q04726-2|Q04726-2|TLE3|NM_005078|NP_005069|transducin-like
        enhancer protein 3

          Length = 760

 Score =  38 bits (87), Expect = 0.040
 Identities = 30/106 (28%), Positives = 43/106 (40%), Gaps = 11/106 (10%)

Query: 179 ISTSVDTAQLWDL--DTFQRKRKLTVRQPVDIQRVFFLPFSNTILSCFSDDSIFAWE--S 234
           .     |  .|||   | . | .||   |     .   | .    || || .|  |.  .
Sbjct: 537 VGGEASTLTIWDLASPTPRIKAELTSSAPA-CYALAISPDAKVCFSCCSDGNIAVWDLHN 595

Query: 235 DTLSCKYQLPVPDSGSQISYKAFAVSHDGRSLAAGGRSNLIHLWCL 280
            ||  ..|      |         .||||  |  ||  | .  | |
Sbjct: 596 QTLVRQFQ------GHTDGASCIDISHDGTKLWTGGLDNTVRSWDL 635

>hg18||uc002aso
        |15|AY583460|Q6PI57|Q6PI57_HUMAN|TLE3|NM_005078|NP_005069|transducin-li
        ke enhancer protein 3

          Length = 767

 Score =  38 bits (87), Expect = 0.040
 Identities = 30/106 (28%), Positives = 43/106 (40%), Gaps = 11/106 (10%)

Query: 179 ISTSVDTAQLWDL--DTFQRKRKLTVRQPVDIQRVFFLPFSNTILSCFSDDSIFAWE--S 234
           .     |  .|||   | . | .||   |     .   | .    || || .|  |.  .
Sbjct: 544 VGGEASTLTIWDLASPTPRIKAELTSSAPA-CYALAISPDAKVCFSCCSDGNIAVWDLHN 602

Query: 235 DTLSCKYQLPVPDSGSQISYKAFAVSHDGRSLAAGGRSNLIHLWCL 280
            ||  ..|      |         .||||  |  ||  | .  | |
Sbjct: 603 QTLVRQFQ------GHTDGASCIDISHDGTKLWTGGLDNTVRSWDL 642

>hg18||uc002asp
        |15|AY583459|Q04726-3|Q04726-3|TLE3|NM_005078|NP_005069|transducin-like
        enhancer protein 3

          Length = 764

 Score =  38 bits (87), Expect = 0.040
 Identities = 30/106 (28%), Positives = 43/106 (40%), Gaps = 11/106 (10%)

Query: 179 ISTSVDTAQLWDL--DTFQRKRKLTVRQPVDIQRVFFLPFSNTILSCFSDDSIFAWE--S 234
           .     |  .|||   | . | .||   |     .   | .    || || .|  |.  .
Sbjct: 541 VGGEASTLTIWDLASPTPRIKAELTSSAPA-CYALAISPDAKVCFSCCSDGNIAVWDLHN 599

Query: 235 DTLSCKYQLPVPDSGSQISYKAFAVSHDGRSLAAGGRSNLIHLWCL 280
            ||  ..|      |         .||||  |  ||  | .  | |
Sbjct: 600 QTLVRQFQ------GHTDGASCIDISHDGTKLWTGGLDNTVRSWDL 639

>hg18||uc001bso |1|NM_004814|Q96DI7|WDR57_HUMAN|WDR57|NM_004814|NP_004805|WD
        repeat domain 57 (U5 snRNP specific)

          Length = 357

 Score =  35 bits (80), Expect = 0.260
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 159 MRGHEGAVSFISVHSSGRYAISTSVD-TAQLWDLDTFQRKRK 199
           ||||  .|. .|. | | | .| ..| | ..||.  |  | .
Sbjct: 231 MRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKER 272

>hg18||uc001ehj |1|NM_006784|Q9UNX4|WDR3_HUMAN|WDR3|NM_006784|NP_006775|WD
        repeat-containing protein 3

          Length = 943

 Score =  35 bits (78), Expect = 0.444
 Identities = 30/138 (21%), Positives = 58/138 (42%), Gaps = 15/138 (10%)

Query: 155 MISWMRGHEGAVSFISVHSSGRYAISTSVD-TAQLWDL----DTFQRKRKLTVRQ----- 204
           ..  .  |.||.  .|.    |  ..   | . . ||     |    ...|.|.|     
Sbjct: 488 LLETIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTQKRLSVKQTRTLQ 547

Query: 205 -PVDIQRVFFLPFSNTILSCFSDDSIFAWESDTLSCKYQLPVPDSGSQISYKAFAVSHDG 263
              |.  | . |    .     | ..  .  |||     |     | ..      .||||
Sbjct: 548 LDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSL----YGHKLPVICMDISHDG 603

Query: 264 RSLAAGGRSNLIHLWCLD 281
             .| |     . .| ||
Sbjct: 604 ALIATGSADRNVKIWGLD 621

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0