BLASTP 7.6.0


Query=fugu4_550746 |jgi|Takru4|550746|e_gw2.139.100.1
        (525 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002jzj |17|NM_001080395|Q6ZMQ8|LMTK1_HUMAN|AATK|NM_00108...     71   3e-012
hg18||uc003upd |7|NM_014916|Q8IWU2|LMTK2_HUMAN|LMTK2|NM_014916|N...     44   5e-004
hg18||uc002pjk |19|NM_001080434|Q96Q04|LMTK3_HUMAN|LMTK3|NM_0010...     44   6e-004
hg18||uc002jzj |17|NM_001080395|Q6ZMQ8|LMTK1_HUMAN|AATK|NM_00108...     42   0.002
hg18||uc003hdx |4|NM_001031732|Q96MU7|YTDC1_HUMAN|YTHDC1|NM_0010...     35   0.162
hg18||uc003hdy |4|NM_133370|Q96MU7-2|Q96MU7-2|YTHDC1|NM_133370|N...     35   0.162
hg18||uc002rkl |2|NM_002707|O15355|PP2CG_HUMAN|PPM1G|NM_002707|N...     35   0.212
hg18||uc002igb |17|NM_014233|P17480|UBF1_HUMAN|UBTF|NM_014233|NP...     34   0.361
hg18||uc002igc |17|NM_001076684|P17480-2|P17480-2|UBTF|NM_001076...     34   0.361
hg18||uc002igd |17|NM_001076683|P17480-2|P17480-2|UBTF|NM_001076...     34   0.361
hg18||uc001pfx |11|NM_024725|Q8N4S0|CCD82_HUMAN|CCDC82|NM_024725...     33   0.617
hg18||uc002arl |15|NM_006305|P39687|AN32A_HUMAN|ANP32A|NM_006305...     33   0.617
hg18||uc002chf |16|NM_014700|O75154|RFIP3_HUMAN|RAB11FIP3|NM_014...     33   0.805
hg18||uc003hdx |4|NM_001031732|Q96MU7|YTDC1_HUMAN|YTHDC1|NM_0010...     33   0.805
hg18||uc003hdy |4|NM_133370|Q96MU7-2|Q96MU7-2|YTHDC1|NM_133370|N...     33   0.805
hg18||uc002qxd |2|NM_015025|Q9UL68|MYT1L_HUMAN|MYT1L|NM_015025|N...     33   1.052
hg18||uc002qxe |2|AF036943|Q9UL68|MYT1L_HUMAN|MYT1L|NM_015025|NP...     33   1.052
hg18||uc002yii |20|NM_004535|Q01538|MYT1_HUMAN|MYT1|NM_004535|NP...     33   1.052
hg18||uc002igb |17|NM_014233|P17480|UBF1_HUMAN|UBTF|NM_014233|NP...     32   1.374
hg18||uc002igc |17|NM_001076684|P17480-2|P17480-2|UBTF|NM_001076...     32   1.374
hg18||uc002igd |17|NM_001076683|P17480-2|P17480-2|UBTF|NM_001076...     32   1.374
hg18||uc003ygo |8|NM_015496|Q69YN4|Q69YN4_HUMAN|KIAA1429|NM_0154...     32   1.794
hg18||uc003ygp |8|NM_183009|Q8IXH4|Q8IXH4_HUMAN|KIAA1429|NM_1830...     32   1.794
hg18||uc004bvt |9|AM393022|Q01105|SET_HUMAN|SET|NA|NA|Protein SE...     32   2.343
hg18||uc004bvu |9|NM_003011|Q01105-2|Q01105-2|SET|NM_003011|NP_0...     32   2.343
hg18||uc004dvy |X|AK127207|NA|NA|AK127207|NA|NA|Homo sapiens cDN...     31   3.060
hg18||uc004dvz |X|AK125760|NA|NA|LAS1L|NM_031206|NP_112483|LAS1-...     31   3.060
hg18||uc004dwa |X|NM_031206|Q9Y4W2|LAS1L_HUMAN|LAS1L|NM_031206|N...     31   3.060
hg18||uc004dwc |X|BC018610|Q9Y4W2-2|Q9Y4W2-2|LAS1L|NM_031206|NP_...     31   3.060
hg18||uc004dwd |X|AK097383|Q9Y4W2-3|Q9Y4W2-3|LAS1L|NM_031206|NP_...     31   3.060
hg18||uc003dns |3|NM_198271|Q0VAK6|LMOD3_HUMAN|LMOD3|NM_198271|N...     30   5.219
hg18||uc003dnt |3|BC039202|Q0VAK6|LMOD3_HUMAN|LMOD3|NM_198271|NP...     30   5.219
hg18||uc003hdx |4|NM_001031732|Q96MU7|YTDC1_HUMAN|YTHDC1|NM_0010...     30   5.219
hg18||uc003hdy |4|NM_133370|Q96MU7-2|Q96MU7-2|YTHDC1|NM_133370|N...     30   5.219
hg18||uc003byf |3|NR_002223|Q17RH7|Q17RH7_HUMAN|TPRXL|NA|NA|TPRX...     30   6.817
hg18||uc003byh |3|BC016304|Q17RH7|Q17RH7_HUMAN|TPRXL|NA|NA|TPRXL...     30   6.817
hg18||uc003ydx |8|NM_019098|Q9NQW8|CNGB3_HUMAN|CNGB3|NM_019098|N...     30   6.817
hg18||uc002poo |19|AB033031|Q9ULL5|PRR12_HUMAN|PRR12|NA|NA|Proli...     30   8.903
hg18||uc002rkm |2|AB209197|Q59GB2|Q59GB2_HUMAN|PPM1G|NA|NA|Prote...     30   8.903

>hg18||uc002jzj
        |17|NM_001080395|Q6ZMQ8|LMTK1_HUMAN|AATK|NM_001080395|NP_001073864|apop
        tosis-associated tyrosine kinase

          Length = 1401

 Score =  71 bits (173), Expect = 3e-012
 Identities = 32/40 (80%), Positives = 40/40 (100%)

Query:  477 HLRSLLKMPALLTQSFCDELERKKKAVSFFDDVTVFLFDQ 516
            .||||||||.||...||..||||||||||||||||.||||
Sbjct: 1233 NLRSLLKMPSLLSETFCEDLERKKKAVSFFDDVTVYLFDQ 1272

>hg18||uc003upd |7|NM_014916|Q8IWU2|LMTK2_HUMAN|LMTK2|NM_014916|NP_055731|lemur
        tyrosine kinase 2

          Length = 1503

 Score =  44 bits (102), Expect = 5e-004
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 1/41 (2%)

Query:  477 HLRSLLKMPAL-LTQSFCDELERKKKAVSFFDDVTVFLFDQ 516
            |||||||  |        .. ...||||.|||||||.||||
Sbjct: 1329 HLRSLLKPTAANAPDPLPEDWKKEKKAVTFFDDVTVYLFDQ 1369

>hg18||uc002pjk
        |19|NM_001080434|Q96Q04|LMTK3_HUMAN|LMTK3|NM_001080434|NP_001073903|lem
        ur tyrosine kinase 3

          Length = 1489

 Score =  44 bits (101), Expect = 6e-004
 Identities = 23/39 (58%), Positives = 26/39 (66%)

Query:  478 LRSLLKMPALLTQSFCDELERKKKAVSFFDDVTVFLFDQ 516
            || ||| |    .    |||||.| |||  ||||.||||
Sbjct: 1355 LRGLLKSPRGADEPEDSELERKRKMVSFHGDVTVYLFDQ 1393

>hg18||uc002jzj
        |17|NM_001080395|Q6ZMQ8|LMTK1_HUMAN|AATK|NM_001080395|NP_001073864|apop
        tosis-associated tyrosine kinase

          Length = 1401

 Score =  42 bits (97), Expect = 0.002
 Identities = 17/22 (77%), Positives = 20/22 (90%)

Query: 148 PKSLDSGYDTENNESPEFIFKE 169
           |..||||||||| |||||. ||
Sbjct: 959 PRALDSGYDTENYESPEFVLKE 980

>hg18||uc003hdx
        |4|NM_001031732|Q96MU7|YTDC1_HUMAN|YTHDC1|NM_001031732|NP_001026902|spl
        icing factor YT521-B isoform 1

          Length = 727

 Score =  35 bits (80), Expect = 0.162
 Identities = 27/109 (24%), Positives = 44/109 (40%), Gaps = 2/109 (1%)

Query: 285 DTEHSAEEPSSELTSSIGSEASSTVQEAPGGHEEGNRRPEDCSHAHSLHLDSTMNTFGDE 344
           | |  |. |. . .  || |       .    .|     |.    |      . .  |. 
Sbjct: 139 DPERRAKSPTPDGSERIGLEVDRRASRSSQSSKE-EVNSEEYGSDHETGSSGSSDEQGNN 197

Query: 345 ASKENEKADR-TREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEE 392
              | |  .    ||||| .  .  || |.  |     ||. |. . ||
Sbjct: 198 TENEEEGVEEDVEEDEEVEEDAEEDEEVDEDGEEEEEEEEEEEEEEEEE 246

>hg18||uc003hdy
        |4|NM_133370|Q96MU7-2|Q96MU7-2|YTHDC1|NM_133370|NP_588611|splicing
        factor YT521-B isoform 2

          Length = 709

 Score =  35 bits (80), Expect = 0.162
 Identities = 27/109 (24%), Positives = 44/109 (40%), Gaps = 2/109 (1%)

Query: 285 DTEHSAEEPSSELTSSIGSEASSTVQEAPGGHEEGNRRPEDCSHAHSLHLDSTMNTFGDE 344
           | |  |. |. . .  || |       .    .|     |.    |      . .  |. 
Sbjct: 139 DPERRAKSPTPDGSERIGLEVDRRASRSSQSSKE-EVNSEEYGSDHETGSSGSSDEQGNN 197

Query: 345 ASKENEKADR-TREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEE 392
              | |  .    ||||| .  .  || |.  |     ||. |. . ||
Sbjct: 198 TENEEEGVEEDVEEDEEVEEDAEEDEEVDEDGEEEEEEEEEEEEEEEEE 246

>hg18||uc002rkl
        |2|NM_002707|O15355|PP2CG_HUMAN|PPM1G|NM_002707|NP_002698|protein
        phosphatase 1G

          Length = 546

 Score =  35 bits (79), Expect = 0.212
 Identities = 37/133 (27%), Positives = 52/133 (39%), Gaps = 9/133 (6%)

Query: 271 LTKESGPADENLGLDTEHSAEEPSSELTSSIGSEASSTV-QEAPGGHEEGNRRPEDCSHA 329
           |  |.|| |      .. .     .    |  ||  .   |    |   |   |  || |
Sbjct: 186 LNGEAGPEDSTRETPSQENGPTAKAYTGFSSNSERGTEAGQVGEPGIPTGEAGP-SCSSA 244

Query: 330 HSLHLDSTMNTFGDEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDID 389
                    . | ...  |...|.   || |     .  || |  |     |||| || |
Sbjct: 245 SDKLPRVAKSKFFEDSEDESDEAEEEEEDSE-----ECSEEEDGYSSEEAENEED-ED-D 297

Query: 390 AEECNSQDSLGEE 402
            ||    |   ||
Sbjct: 298 TEEAEEDDEEEEE 310

>hg18||uc002igb
        |17|NM_014233|P17480|UBF1_HUMAN|UBTF|NM_014233|NP_055048|upstream
        binding transcription factor, RNA

          Length = 764

 Score =  34 bits (77), Expect = 0.361
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 13/68 (19%)

Query: 343 DEASKENEKADRTREDEEVPDLND---------VKEEGDDGSEAVRINEEDFEDIDAEEC 393
           ||  ...|  |   ||.|  | ..          ..| .|| |    |||| || | .| 
Sbjct: 681 DEEDEDDEDEDEEEEDDENGDSSEDGGDSSESSSEDESEDGDE----NEEDDEDEDDDED 736

Query: 394 NSQDSLGE 401
           . .|   |
Sbjct: 737 DDEDEDNE 744

>hg18||uc002igc
        |17|NM_001076684|P17480-2|P17480-2|UBTF|NM_001076684|NP_001070152|upstr
        eam binding transcription factor, RNA

          Length = 727

 Score =  34 bits (77), Expect = 0.361
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 13/68 (19%)

Query: 343 DEASKENEKADRTREDEEVPDLND---------VKEEGDDGSEAVRINEEDFEDIDAEEC 393
           ||  ...|  |   ||.|  | ..          ..| .|| |    |||| || | .| 
Sbjct: 644 DEEDEDDEDEDEEEEDDENGDSSEDGGDSSESSSEDESEDGDE----NEEDDEDEDDDED 699

Query: 394 NSQDSLGE 401
           . .|   |
Sbjct: 700 DDEDEDNE 707

>hg18||uc002igd
        |17|NM_001076683|P17480-2|P17480-2|UBTF|NM_001076683|NP_001070151|upstr
        eam binding transcription factor, RNA

          Length = 727

 Score =  34 bits (77), Expect = 0.361
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 13/68 (19%)

Query: 343 DEASKENEKADRTREDEEVPDLND---------VKEEGDDGSEAVRINEEDFEDIDAEEC 393
           ||  ...|  |   ||.|  | ..          ..| .|| |    |||| || | .| 
Sbjct: 644 DEEDEDDEDEDEEEEDDENGDSSEDGGDSSESSSEDESEDGDE----NEEDDEDEDDDED 699

Query: 394 NSQDSLGE 401
           . .|   |
Sbjct: 700 DDEDEDNE 707

>hg18||uc001pfx
        |11|NM_024725|Q8N4S0|CCD82_HUMAN|CCDC82|NM_024725|NP_079001|coiled-coil
        domain containing 82

          Length = 544

 Score =  33 bits (75), Expect = 0.617
 Identities = 18/61 (29%), Positives = 27/61 (44%)

Query: 342 GDEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEECNSQDSLGE 401
           |     | .  ..|   ..   |  .||     |   | .  |||| . | | | | . |
Sbjct: 218 GSSVEMEQKTPEKTLAAQKREKLQKLKELSKQRSRQRRSSGRDFEDSEKESCPSSDEVDE 277

Query: 402 E 402
           |
Sbjct: 278 E 278

>hg18||uc002arl
        |15|NM_006305|P39687|AN32A_HUMAN|ANP32A|NM_006305|NP_006296|acidic
        (leucine-rich) nuclear phosphoprotein 32

          Length = 249

 Score =  33 bits (75), Expect = 0.617
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 343 DEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEECNSQDSLGEE 402
           ||  .| ..  .  ||||  |  .  || |   |    .|| . | . ..   .. ||||
Sbjct: 173 DEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEE-DEEGYNDGEVDDEEDEEELGEE 231

Query: 403 PNG 405
             |
Sbjct: 232 ERG 234

>hg18||uc002chf
        |16|NM_014700|O75154|RFIP3_HUMAN|RAB11FIP3|NM_014700|NP_055515|rab11-fa
        mily interacting protein 3

          Length = 756

 Score =  33 bits (74), Expect = 0.805
 Identities = 30/98 (30%), Positives = 38/98 (38%), Gaps = 7/98 (7%)

Query: 235 PREEGGIF*PDTSP------SSPHPAPG-FSMLSPFPPQMGGCLTKESGPADENLGLDTE 287
           | | |    |...|      || | | |   . ||||    | |  | ||       |  
Sbjct: 129 PEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLS 188

Query: 288 HSAEEPSSELTSSIGSEASSTVQEAPGGHEEGNRRPED 325
            .   ||  . |         | .|  |  .|  | ||
Sbjct: 189 QTHPLPSEPVGSQEDGPRLRAVFDALDGDGDGFVRIED 226

>hg18||uc003hdx
        |4|NM_001031732|Q96MU7|YTDC1_HUMAN|YTHDC1|NM_001031732|NP_001026902|spl
        icing factor YT521-B isoform 1

          Length = 727

 Score =  33 bits (74), Expect = 0.805
 Identities = 30/121 (24%), Positives = 50/121 (41%), Gaps = 9/121 (7%)

Query: 288 HSAEEPSSELTSSIGS---EASSTVQEAPGGHEEGNRRPEDCSHAHSLHLDSTMNTFGDE 344
           .| |  |   | | ||   . ..|  |  |  |.     ||         |  ..  |.|
Sbjct: 175 NSEEYGSDHETGSSGSSDEQGNNTENEEEGVEEDVE---EDEEVEEDAEEDEEVDEDGEE 231

Query: 345 ASKENEKADRTREDEE---VPDLNDVKEEGDDGSEAVRINEEDFEDIDAEECNSQDSLGE 401
             .| |. .   |.||     |  | ||||.|       ..   | .   . . .   | 
Sbjct: 232 EEEEEEEEEEEEEEEEEEYEQDERDQKEEGNDYDTRSEASDSGSESVSFTDGSVRSGSGT 291

Query: 402 E 402
           .
Sbjct: 292 D 292

>hg18||uc003hdy
        |4|NM_133370|Q96MU7-2|Q96MU7-2|YTHDC1|NM_133370|NP_588611|splicing
        factor YT521-B isoform 2

          Length = 709

 Score =  33 bits (74), Expect = 0.805
 Identities = 30/121 (24%), Positives = 50/121 (41%), Gaps = 9/121 (7%)

Query: 288 HSAEEPSSELTSSIGS---EASSTVQEAPGGHEEGNRRPEDCSHAHSLHLDSTMNTFGDE 344
           .| |  |   | | ||   . ..|  |  |  |.     ||         |  ..  |.|
Sbjct: 175 NSEEYGSDHETGSSGSSDEQGNNTENEEEGVEEDVE---EDEEVEEDAEEDEEVDEDGEE 231

Query: 345 ASKENEKADRTREDEE---VPDLNDVKEEGDDGSEAVRINEEDFEDIDAEECNSQDSLGE 401
             .| |. .   |.||     |  | ||||.|       ..   | .   . . .   | 
Sbjct: 232 EEEEEEEEEEEEEEEEEEYEQDERDQKEEGNDYDTRSEASDSGSESVSFTDGSVRSGSGT 291

Query: 402 E 402
           .
Sbjct: 292 D 292

>hg18||uc002qxd |2|NM_015025|Q9UL68|MYT1L_HUMAN|MYT1L|NM_015025|NP_055840|myelin
        transcription factor 1-like

          Length = 1184

 Score =  33 bits (73), Expect = 1.052
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 343 DEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEED-FEDIDAEECNSQDSLGE 401
           |   || .. .   || . |   | ..|  |  |   | |||  .| | |.   ..   |
Sbjct:  98 DMDEKEEDEGEEYSEDNDEPGDEDEEDEEGDREEEEEIEEEDEDDDEDGEDVEDEEEEEE 157

Query: 402 E 402
           |
Sbjct: 158 E 158

>hg18||uc002qxe |2|AF036943|Q9UL68|MYT1L_HUMAN|MYT1L|NM_015025|NP_055840|myelin
        transcription factor 1-like

          Length = 1186

 Score =  33 bits (73), Expect = 1.052
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 343 DEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEED-FEDIDAEECNSQDSLGE 401
           |   || .. .   || . |   | ..|  |  |   | |||  .| | |.   ..   |
Sbjct:  98 DMDEKEEDEGEEYSEDNDEPGDEDEEDEEGDREEEEEIEEEDEDDDEDGEDVEDEEEEEE 157

Query: 402 E 402
           |
Sbjct: 158 E 158

>hg18||uc002yii |20|NM_004535|Q01538|MYT1_HUMAN|MYT1|NM_004535|NP_004526|myelin
        transcription factor 1

          Length = 1121

 Score =  33 bits (73), Expect = 1.052
 Identities = 18/64 (28%), Positives = 31/64 (48%)

Query: 343 DEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEECNSQDSLGEE 402
           .|.||.        ||||  .  . .|| ..  |     ||. |. . ||   ..   ||
Sbjct: 246 EESSKQKGILSHEEEDEEEEEEEEEEEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 305

Query: 403 PNGP 406
              |
Sbjct: 306 EAAP 309

>hg18||uc002igb
        |17|NM_014233|P17480|UBF1_HUMAN|UBTF|NM_014233|NP_055048|upstream
        binding transcription factor, RNA

          Length = 764

 Score =  32 bits (72), Expect = 1.374
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 343 DEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEECNSQDSLGEE 402
           .|  .|.|  .   |.||  .  |  |.| | ||.   .|.. || |  | . .|   .|
Sbjct: 678 EEDDEEDEDDEDEDEEEEDDENGDSSEDGGDSSES--SSEDESEDGDENEEDDEDEDDDE 735

>hg18||uc002igc
        |17|NM_001076684|P17480-2|P17480-2|UBTF|NM_001076684|NP_001070152|upstr
        eam binding transcription factor, RNA

          Length = 727

 Score =  32 bits (72), Expect = 1.374
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 343 DEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEECNSQDSLGEE 402
           .|  .|.|  .   |.||  .  |  |.| | ||.   .|.. || |  | . .|   .|
Sbjct: 641 EEDDEEDEDDEDEDEEEEDDENGDSSEDGGDSSES--SSEDESEDGDENEEDDEDEDDDE 698

>hg18||uc002igd
        |17|NM_001076683|P17480-2|P17480-2|UBTF|NM_001076683|NP_001070151|upstr
        eam binding transcription factor, RNA

          Length = 727

 Score =  32 bits (72), Expect = 1.374
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 343 DEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEECNSQDSLGEE 402
           .|  .|.|  .   |.||  .  |  |.| | ||.   .|.. || |  | . .|   .|
Sbjct: 641 EEDDEEDEDDEDEDEEEEDDENGDSSEDGGDSSES--SSEDESEDGDENEEDDEDEDDDE 698

>hg18||uc003ygo
        |8|NM_015496|Q69YN4|Q69YN4_HUMAN|KIAA1429|NM_015496|NP_056311|hypotheti
        cal protein LOC25962 isoform 1

          Length = 1812

 Score =  32 bits (71), Expect = 1.794
 Identities = 22/75 (29%), Positives = 30/75 (40%), Gaps = 6/75 (8%)

Query: 317 EEGNRRPEDCSHAHSLHLDSTMNTFGDEASKENEKADRTREDEEVPDLNDVKEEGDDGSE 376
           |||    .|         |       |   .| |      ||||     | . ||||| |
Sbjct: 246 EEGEEDEDDVDVEEEEDEDEDDRRTVDSIPEEEE------EDEEEEGEEDEEGEGDDGYE 299

Query: 377 AVRINEEDFEDIDAE 391
            .  .|.   |.. |
Sbjct: 300 QISSDEDGIADLERE 314

>hg18||uc003ygp
        |8|NM_183009|Q8IXH4|Q8IXH4_HUMAN|KIAA1429|NM_183009|NP_892121|hypotheti
        cal protein LOC25962 isoform 2

          Length = 1147

 Score =  32 bits (71), Expect = 1.794
 Identities = 22/75 (29%), Positives = 30/75 (40%), Gaps = 6/75 (8%)

Query: 317 EEGNRRPEDCSHAHSLHLDSTMNTFGDEASKENEKADRTREDEEVPDLNDVKEEGDDGSE 376
           |||    .|         |       |   .| |      ||||     | . ||||| |
Sbjct: 246 EEGEEDEDDVDVEEEEDEDEDDRRTVDSIPEEEE------EDEEEEGEEDEEGEGDDGYE 299

Query: 377 AVRINEEDFEDIDAE 391
            .  .|.   |.. |
Sbjct: 300 QISSDEDGIADLERE 314

>hg18||uc004bvt |9|AM393022|Q01105|SET_HUMAN|SET|NA|NA|Protein SET (Phosphatase
        2A inhibitor I2PP2A) (I-2PP2A) (Template- activating factor I) (TAF-I)
        (HLA-DR-associated protein II) (PHAPII) (Inhibitor of granzyme
        A-activated DNase) (IGAAD)

          Length = 290

 Score =  32 bits (70), Expect = 2.343
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 5/50 (10%)

Query: 343 DEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEE 392
           |   .| |  .   .|||   | |. ||||.        ||| .| . ||
Sbjct: 237 DMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDE-----GEEDEDDDEGEE 281

>hg18||uc004bvu |9|NM_003011|Q01105-2|Q01105-2|SET|NM_003011|NP_003002|SET
        translocation (myeloid leukemia-associated)

          Length = 277

 Score =  32 bits (70), Expect = 2.343
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 5/50 (10%)

Query: 343 DEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEE 392
           |   .| |  .   .|||   | |. ||||.        ||| .| . ||
Sbjct: 224 DMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDE-----GEEDEDDDEGEE 268

>hg18||uc004dvy |X|AK127207|NA|NA|AK127207|NA|NA|Homo sapiens cDNA FLJ43772 fis,
        clone TESTI2049576

          Length = 206

 Score =  31 bits (69), Expect = 3.060
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 354 RTREDEEVPDLNDVKEEGDDGSEAV--RINEEDFEDIDAEECNSQDSLGEEPNGPLEL 409
           . .. ||   .||||||  .  | .  .. ||.  |   ||   .|   .|    .|.
Sbjct:  64 KAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEEDEDDEDDEEEDRMEV 121

>hg18||uc004dvz |X|AK125760|NA|NA|LAS1L|NM_031206|NP_112483|LAS1-like

          Length = 247

 Score =  31 bits (69), Expect = 3.060
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 354 RTREDEEVPDLNDVKEEGDDGSEAV--RINEEDFEDIDAEECNSQDSLGEEPNGPLEL 409
           . .. ||   .||||||  .  | .  .. ||.  |   ||   .|   .|    .|.
Sbjct:  64 KAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEEDEDDEDDEEEDRMEV 121

>hg18||uc004dwa
        |X|NM_031206|Q9Y4W2|LAS1L_HUMAN|LAS1L|NM_031206|NP_112483|LAS1-like

          Length = 734

 Score =  31 bits (69), Expect = 3.060
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 354 RTREDEEVPDLNDVKEEGDDGSEAV--RINEEDFEDIDAEECNSQDSLGEEPNGPLEL 409
           . .. ||   .||||||  .  | .  .. ||.  |   ||   .|   .|    .|.
Sbjct: 551 KAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEEDEDDEDDEEEDRMEV 608

>hg18||uc004dwc
        |X|BC018610|Q9Y4W2-2|Q9Y4W2-2|LAS1L|NM_031206|NP_112483|LAS1-like

          Length = 717

 Score =  31 bits (69), Expect = 3.060
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 354 RTREDEEVPDLNDVKEEGDDGSEAV--RINEEDFEDIDAEECNSQDSLGEEPNGPLEL 409
           . .. ||   .||||||  .  | .  .. ||.  |   ||   .|   .|    .|.
Sbjct: 534 KAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEEDEDDEDDEEEDRMEV 591

>hg18||uc004dwd
        |X|AK097383|Q9Y4W2-3|Q9Y4W2-3|LAS1L|NM_031206|NP_112483|LAS1-like

          Length = 675

 Score =  31 bits (69), Expect = 3.060
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 354 RTREDEEVPDLNDVKEEGDDGSEAV--RINEEDFEDIDAEECNSQDSLGEEPNGPLEL 409
           . .. ||   .||||||  .  | .  .. ||.  |   ||   .|   .|    .|.
Sbjct: 492 KAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEEDEDDEDDEEEDRMEV 549

>hg18||uc003dns
        |3|NM_198271|Q0VAK6|LMOD3_HUMAN|LMOD3|NM_198271|NP_938012|leiomodin 3
        (fetal)

          Length = 560

 Score =  30 bits (67), Expect = 5.219
 Identities = 19/69 (27%), Positives = 32/69 (46%)

Query: 316 HEEGNRRPEDCSHAHSLHLDSTMNTFGDEASKENEKADRTREDEEVPDLNDVKEEGDDGS 375
           |||  .| .. .      |.. .     |.   .   .   ||||  | .|  |  ||| 
Sbjct: 105 HEEIEKRNKNMAQYLKEKLNNEIVANKRESKGSSNIQETDEEDEEEEDDDDDDEGEDDGE 164

Query: 376 EAVRINEED 384
           |.   | |.
Sbjct: 165 ESEETNREE 173

>hg18||uc003dnt
        |3|BC039202|Q0VAK6|LMOD3_HUMAN|LMOD3|NM_198271|NP_938012|leiomodin 3
        (fetal)

          Length = 552

 Score =  30 bits (67), Expect = 5.219
 Identities = 19/69 (27%), Positives = 32/69 (46%)

Query: 316 HEEGNRRPEDCSHAHSLHLDSTMNTFGDEASKENEKADRTREDEEVPDLNDVKEEGDDGS 375
           |||  .| .. .      |.. .     |.   .   .   ||||  | .|  |  ||| 
Sbjct: 105 HEEIEKRNKNMAQYLKEKLNNEIVANKRESKGSSNIQETDEEDEEEEDDDDDDEGEDDGE 164

Query: 376 EAVRINEED 384
           |.   | |.
Sbjct: 165 ESEETNREE 173

>hg18||uc003hdx
        |4|NM_001031732|Q96MU7|YTDC1_HUMAN|YTHDC1|NM_001031732|NP_001026902|spl
        icing factor YT521-B isoform 1

          Length = 727

 Score =  30 bits (67), Expect = 5.219
 Identities = 24/106 (22%), Positives = 42/106 (39%), Gaps = 9/106 (8%)

Query: 299 SSIGSEASSTVQEAPGGHEEGNRRPEDCSHAHSLHLDSTMNTFGDEASKENEKADRTRED 358
           ||  |.     .|    || |.    |         .   ||  .|   | .  .    .
Sbjct: 166 SSQSSKEEVNSEEYGSDHETGSSGSSD---------EQGNNTENEEEGVEEDVEEDEEVE 216

Query: 359 EEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEECNSQDSLGEEPN 404
           |.  .  .| |.|..  |     ||. |. . |    .    || |
Sbjct: 217 EDAEEDEEVDEDGEEEEEEEEEEEEEEEEEEEEYEQDERDQKEEGN 262

>hg18||uc003hdy
        |4|NM_133370|Q96MU7-2|Q96MU7-2|YTHDC1|NM_133370|NP_588611|splicing
        factor YT521-B isoform 2

          Length = 709

 Score =  30 bits (67), Expect = 5.219
 Identities = 24/106 (22%), Positives = 42/106 (39%), Gaps = 9/106 (8%)

Query: 299 SSIGSEASSTVQEAPGGHEEGNRRPEDCSHAHSLHLDSTMNTFGDEASKENEKADRTRED 358
           ||  |.     .|    || |.    |         .   ||  .|   | .  .    .
Sbjct: 166 SSQSSKEEVNSEEYGSDHETGSSGSSD---------EQGNNTENEEEGVEEDVEEDEEVE 216

Query: 359 EEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEECNSQDSLGEEPN 404
           |.  .  .| |.|..  |     ||. |. . |    .    || |
Sbjct: 217 EDAEEDEEVDEDGEEEEEEEEEEEEEEEEEEEEYEQDERDQKEEGN 262

>hg18||uc003byf |3|NR_002223|Q17RH7|Q17RH7_HUMAN|TPRXL|NA|NA|TPRXL protein

          Length = 252

 Score =  30 bits (66), Expect = 6.817
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 6/70 (8%)

Query: 244 PDTSPSSPHPAPGFSMLSPFPPQMGGCLTKESGPADENLGLDTEHSAEEPSSELTSSIGS 303
           | .||||  |.   |  ||         .  | |.  .    .  |.   ||  .||  |
Sbjct:  65 PSSSPSSSSPSSSHSSSSP------SSSSSTSSPSSSSSSSSSSPSSSNSSSSSSSSSPS 118

Query: 304 EASSTVQEAP 313
            .||.   .|
Sbjct: 119 SSSSSSSSSP 128

>hg18||uc003byh |3|BC016304|Q17RH7|Q17RH7_HUMAN|TPRXL|NA|NA|TPRXL protein

          Length = 252

 Score =  30 bits (66), Expect = 6.817
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 6/70 (8%)

Query: 244 PDTSPSSPHPAPGFSMLSPFPPQMGGCLTKESGPADENLGLDTEHSAEEPSSELTSSIGS 303
           | .||||  |.   |  ||         .  | |.  .    .  |.   ||  .||  |
Sbjct:  65 PSSSPSSSSPSSSHSSSSP------SSSSSTSSPSSSSSSSSSSPSSSNSSSSSSSSSPS 118

Query: 304 EASSTVQEAP 313
            .||.   .|
Sbjct: 119 SSSSSSSSSP 128

>hg18||uc003ydx |8|NM_019098|Q9NQW8|CNGB3_HUMAN|CNGB3|NM_019098|NP_061971|cyclic
        nucleotide gated channel beta 3

          Length = 809

 Score =  30 bits (66), Expect = 6.817
 Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 342 GDEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEECN-SQDSLG 400
           |.|  ||||   .  ||..     . ...| .  .  .  | . . .|  ||  |  .. 
Sbjct: 709 GEEEGKENEDKQKENEDKQ----KENEDKGKENEDKDKGREPEEKPLDRPECTASPIAVE 764

Query: 401 EEPN 404
           |||.
Sbjct: 765 EEPH 768

>hg18||uc002poo |19|AB033031|Q9ULL5|PRR12_HUMAN|PRR12|NA|NA|Proline-rich protein
        12

          Length = 1191

 Score =  30 bits (65), Expect = 8.903
 Identities = 20/61 (32%), Positives = 24/61 (39%), Gaps = 1/61 (1%)

Query: 253 PAPGFSMLSPFPPQMGGCLTKESGPADENLGLDTEHSAEEPSSELTSSIGSEASSTVQEA 312
           | ||     |. |   |     .||    ||||     | ||.     .|   |   | |
Sbjct: 135 PPPGPPAYDPYGPYCPG-RASGAGPETPGLGLDPNKPPELPSTVNAEPLGLIQSGPHQAA 193

Query: 313 P 313
           |
Sbjct: 194 P 194

>hg18||uc002rkm |2|AB209197|Q59GB2|Q59GB2_HUMAN|PPM1G|NA|NA|Protein phosphatase
        1G variant (Fragment)

          Length = 327

 Score =  30 bits (65), Expect = 8.903
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 7/62 (11%)

Query: 341 FGDEASKENEKADRTREDEEVPDLNDVKEEGDDGSEAVRINEEDFEDIDAEECNSQDSLG 400
           | ...  |...|.   || |     .  || |  |     |||| || | ||    |   
Sbjct:  37 FFEDSEDESDEAEEEEEDSE-----ECSEEEDGYSSEEAENEED-ED-DTEEAEEDDEEE 89

Query: 401 EE 402
           ||
Sbjct:  90 EE 91

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,464,252
Number of Sequences: 45480
Number of Extensions: 194464252
Number of Successful Extensions: 11249806
Number of sequences better than 0.0: 0
BLASTP 7.6.0