BLASTP 7.6.0


Query=fugu4_550681 |jgi|Takru4|550681|e_gw2.139.91.1
        (410 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002kgh |17|NM_001004431|Q641Q3|Q641Q3_HUMAN|METRNL|NM_00...    308   1e-083
hg18||uc002kgi |17|BC050568|Q86VM0|Q86VM0_HUMAN|METRNL|NM_001004...    244   2e-064
hg18||uc002cjd |16|NM_024042|Q9UJH8|METRN_HUMAN|METRN|NM_024042|...    181   1e-045
hg18||uc002tuj |2|NM_012233|Q15042|RB3GP_HUMAN|RAB3GAP1|NM_01223...     30   5.019

>hg18||uc002kgh
        |17|NM_001004431|Q641Q3|Q641Q3_HUMAN|METRNL|NM_001004431|NP_001004431|m
        eteorin, glial cell differentiation

          Length = 311

 Score =  308 bits (788), Expect = 1e-083
 Identities = 147/261 (56%), Positives = 189/261 (72%), Gaps = 3/261 (1%)

Query:  22 QYSSDQCSWKGSGLMHEGHARDVEQVYLRCSQGSLEWLYPTGAIIVNLRPNILSPAAARL 81
           |||||.|||||||| || | ..||||||||. |..||.|||||.|||||||  || |  |
Sbjct:  46 QYSSDRCSWKGSGLTHEAHRKEVEQVYLRCAAGAVEWMYPTGALIVNLRPNTFSP-ARHL 104

Query:  82 SVCIKPAPDSRGTNVYLDRSGKLRLLLREQDQARGKVQCFGITEGALFIEAVPHMDISRR 141
           .|||.   || | |.||...|.||||. . |   |.|||||. .| ||.|| |  || ||
Sbjct: 105 TVCIRSFTDSSGANIYLEKTGELRLLVPDGDGRPGRVQCFGLEQGGLFVEATPQQDIGRR 164

Query: 142 TTAFQYELLSNRPGPDARSLGAPCQPCSDAEILLAVCTSDIVARGSITKV--EQEEEHSS 199
           || |||||.      |   | |||.|||| |.||||||||   |||| .|  | | . |.
Sbjct: 165 TTGFQYELVRRHRASDLHELSAPCRPCSDTEVLLAVCTSDFAVRGSIQQVTHEPERQDSA 224

Query: 200 ISVVLSRLYRQKTQIFTGGGVRVRSWTGSIKMPPQCRVRSGEGEFLFTGMVRFGEAWMGC 259
           | . .|||||||...|         | | ..   .| || | |.||||| . |||| .||
Sbjct: 225 IHLRVSRLYRQKSRVFEPVPEGDGHWQGRVRTLLECGVRPGHGDFLFTGHMHFGEARLGC 284

Query: 260 APRYKDFLRVYNEAQLQGTNP 280
           |||.||| |.| .|| .| ||
Sbjct: 285 APRFKDFQRMYRDAQERGLNP 305

>hg18||uc002kgi
        |17|BC050568|Q86VM0|Q86VM0_HUMAN|METRNL|NM_001004431|NP_001004431|meteo
        rin, glial cell differentiation

          Length = 229

 Score =  244 bits (622), Expect = 2e-064
 Identities = 120/224 (53%), Positives = 156/224 (69%), Gaps = 3/224 (1%)

Query:  59 LYPTGAIIVNLRPNILSPAAARLSVCIKPAPDSRGTNVYLDRSGKLRLLLREQDQARGKV 118
           .|||||.|||||||  || |  |.|||.   || | |.||...|.||||. . |   |.|
Sbjct:   1 MYPTGALIVNLRPNTFSP-ARHLTVCIRSFTDSSGANIYLEKTGELRLLVPDGDGRPGRV 59

Query: 119 QCFGITEGALFIEAVPHMDISRRTTAFQYELLSNRPGPDARSLGAPCQPCSDAEILLAVC 178
           ||||. .| ||.|| |  || |||| |||||.      |   | |||.|||| |.|||||
Sbjct:  60 QCFGLEQGGLFVEATPQQDIGRRTTGFQYELVRRHRASDLHELSAPCRPCSDTEVLLAVC 119

Query: 179 TSDIVARGSITKV--EQEEEHSSISVVLSRLYRQKTQIFTGGGVRVRSWTGSIKMPPQCR 236
           |||   |||| .|  | | . |.| . .|||||||...|         | | ..   .| 
Sbjct: 120 TSDFAVRGSIQQVTHEPERQDSAIHLRVSRLYRQKSRVFEPVPEGDGHWQGRVRTLLECG 179

Query: 237 VRSGEGEFLFTGMVRFGEAWMGCAPRYKDFLRVYNEAQLQGTNP 280
           || | |.||||| . |||| .|||||.||| |.| .|| .| ||
Sbjct: 180 VRPGHGDFLFTGHMHFGEARLGCAPRFKDFQRMYRDAQERGLNP 223

>hg18||uc002cjd
        |16|NM_024042|Q9UJH8|METRN_HUMAN|METRN|NM_024042|NP_076947|meteorin,
        glial cell differentiation regulator

          Length = 293

 Score =  181 bits (459), Expect = 1e-045
 Identities = 117/273 (42%), Positives = 157/273 (57%), Gaps = 15/273 (5%)

Query:  23 YSSDQCSWKGSGLMHEGHARDVEQVYLRCSQGSLEWLYPTGAIIVNLRPNILSPAAARLS 82
           || ..|||.||||  |     | |. | |..|..||||| ||. . |      | |    
Sbjct:  25 YSEERCSWRGSGLTQE--PGSVGQLALACAEGAVEWLYPAGALRLTLGGP--DPRARPGI 80

Query:  83 VCIKPAPDSRGTNVYLDRS-GKLRLLLRE-QDQARGKVQCFGITE-GALFIEAVPHMDIS 139
            |..|     |  |. .|. | | ||| |    | |.   .|  |  |||..| || |||
Sbjct:  81 ACLRPVRPFAGAQVFAERAGGALELLLAEGPGPAGGRCVRWGPRERRALFLQATPHQDIS 140

Query: 140 RRTTAFQYELLSN-RP--GPDARSLG--APCQPCSDAEILLAVCTSDIVARGSITKV--E 192
           ||  ||..||  . ||   | |  ||    |.||||||.||| |||| |  | |  |  .
Sbjct: 141 RRVAAFRFELREDGRPELPPQAHGLGVDGACRPCSDAELLLAACTSDFVIHGIIHGVTHD 200

Query: 193 QEEEHSSISVVLSRLYRQKTQIFTGGGVRVRSWTGSIKMPPQCRVRSGEGEFLFTGMVRF 252
            | . | |.|| .|. ||   .|  |    .  | ||. | .| |  | | ||| |  ||
Sbjct: 201 VELQESVITVVAARVLRQTPPLFQAGRSGDQGLT-SIRTPLRCGVHPGPGTFLFMGWSRF 259

Query: 253 GEAWMGCAPRYKDFLRVYNEAQLQGTNPFSLRL 285
           ||| .|||||...| | |  |.    .|  . |
Sbjct: 260 GEARLGCAPRFQEFRRAYEAARAAHLHPCEVAL 292

>hg18||uc002tuj
        |2|NM_012233|Q15042|RB3GP_HUMAN|RAB3GAP1|NM_012233|NP_036365|RAB3
        GTPase-activating protein

          Length = 981

 Score =  30 bits (66), Expect = 5.019
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 154 PGPDARSLGAPCQPCSDAEILLAVCTSDIVARGSITKVEQEEEHSSISVVLSRLYRQKTQ 213
           | |. . |       .. | |.|   | . |.    | |||||   .   .| |  |   
Sbjct: 822 PNPEDKKLEEIIHQITNVEALIARARS-LKAKFGTEKCEQEEEKEDLERFVSCLLEQPEV 880

Query: 214 IFTGGG 219
           . || |
Sbjct: 881 LVTGAG 886

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,464,252
Number of Sequences: 45480
Number of Extensions: 194464252
Number of Successful Extensions: 11249806
Number of sequences better than 0.0: 0
BLASTP 7.6.0