BLASTP 7.6.0


Query=fugu4_550620 |jgi|Takru4|550620|e_gw2.139.78.1
        (519 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002jyz |17|BC032559|Q9UQB8-3|Q9UQB8-3|BAIAP2|NM_006340|N...    642   5e-184
hg18||uc002jza |17|NM_017450|Q9UQB8-4|Q9UQB8-4|BAIAP2|NM_017450|...    642   5e-184
hg18||uc002jzd |17|NM_006340|Q9UQB8-5|Q9UQB8-5|BAIAP2|NM_006340|...    642   5e-184
hg18||uc002jzf |17|BC002495|Q9UQB8-2|Q9UQB8-2|BAIAP2|NM_006340|N...    642   5e-184
hg18||uc002jzg |17|NM_017451|Q9UQB8|BAIP2_HUMAN|BAIAP2|NM_017451...    642   5e-184
hg18||uc002jzc |17|DQ896329|Q9UQB8-6|Q9UQB8-6|BAIAP2|NM_017450|N...    638   7e-183
hg18||uc002jze |17|BC014043|Q9UQB8-5|Q9UQB8-5|BAIAP2|NM_006340|N...    617   1e-176
hg18||uc002jzh |17|AK056888|NA|NA|BAIAP2|NA|NA|Homo sapiens mRNA...    485   6e-137
hg18||uc002jzb |17|AK023688|NA|NA|BAIAP2|NA|NA|Homo sapiens mRNA...    271   2e-072
hg18||uc003upj |7|NM_018842|Q9UHR4|BI2L1_HUMAN|BAIAP2L1|NM_01884...    252   1e-066
hg18||uc003upj |7|NM_018842|Q9UHR4|BI2L1_HUMAN|BAIAP2L1|NM_01884...    114   5e-025
hg18||uc003auw |22|NM_025045|Q6UXY1|BI2L2_HUMAN|BAIAP2L2|NM_0250...    106   1e-022
hg18||uc003auw |22|NM_025045|Q6UXY1|BI2L2_HUMAN|BAIAP2L2|NM_0250...     73   9e-013
hg18||uc002gmg |17|NM_201433|Q7Z571|Q7Z571_HUMAN|GAS7|NM_201433|...     43   0.001
hg18||uc002rfe |2|NM_006277|Q9NZM3|ITSN2_HUMAN|ITSN2|NM_006277|N...     43   0.001
hg18||uc002rff |2|NM_019595|Q9NZM3-2|Q9NZM3-2|ITSN2|NM_019595|NP...     43   0.001
hg18||uc002rfg |2|NM_147152|Q9NZM3-3|Q9NZM3-3|ITSN2|NM_147152|NP...     43   0.001
hg18||uc002rfe |2|NM_006277|Q9NZM3|ITSN2_HUMAN|ITSN2|NM_006277|N...     38   0.032
hg18||uc002rff |2|NM_019595|Q9NZM3-2|Q9NZM3-2|ITSN2|NM_019595|NP...     38   0.032
hg18||uc002rfg |2|NM_147152|Q9NZM3-3|Q9NZM3-3|ITSN2|NM_147152|NP...     38   0.032
hg18||uc002mfu |19|NM_005428|P15498|VAV_HUMAN|VAV1|NM_005428|NP_...     37   0.055
hg18||uc002mfv |19|BC013361|Q96D37|Q96D37_HUMAN|VAV1|NM_005428|N...     37   0.055
hg18||uc003ayu |22|NM_015705|Q96HU1|Q96HU1_HUMAN|RUTBC3|NM_01570...     37   0.055
hg18||uc002vts |2|NM_019850|Q8N5V2|NGEF_HUMAN|NGEF|NM_019850|NP_...     36   0.094
hg18||uc001akg |1|AK095984|Q5VV41|ARHGG_HUMAN|ARHGEF16|NA|NA|Rho...     35   0.210
hg18||uc001akh |1|NM_014448|Q5VV41-2|Q5VV41-2|ARHGEF16|NM_014448...     35   0.210
hg18||uc001aki |1|BC051838|Q5VV41-2|Q5VV41-2|ARHGEF16|NM_014448|...     35   0.210
hg18||uc001akj |1|D89016|Q5VV41-2|Q5VV41-2|ARHGEF16|NM_014448|NP...     35   0.210
hg18||uc002rfe |2|NM_006277|Q9NZM3|ITSN2_HUMAN|ITSN2|NM_006277|N...     34   0.358
hg18||uc002rff |2|NM_019595|Q9NZM3-2|Q9NZM3-2|ITSN2|NM_019595|NP...     34   0.358
hg18||uc002rfg |2|NM_147152|Q9NZM3-3|Q9NZM3-3|ITSN2|NM_147152|NP...     34   0.358
hg18||uc003ezv |3|NM_015595|NA|NA|SGEF|NM_015595|NP_056410|Src h...     33   0.611
hg18||uc003ezx |3|AF415176|NA|NA|SGEF|NA|NA|Homo sapiens putativ...     33   0.611
hg18||uc002jze |17|BC014043|Q9UQB8-5|Q9UQB8-5|BAIAP2|NM_006340|N...     32   1.360
hg18||uc002qzh |2|NM_003887|O43150|DDEF2_HUMAN|DDEF2|NM_003887|N...     32   1.360
hg18||uc002qzi |2|BC063308|O43150-2|O43150-2|DDEF2|NM_003887|NP_...     32   1.360
hg18||uc003wel |7|NM_005435|Q6ZML7|Q6ZML7_HUMAN|ARHGEF5|NM_00543...     32   1.360
hg18||uc003wem |7|AX746515|Q12774|ARHG5_HUMAN|ARHGEF5|NA|NA|Rho ...     32   1.360
hg18||uc002jor |17|AF418293|NA|NA|KIAA1783|NA|NA|Homo sapiens mR...     30   5.170
hg18||uc003kkr |5|CR936768|NA|NA|DKFZp564C0469|NA|NA|Homo sapien...     30   5.170
hg18||uc003kks |5|BC063674|Q9BQI6|ANR32_HUMAN|ANKRD32|NM_032290|...     30   5.170
hg18||uc003kkt |5|NM_032290|Q9BQI6|ANR32_HUMAN|ANKRD32|NM_032290...     30   5.170

>hg18||uc002jyz
        |17|BC032559|Q9UQB8-3|Q9UQB8-3|BAIAP2|NM_006340|NP_006331|BAI1-associat
        ed protein 2 isoform 3

          Length = 512

 Score =  642 bits (1654), Expect = 5e-184
 Identities = 327/508 (64%), Positives = 394/508 (77%), Gaps = 19/508 (3%)

Query:   8 TMSRTDEVNRLTENVYKTIMEQFNPCLRNFVAMGKNYEKALASVTFAAKGYFDALVRMGE 67
           ..||..|..|||||||||||||||| ||||.||||||||||| ||.||||||||||.|||
Sbjct:   2 SLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGE 61

Query:  68 LASESQGSKDLGDVLFQMAEVHRQIQVQLEEMLKSFHNXXXXXXXXXXXXDARYLTAALK 127
           |||||||||.|||||||||||||||| |||||||||||            |.|||.||||
Sbjct:  62 LASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALK 121

Query: 128 KYQVEHKSKGESLEKCQAELKKLRRKSQGSKNPSKYGEKEMQFVETISSKQTELDTFIAE 187
           ||| | .|||..|.||||||||||.|||||||| || .||.|... ||.|| ||. ....
Sbjct: 122 KYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSD 181

Query: 188 GYKTALSEERRRYCFLVDRQCAVAKNSSAYHGKGKDLLTQKIPVWQQACSDPNKLPERAM 247
           ||||||.|||||.||||..||||||||.||| |||.|| ||.|.|||||.||.|.||||.
Sbjct: 182 GYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAV 241

Query: 248 LLAQQMGSAAIAGTSPLHTSKSNLVISDPIPGATPLPVPPELAVFMGSGLGHPSRLIGPD 307
            | ||. |      | |  |||||||||||||| ||||||||| |.|       |.   .
Sbjct: 242 QLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVG-------RMSAQE 294

Query: 308 GMSMVNGTTGVHGEEY--WTDGGTLSQVRPSSXXXXXXXXXXXXXXVSDVYSNTLPVRRP 365
              ..|| ||  ||.|  | |       .| |              .|| ||||||||. 
Sbjct: 295 STPIMNGVTGPDGEDYSPWAD---RKAAQPKS-----LSPPQSQSKLSDSYSNTLPVRKS 346

Query: 366 APAKNKNPVGETRTLPRSSSMAAGLEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLV 425
              ||     | .|||||||||||||.||| ||.|||||||||| ||||| |||.|||||
Sbjct: 347 VTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLV 406

Query: 426 PEARDGWHYGENEKNKMRGWFPFSYTRVLPESDSEKLKVNLHHGKSSSTGNLLENDG-SL 484
           |||||||||||.|| ||||||||||||||    |..| ..|  ||||||||||. |  ..
Sbjct: 407 PEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAI 466

Query: 485 PTPDYGLTARLL-AQSLAQTRPRPYSMA 511
           | ||||  .|   ||. .  . ||||.|
Sbjct: 467 PPPDYGAASRAFPAQTASGFKQRPYSVA 494

>hg18||uc002jza
        |17|NM_017450|Q9UQB8-4|Q9UQB8-4|BAIAP2|NM_017450|NP_059344|BAI1-associa
        ted protein 2 isoform 1

          Length = 521

 Score =  642 bits (1654), Expect = 5e-184
 Identities = 327/508 (64%), Positives = 394/508 (77%), Gaps = 19/508 (3%)

Query:   8 TMSRTDEVNRLTENVYKTIMEQFNPCLRNFVAMGKNYEKALASVTFAAKGYFDALVRMGE 67
           ..||..|..|||||||||||||||| ||||.||||||||||| ||.||||||||||.|||
Sbjct:   2 SLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGE 61

Query:  68 LASESQGSKDLGDVLFQMAEVHRQIQVQLEEMLKSFHNXXXXXXXXXXXXDARYLTAALK 127
           |||||||||.|||||||||||||||| |||||||||||            |.|||.||||
Sbjct:  62 LASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALK 121

Query: 128 KYQVEHKSKGESLEKCQAELKKLRRKSQGSKNPSKYGEKEMQFVETISSKQTELDTFIAE 187
           ||| | .|||..|.||||||||||.|||||||| || .||.|... ||.|| ||. ....
Sbjct: 122 KYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSD 181

Query: 188 GYKTALSEERRRYCFLVDRQCAVAKNSSAYHGKGKDLLTQKIPVWQQACSDPNKLPERAM 247
           ||||||.|||||.||||..||||||||.||| |||.|| ||.|.|||||.||.|.||||.
Sbjct: 182 GYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAV 241

Query: 248 LLAQQMGSAAIAGTSPLHTSKSNLVISDPIPGATPLPVPPELAVFMGSGLGHPSRLIGPD 307
            | ||. |      | |  |||||||||||||| ||||||||| |.|       |.   .
Sbjct: 242 QLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVG-------RMSAQE 294

Query: 308 GMSMVNGTTGVHGEEY--WTDGGTLSQVRPSSXXXXXXXXXXXXXXVSDVYSNTLPVRRP 365
              ..|| ||  ||.|  | |       .| |              .|| ||||||||. 
Sbjct: 295 STPIMNGVTGPDGEDYSPWAD---RKAAQPKS-----LSPPQSQSKLSDSYSNTLPVRKS 346

Query: 366 APAKNKNPVGETRTLPRSSSMAAGLEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLV 425
              ||     | .|||||||||||||.||| ||.|||||||||| ||||| |||.|||||
Sbjct: 347 VTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLV 406

Query: 426 PEARDGWHYGENEKNKMRGWFPFSYTRVLPESDSEKLKVNLHHGKSSSTGNLLENDG-SL 484
           |||||||||||.|| ||||||||||||||    |..| ..|  ||||||||||. |  ..
Sbjct: 407 PEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAI 466

Query: 485 PTPDYGLTARLL-AQSLAQTRPRPYSMA 511
           | ||||  .|   ||. .  . ||||.|
Sbjct: 467 PPPDYGAASRAFPAQTASGFKQRPYSVA 494

>hg18||uc002jzd
        |17|NM_006340|Q9UQB8-5|Q9UQB8-5|BAIAP2|NM_006340|NP_006331|BAI1-associa
        ted protein 2 isoform 3

          Length = 520

 Score =  642 bits (1654), Expect = 5e-184
 Identities = 327/508 (64%), Positives = 394/508 (77%), Gaps = 19/508 (3%)

Query:   8 TMSRTDEVNRLTENVYKTIMEQFNPCLRNFVAMGKNYEKALASVTFAAKGYFDALVRMGE 67
           ..||..|..|||||||||||||||| ||||.||||||||||| ||.||||||||||.|||
Sbjct:   2 SLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGE 61

Query:  68 LASESQGSKDLGDVLFQMAEVHRQIQVQLEEMLKSFHNXXXXXXXXXXXXDARYLTAALK 127
           |||||||||.|||||||||||||||| |||||||||||            |.|||.||||
Sbjct:  62 LASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALK 121

Query: 128 KYQVEHKSKGESLEKCQAELKKLRRKSQGSKNPSKYGEKEMQFVETISSKQTELDTFIAE 187
           ||| | .|||..|.||||||||||.|||||||| || .||.|... ||.|| ||. ....
Sbjct: 122 KYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSD 181

Query: 188 GYKTALSEERRRYCFLVDRQCAVAKNSSAYHGKGKDLLTQKIPVWQQACSDPNKLPERAM 247
           ||||||.|||||.||||..||||||||.||| |||.|| ||.|.|||||.||.|.||||.
Sbjct: 182 GYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAV 241

Query: 248 LLAQQMGSAAIAGTSPLHTSKSNLVISDPIPGATPLPVPPELAVFMGSGLGHPSRLIGPD 307
            | ||. |      | |  |||||||||||||| ||||||||| |.|       |.   .
Sbjct: 242 QLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVG-------RMSAQE 294

Query: 308 GMSMVNGTTGVHGEEY--WTDGGTLSQVRPSSXXXXXXXXXXXXXXVSDVYSNTLPVRRP 365
              ..|| ||  ||.|  | |       .| |              .|| ||||||||. 
Sbjct: 295 STPIMNGVTGPDGEDYSPWAD---RKAAQPKS-----LSPPQSQSKLSDSYSNTLPVRKS 346

Query: 366 APAKNKNPVGETRTLPRSSSMAAGLEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLV 425
              ||     | .|||||||||||||.||| ||.|||||||||| ||||| |||.|||||
Sbjct: 347 VTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLV 406

Query: 426 PEARDGWHYGENEKNKMRGWFPFSYTRVLPESDSEKLKVNLHHGKSSSTGNLLENDG-SL 484
           |||||||||||.|| ||||||||||||||    |..| ..|  ||||||||||. |  ..
Sbjct: 407 PEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAI 466

Query: 485 PTPDYGLTARLL-AQSLAQTRPRPYSMA 511
           | ||||  .|   ||. .  . ||||.|
Sbjct: 467 PPPDYGAASRAFPAQTASGFKQRPYSVA 494

>hg18||uc002jzf
        |17|BC002495|Q9UQB8-2|Q9UQB8-2|BAIAP2|NM_006340|NP_006331|BAI1-associat
        ed protein 2 isoform 3

          Length = 534

 Score =  642 bits (1654), Expect = 5e-184
 Identities = 327/508 (64%), Positives = 394/508 (77%), Gaps = 19/508 (3%)

Query:   8 TMSRTDEVNRLTENVYKTIMEQFNPCLRNFVAMGKNYEKALASVTFAAKGYFDALVRMGE 67
           ..||..|..|||||||||||||||| ||||.||||||||||| ||.||||||||||.|||
Sbjct:   2 SLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGE 61

Query:  68 LASESQGSKDLGDVLFQMAEVHRQIQVQLEEMLKSFHNXXXXXXXXXXXXDARYLTAALK 127
           |||||||||.|||||||||||||||| |||||||||||            |.|||.||||
Sbjct:  62 LASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALK 121

Query: 128 KYQVEHKSKGESLEKCQAELKKLRRKSQGSKNPSKYGEKEMQFVETISSKQTELDTFIAE 187
           ||| | .|||..|.||||||||||.|||||||| || .||.|... ||.|| ||. ....
Sbjct: 122 KYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSD 181

Query: 188 GYKTALSEERRRYCFLVDRQCAVAKNSSAYHGKGKDLLTQKIPVWQQACSDPNKLPERAM 247
           ||||||.|||||.||||..||||||||.||| |||.|| ||.|.|||||.||.|.||||.
Sbjct: 182 GYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAV 241

Query: 248 LLAQQMGSAAIAGTSPLHTSKSNLVISDPIPGATPLPVPPELAVFMGSGLGHPSRLIGPD 307
            | ||. |      | |  |||||||||||||| ||||||||| |.|       |.   .
Sbjct: 242 QLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVG-------RMSAQE 294

Query: 308 GMSMVNGTTGVHGEEY--WTDGGTLSQVRPSSXXXXXXXXXXXXXXVSDVYSNTLPVRRP 365
              ..|| ||  ||.|  | |       .| |              .|| ||||||||. 
Sbjct: 295 STPIMNGVTGPDGEDYSPWAD---RKAAQPKS-----LSPPQSQSKLSDSYSNTLPVRKS 346

Query: 366 APAKNKNPVGETRTLPRSSSMAAGLEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLV 425
              ||     | .|||||||||||||.||| ||.|||||||||| ||||| |||.|||||
Sbjct: 347 VTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLV 406

Query: 426 PEARDGWHYGENEKNKMRGWFPFSYTRVLPESDSEKLKVNLHHGKSSSTGNLLENDG-SL 484
           |||||||||||.|| ||||||||||||||    |..| ..|  ||||||||||. |  ..
Sbjct: 407 PEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAI 466

Query: 485 PTPDYGLTARLL-AQSLAQTRPRPYSMA 511
           | ||||  .|   ||. .  . ||||.|
Sbjct: 467 PPPDYGAASRAFPAQTASGFKQRPYSVA 494

>hg18||uc002jzg
        |17|NM_017451|Q9UQB8|BAIP2_HUMAN|BAIAP2|NM_017451|NP_059345|BAI1-associ
        ated protein 2 isoform 2

          Length = 552

 Score =  642 bits (1654), Expect = 5e-184
 Identities = 327/508 (64%), Positives = 394/508 (77%), Gaps = 19/508 (3%)

Query:   8 TMSRTDEVNRLTENVYKTIMEQFNPCLRNFVAMGKNYEKALASVTFAAKGYFDALVRMGE 67
           ..||..|..|||||||||||||||| ||||.||||||||||| ||.||||||||||.|||
Sbjct:   2 SLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGE 61

Query:  68 LASESQGSKDLGDVLFQMAEVHRQIQVQLEEMLKSFHNXXXXXXXXXXXXDARYLTAALK 127
           |||||||||.|||||||||||||||| |||||||||||            |.|||.||||
Sbjct:  62 LASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALK 121

Query: 128 KYQVEHKSKGESLEKCQAELKKLRRKSQGSKNPSKYGEKEMQFVETISSKQTELDTFIAE 187
           ||| | .|||..|.||||||||||.|||||||| || .||.|... ||.|| ||. ....
Sbjct: 122 KYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSD 181

Query: 188 GYKTALSEERRRYCFLVDRQCAVAKNSSAYHGKGKDLLTQKIPVWQQACSDPNKLPERAM 247
           ||||||.|||||.||||..||||||||.||| |||.|| ||.|.|||||.||.|.||||.
Sbjct: 182 GYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAV 241

Query: 248 LLAQQMGSAAIAGTSPLHTSKSNLVISDPIPGATPLPVPPELAVFMGSGLGHPSRLIGPD 307
            | ||. |      | |  |||||||||||||| ||||||||| |.|       |.   .
Sbjct: 242 QLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVG-------RMSAQE 294

Query: 308 GMSMVNGTTGVHGEEY--WTDGGTLSQVRPSSXXXXXXXXXXXXXXVSDVYSNTLPVRRP 365
              ..|| ||  ||.|  | |       .| |              .|| ||||||||. 
Sbjct: 295 STPIMNGVTGPDGEDYSPWAD---RKAAQPKS-----LSPPQSQSKLSDSYSNTLPVRKS 346

Query: 366 APAKNKNPVGETRTLPRSSSMAAGLEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLV 425
              ||     | .|||||||||||||.||| ||.|||||||||| ||||| |||.|||||
Sbjct: 347 VTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLV 406

Query: 426 PEARDGWHYGENEKNKMRGWFPFSYTRVLPESDSEKLKVNLHHGKSSSTGNLLENDG-SL 484
           |||||||||||.|| ||||||||||||||    |..| ..|  ||||||||||. |  ..
Sbjct: 407 PEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAI 466

Query: 485 PTPDYGLTARLL-AQSLAQTRPRPYSMA 511
           | ||||  .|   ||. .  . ||||.|
Sbjct: 467 PPPDYGAASRAFPAQTASGFKQRPYSVA 494

>hg18||uc002jzc
        |17|DQ896329|Q9UQB8-6|Q9UQB8-6|BAIAP2|NM_017450|NP_059344|BAI1-associat
        ed protein 2 isoform 1

          Length = 522

 Score =  638 bits (1644), Expect = 7e-183
 Identities = 327/509 (64%), Positives = 394/509 (77%), Gaps = 20/509 (3%)

Query:   8 TMSRTDEVNRLTENVYKTIMEQFNPCLRNFVAMGKNYEKALASVTFAAKGYFDALVRMGE 67
           ..||..|..|||||||||||||||| ||||.||||||||||| ||.||||||||||.|||
Sbjct:   2 SLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGE 61

Query:  68 LASESQGSKDLGDVLFQMAEVHRQIQVQLEEMLKSFHNXXXXXXXXXXXXDARYLTAALK 127
           |||||||||.|||||||||||||||| |||||||||||            |.|||.||||
Sbjct:  62 LASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALK 121

Query: 128 KYQVEHKSKGESLEKCQAELKKLRRKSQGSKNPSKYGEKEMQFVETISSKQTELDTFIAE 187
           ||| | .|||..|.||||||||||.|||||||| || .||.|... ||.|| ||. ....
Sbjct: 122 KYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSD 181

Query: 188 GYKTALSEERRRYCFLVDRQCAVAKNSSAYHGKGKDLLTQKIPVWQQACSDPNKLPERAM 247
           ||||||.|||||.||||..||||||||.||| |||.|| ||.|.|||||.||.|.||||.
Sbjct: 182 GYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAV 241

Query: 248 LLAQQMGSAAIAGTSPLHTSKSNLVISDPIPGATPLPVPPELAVFMGSGLGHPSRLIGPD 307
            | ||. |      | |  |||||||||||||| ||||||||| |.|       |.   .
Sbjct: 242 QLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVG-------RMSAQE 294

Query: 308 GMSMVNGTTGVHGEEY--WTDGGTLSQVRPSSXXXXXXXXXXXXXXVSDVYSNTLPVRRP 365
              ..|| ||  ||.|  | |       .| |              .|| ||||||||. 
Sbjct: 295 STPIMNGVTGPDGEDYSPWAD---RKAAQPKS-----LSPPQSQSKLSDSYSNTLPVRKS 346

Query: 366 APAKNK-NPVGETRTLPRSSSMAAGLEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLL 424
              ||      | .|||||||||||||.||| ||.|||||||||| ||||| |||.||||
Sbjct: 347 VTPKNSYATTAENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLL 406

Query: 425 VPEARDGWHYGENEKNKMRGWFPFSYTRVLPESDSEKLKVNLHHGKSSSTGNLLENDG-S 483
           ||||||||||||.|| ||||||||||||||    |..| ..|  ||||||||||. |  .
Sbjct: 407 VPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLA 466

Query: 484 LPTPDYGLTARLL-AQSLAQTRPRPYSMA 511
           .| ||||  .|   ||. .  . ||||.|
Sbjct: 467 IPPPDYGAASRAFPAQTASGFKQRPYSVA 495

>hg18||uc002jze
        |17|BC014043|Q9UQB8-5|Q9UQB8-5|BAIAP2|NM_006340|NP_006331|BAI1-associat
        ed protein 2 isoform 3

          Length = 553

 Score =  617 bits (1591), Expect = 1e-176
 Identities = 316/491 (64%), Positives = 377/491 (76%), Gaps = 19/491 (3%)

Query:  25 TIMEQFNPCLRNFVAMGKNYEKALASVTFAAKGYFDALVRMGELASESQGSKDLGDVLFQ 84
           |||||||| ||||.||||||||||| ||.||||||||||.||||||||||||.|||||||
Sbjct:  52 TIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQ 111

Query:  85 MAEVHRQIQVQLEEMLKSFHNXXXXXXXXXXXXDARYLTAALKKYQVEHKSKGESLEKCQ 144
           ||||||||| |||||||||||            |.|||.||||||| | .|||..|.|||
Sbjct: 112 MAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQ 171

Query: 145 AELKKLRRKSQGSKNPSKYGEKEMQFVETISSKQTELDTFIAEGYKTALSEERRRYCFLV 204
           |||||||.|||||||| || .||.|... ||.|| ||. ....||||||.|||||.||||
Sbjct: 172 AELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLV 231

Query: 205 DRQCAVAKNSSAYHGKGKDLLTQKIPVWQQACSDPNKLPERAMLLAQQMGSAAIAGTSPL 264
           ..||||||||.||| |||.|| ||.|.|||||.||.|.||||. | ||. |      | |
Sbjct: 232 EKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSAL 291

Query: 265 HTSKSNLVISDPIPGATPLPVPPELAVFMGSGLGHPSRLIGPDGMSMVNGTTGVHGEEY- 323
             |||||||||||||| ||||||||| |.|       |.   .   ..|| ||  ||.| 
Sbjct: 292 SASKSNLVISDPIPGAKPLPVPPELAPFVG-------RMSAQESTPIMNGVTGPDGEDYS 344

Query: 324 -WTDGGTLSQVRPSSXXXXXXXXXXXXXXVSDVYSNTLPVRRPAPAKNKNPVGETRTLPR 382
            | |       .| |              .|| ||||||||.    ||     | .||||
Sbjct: 345 PWAD---RKAAQPKS-----LSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPR 396

Query: 383 SSSMAAGLEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENEKNKM 442
           |||||||||.||| ||.|||||||||| ||||| |||.||||||||||||||||.|| ||
Sbjct: 397 SSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKM 456

Query: 443 RGWFPFSYTRVLPESDSEKLKVNLHHGKSSSTGNLLENDG-SLPTPDYGLTARLL-AQSL 500
           ||||||||||||    |..| ..|  ||||||||||. |  ..| ||||  .|   ||. 
Sbjct: 457 RGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTA 516

Query: 501 AQTRPRPYSMA 511
           .  . ||||.|
Sbjct: 517 SGFKQRPYSVA 527

>hg18||uc002jzh |17|AK056888|NA|NA|BAIAP2|NA|NA|Homo sapiens mRNA for BAP2-alpha
        protein, complete cds

          Length = 521

 Score =  485 bits (1248), Expect = 6e-137
 Identities = 249/420 (59%), Positives = 306/420 (72%), Gaps = 19/420 (4%)

Query:  96 LEEMLKSFHNXXXXXXXXXXXXDARYLTAALKKYQVEHKSKGESLEKCQAELKKLRRKSQ 155
           |   ||||||            |.|||.||||||| | .|||..|.||||||||||.|||
Sbjct:  91 LHVQLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQ 150

Query: 156 GSKNPSKYGEKEMQFVETISSKQTELDTFIAEGYKTALSEERRRYCFLVDRQCAVAKNSS 215
           ||||| || .||.|... ||.|| ||. ....||||||.|||||.||||..||||||||.
Sbjct: 151 GSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSA 210

Query: 216 AYHGKGKDLLTQKIPVWQQACSDPNKLPERAMLLAQQMGSAAIAGTSPLHTSKSNLVISD 275
           ||| |||.|| ||.|.|||||.||.|.||||. | ||. |      | |  |||||||||
Sbjct: 211 AYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISD 270

Query: 276 PIPGATPLPVPPELAVFMGSGLGHPSRLIGPDGMSMVNGTTGVHGEEY--WTDGGTLSQV 333
           ||||| ||||||||| |.|       |.   .   ..|| ||  ||.|  | |       
Sbjct: 271 PIPGAKPLPVPPELAPFVG-------RMSAQESTPIMNGVTGPDGEDYSPWAD---RKAA 320

Query: 334 RPSSXXXXXXXXXXXXXXVSDVYSNTLPVRRPAPAKNKNPVGETRTLPRSSSMAAGLEKN 393
           .| |              .|| ||||||||.    ||     | .|||||||||||||.|
Sbjct: 321 QPKS-----LSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERN 375

Query: 394 GRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYTRV 453
           || ||.|||||||||| ||||| |||.||||||||||||||||.|| |||||||||||||
Sbjct: 376 GRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRV 435

Query: 454 LPESDSEKLKVNLHHGKSSSTGNLLENDG-SLPTPDYGLTARLL-AQSLAQTRPRPYSMA 511
           |    |..| ..|  ||||||||||. |  ..| ||||  .|   ||. .  . ||||.|
Sbjct: 436 LDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVA 495

>hg18||uc002jzb |17|AK023688|NA|NA|BAIAP2|NA|NA|Homo sapiens mRNA for BAP2-alpha
        protein, complete cds

          Length = 278

 Score =  271 bits (691), Expect = 2e-072
 Identities = 150/265 (56%), Positives = 177/265 (66%), Gaps = 19/265 (7%)

Query: 251 QQMGSAAIAGTSPLHTSKSNLVISDPIPGATPLPVPPELAVFMGSGLGHPSRLIGPDGMS 310
           ||. |      | |  |||||||||||||| ||||||||| |.|       |.   .   
Sbjct:   2 QQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVG-------RMSAQESTP 54

Query: 311 MVNGTTGVHGEEY--WTDGGTLSQVRPSSXXXXXXXXXXXXXXVSDVYSNTLPVRRPAPA 368
           ..|| ||  ||.|  | |       .| |              .|| ||||||||.    
Sbjct:  55 IMNGVTGPDGEDYSPWAD---RKAAQPKS-----LSPPQSQSKLSDSYSNTLPVRKSVTP 106

Query: 369 KNKNPVGETRTLPRSSSMAAGLEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVPEA 428
           ||     | .|||||||||||||.||| ||.|||||||||| ||||| |||.||||||||
Sbjct: 107 KNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEA 166

Query: 429 RDGWHYGENEKNKMRGWFPFSYTRVLPESDSEKLKVNLHHGKSSSTGNLLENDG-SLPTP 487
           ||||||||.|| ||||||||||||||    |..| ..|  ||||||||||. |  ..| |
Sbjct: 167 RDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPP 226

Query: 488 DYGLTARLL-AQSLAQTRPRPYSMA 511
           |||  .|   ||. .  . ||||.|
Sbjct: 227 DYGAASRAFPAQTASGFKQRPYSVA 251

>hg18||uc003upj
        |7|NM_018842|Q9UHR4|BI2L1_HUMAN|BAIAP2L1|NM_018842|NP_061330|BAI1-assoc
        iated protein 2-like 1

          Length = 511

 Score =  252 bits (642), Expect = 1e-066
 Identities = 127/274 (46%), Positives = 184/274 (67%), Gaps = 8/274 (2%)

Query:   9 MSR-TDEVNRLTENVYKTIMEQFNPCLRNFVAMGKNYEKALASVTFAAKGYFDALVRMGE 67
           |||  .|||||||. |. .|||||| ||| . .|||||||. ..  | | |.| . ..||
Sbjct:   1 MSRGPEEVNRLTESTYRNVMEQFNPGLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGE 60

Query:  68 LASESQGSKDLGDVLFQMAEVHRQIQVQLEEMLKSFHNXXXXXXXXXXXXDARYLTAALK 127
           .|. |  | .|| || ...  |...   |.|  | ||             | .|. | ||
Sbjct:  61 IATGSPVSTELGHVLIEISSTHKKLNESLDENFKKFHKEIIHELEKKIELDVKYMNATLK 120

Query: 128 KYQVEHKSKGESLEKCQAELKKLRRKSQGSKNPSKYGEKEMQFVETISSKQTELDTFIAE 187
           .|| |||.| ||||| ||||||.|||||||.|  ||  ||...|||..|.|.|.  |||.
Sbjct: 121 RYQTEHKNKLESLEKSQAELKKIRRKSQGSRNALKYEHKEIEYVETVTSRQSEIQKFIAD 180

Query: 188 GYKTALSEERRRYCFLVDRQCAVAKNSSAYHGKGKDLLTQKIPVWQQACSDPNKLPERAM 247
           | | || ||.||.|||||. |  | .   || .  .||  |.| ||. | |  |.||. |
Sbjct: 181 GCKEALLEEKRRFCFLVDKHCGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIM 240

Query: 248 LLAQQM---GSAAIAGT---SPLHTSKSNLVISD 275
            . ...    |  ..||   ||.   .||.|  |
Sbjct: 241 NMIEEIKTPASTPVSGTPQASPM-IERSNVVRKD 273

>hg18||uc003upj
        |7|NM_018842|Q9UHR4|BI2L1_HUMAN|BAIAP2L1|NM_018842|NP_061330|BAI1-assoc
        iated protein 2-like 1

          Length = 511

 Score =  114 bits (283), Expect = 5e-025
 Identities = 60/124 (48%), Positives = 80/124 (64%), Gaps = 4/124 (3%)

Query: 370 NKNPVGETRTLPRSSSMAAGLEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVPEAR 429
           |     |  .| || |.| ||    . .|. || | || | |||||..|||||||.|| .
Sbjct: 316 NSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEK 375

Query: 430 DGWHYGENEKNKMRGWFPFSYTRVLPESDSEKLKVNLHHG---KSSSTGNLLENDG-SLP 485
           ||| |||.. .| ||||| |||..| |...| . |        .| || || ||    .|
Sbjct: 376 DGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRSISTVNLSENSSVVIP 435

Query: 486 TPDY 489
            |||
Sbjct: 436 PPDY 439

>hg18||uc003auw
        |22|NM_025045|Q6UXY1|BI2L2_HUMAN|BAIAP2L2|NM_025045|NP_079321|BAI1-asso
        ciated protein 2-like 2

          Length = 529

 Score =  106 bits (262), Expect = 1e-022
 Identities = 56/174 (32%), Positives = 98/174 (56%), Gaps = 4/174 (2%)

Query:  13 DEVNRLTENVYKTIMEQFNPCLRNFVAMGKNYEKALASVTFAAKGYFDALVRMGELASES 72
           |.  | |  .||.||||||| | | | .| || .|  ... ||. || |. ..|| | .|
Sbjct:   6 DQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGERALQS 65

Query:  73 QGSKDLGDVLFQMAEVHRQIQVQLEEMLKSFHNXXXXXXXXXXXXDARYLTAALKKYQVE 132
             |. ||..| ||..  | .   || ....||             | ...  . . |..|
Sbjct:  66 PTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQHYELE 125

Query: 133 HKSKGESLEKCQAELKKLRRKSQGSKNPSKYG----EKEMQFVETISSKQTELD 182
           .. .  .|||| .|| .. ||   .    |        .||   . | .  ||.
Sbjct: 126 YRHRAANLEKCMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELE 179

>hg18||uc003auw
        |22|NM_025045|Q6UXY1|BI2L2_HUMAN|BAIAP2L2|NM_025045|NP_079321|BAI1-asso
        ciated protein 2-like 2

          Length = 529

 Score =  73 bits (177), Expect = 9e-013
 Identities = 33/63 (52%), Positives = 44/63 (69%)

Query: 394 GRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYTRV 453
           |  ||.|. ||. | | ||| || |||. .|||||..|| ||. | .   |||| .| . 
Sbjct: 325 GARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKA 384

Query: 454 LPE 456
           | |
Sbjct: 385 LEE 387

>hg18||uc002gmg
        |17|NM_201433|Q7Z571|Q7Z571_HUMAN|GAS7|NM_201433|NP_958839|growth
        arrest-specific 7 isoform c

          Length = 476

 Score =  43 bits (99), Expect = 0.001
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 4/60 (6%)

Query: 396 SRVQAIFSHAAGDNGTLLSFSEGDVITLL-VPEARDGWHYGENEKNKMRGWFPFSYTRVL 454
           .| . ..  .   .|  | |. |..|||| ||.   ||  || | . .||||| || ..|
Sbjct:   4 ARCRTLYPFSGERHGQGLRFAAGELITLLQVPDG--GWWEGEKE-DGLRGWFPASYVQLL 60

>hg18||uc002rfe
        |2|NM_006277|Q9NZM3|ITSN2_HUMAN|ITSN2|NM_006277|NP_006268|intersectin 2
        isoform 1

          Length = 1696

 Score =  43 bits (99), Expect = 0.001
 Identities = 24/65 (36%), Positives = 40/65 (61%), Gaps = 5/65 (7%)

Query: 397 RVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYTRVLPE 456
           . ||. |  |  .   |.||. |.||.|  | .. | .||      ||||| || ...| 
Sbjct: 901 KAQALCSWTAKKDNH-LNFSKHDIITVL--EQQENWWFGEVHGG--RGWFPKSYVKIIPG 955

Query: 457 SDSEK 461
           |. ..
Sbjct: 956 SEVKR 960

>hg18||uc002rff
        |2|NM_019595|Q9NZM3-2|Q9NZM3-2|ITSN2|NM_019595|NP_062541|intersectin 2
        isoform 3

          Length = 1669

 Score =  43 bits (99), Expect = 0.001
 Identities = 24/65 (36%), Positives = 40/65 (61%), Gaps = 5/65 (7%)

Query: 397 RVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYTRVLPE 456
           . ||. |  |  .   |.||. |.||.|  | .. | .||      ||||| || ...| 
Sbjct: 874 KAQALCSWTAKKDNH-LNFSKHDIITVL--EQQENWWFGEVHGG--RGWFPKSYVKIIPG 928

Query: 457 SDSEK 461
           |. ..
Sbjct: 929 SEVKR 933

>hg18||uc002rfg
        |2|NM_147152|Q9NZM3-3|Q9NZM3-3|ITSN2|NM_147152|NP_671494|intersectin 2
        isoform 2

          Length = 1248

 Score =  43 bits (99), Expect = 0.001
 Identities = 24/65 (36%), Positives = 40/65 (61%), Gaps = 5/65 (7%)

Query: 397 RVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYTRVLPE 456
           . ||. |  |  .   |.||. |.||.|  | .. | .||      ||||| || ...| 
Sbjct: 901 KAQALCSWTAKKDNH-LNFSKHDIITVL--EQQENWWFGEVHGG--RGWFPKSYVKIIPG 955

Query: 457 SDSEK 461
           |. ..
Sbjct: 956 SEVKR 960

>hg18||uc002rfe
        |2|NM_006277|Q9NZM3|ITSN2_HUMAN|ITSN2|NM_006277|NP_006268|intersectin 2
        isoform 1

          Length = 1696

 Score =  38 bits (86), Expect = 0.032
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 413 LSFSEGDVITLLVPEARD-GWHYGENEKNKMRGWFPFSYTRVLPESDSEK 461
           .||. ||.| .      . || ||  . |   |||| .|   .| |..||
Sbjct: 775 MSFNSGDIIQVDEKTVGEPGWLYGSFQGN--FGWFPCNYVEKMPSSENEK 822

>hg18||uc002rff
        |2|NM_019595|Q9NZM3-2|Q9NZM3-2|ITSN2|NM_019595|NP_062541|intersectin 2
        isoform 3

          Length = 1669

 Score =  38 bits (86), Expect = 0.032
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 413 LSFSEGDVITLLVPEARD-GWHYGENEKNKMRGWFPFSYTRVLPESDSEK 461
           .||. ||.| .      . || ||  . |   |||| .|   .| |..||
Sbjct: 748 MSFNSGDIIQVDEKTVGEPGWLYGSFQGN--FGWFPCNYVEKMPSSENEK 795

>hg18||uc002rfg
        |2|NM_147152|Q9NZM3-3|Q9NZM3-3|ITSN2|NM_147152|NP_671494|intersectin 2
        isoform 2

          Length = 1248

 Score =  38 bits (86), Expect = 0.032
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 413 LSFSEGDVITLLVPEARD-GWHYGENEKNKMRGWFPFSYTRVLPESDSEK 461
           .||. ||.| .      . || ||  . |   |||| .|   .| |..||
Sbjct: 775 MSFNSGDIIQVDEKTVGEPGWLYGSFQGN--FGWFPCNYVEKMPSSENEK 822

>hg18||uc002mfu |19|NM_005428|P15498|VAV_HUMAN|VAV1|NM_005428|NP_005419|vav 1
        oncogene

          Length = 845

 Score =  37 bits (84), Expect = 0.055
 Identities = 18/60 (30%), Positives = 25/60 (41%)

Query: 407 GDNGTLLSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYTRVLPESDSEKLKVNL 466
           |  |  |  . ||.. |   ||   |  | |      |||| .  .       . | |.|
Sbjct: 611 GAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHL 670

>hg18||uc002mfv |19|BC013361|Q96D37|Q96D37_HUMAN|VAV1|NM_005428|NP_005419|vav 1
        oncogene

          Length = 790

 Score =  37 bits (84), Expect = 0.055
 Identities = 18/60 (30%), Positives = 25/60 (41%)

Query: 407 GDNGTLLSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYTRVLPESDSEKLKVNL 466
           |  |  |  . ||.. |   ||   |  | |      |||| .  .       . | |.|
Sbjct: 556 GAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHL 615

>hg18||uc003ayu |22|NM_015705|Q96HU1|Q96HU1_HUMAN|RUTBC3|NM_015705|NP_056520|RUN
        and TBC1 domain containing 3

          Length = 749

 Score =  37 bits (84), Expect = 0.055
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 392 KNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYT 451
           .. | | .|.      |.   | | . |.||..  .    |     | | .|||||  . 
Sbjct: 479 RSHRRRAKALLDFERHDDDE-LGFRKNDIITIVSQKDEHCW---VGELNGLRGWFPAKFV 534

Query: 452 RVLPESDSE 460
            || |   |
Sbjct: 535 EVLDERSKE 543

>hg18||uc002vts |2|NM_019850|Q8N5V2|NGEF_HUMAN|NGEF|NM_019850|NP_062824|neuronal
        guanine nucleotide exchange factor

          Length = 710

 Score =  36 bits (82), Expect = 0.094
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 413 LSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYTRVL--PESDSEKLK 463
           |.    |.. .|  .  ||| .||   .. ||||| | |  .  |.  |. ||
Sbjct: 631 LTLELADILNIL-DKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLK 682

>hg18||uc001akg |1|AK095984|Q5VV41|ARHGG_HUMAN|ARHGEF16|NA|NA|Rho guanine
        nucleotide exchange factor 16

          Length = 709

 Score =  35 bits (79), Expect = 0.210
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 413 LSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYTRVL 454
           ..  . ||.  || .  ||| |||  ..   ||||  . | .
Sbjct: 648 VTLQQADVV--LVLQQEDGWLYGERLRDGETGWFPEDFARFI 687

>hg18||uc001akh |1|NM_014448|Q5VV41-2|Q5VV41-2|ARHGEF16|NM_014448|NP_055263|Rho
        guanine exchange factor 16

          Length = 421

 Score =  35 bits (79), Expect = 0.210
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 413 LSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYTRVL 454
           ..  . ||.  || .  ||| |||  ..   ||||  . | .
Sbjct: 360 VTLQQADVV--LVLQQEDGWLYGERLRDGETGWFPEDFARFI 399

>hg18||uc001aki |1|BC051838|Q5VV41-2|Q5VV41-2|ARHGEF16|NM_014448|NP_055263|Rho
        guanine exchange factor 16

          Length = 421

 Score =  35 bits (79), Expect = 0.210
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 413 LSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYTRVL 454
           ..  . ||.  || .  ||| |||  ..   ||||  . | .
Sbjct: 360 VTLQQADVV--LVLQQEDGWLYGERLRDGETGWFPEDFARFI 399

>hg18||uc001akj |1|D89016|Q5VV41-2|Q5VV41-2|ARHGEF16|NM_014448|NP_055263|Rho
        guanine exchange factor 16

          Length = 421

 Score =  35 bits (79), Expect = 0.210
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 413 LSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFSYTRVL 454
           ..  . ||.  || .  ||| |||  ..   ||||  . | .
Sbjct: 360 VTLQQADVV--LVLQQEDGWLYGERLRDGETGWFPEDFARFI 399

>hg18||uc002rfe
        |2|NM_006277|Q9NZM3|ITSN2_HUMAN|ITSN2|NM_006277|NP_006268|intersectin 2
        isoform 1

          Length = 1696

 Score =  34 bits (77), Expect = 0.358
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query:  393 NGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENE---KNKMRGWFPFS 449
            | .  .  . |         || . | .| |.. .   ||  || .   | . .|||| |
Sbjct: 1051 NKKPEIAQVTSAYVASGSEQLSLAPGQLI-LILKKNTSGWWQGELQARGKKRQKGWFPAS 1109

Query:  450 YTRVLPESDSEKLKVNLH 467
            . ..|  | ||.     |
Sbjct: 1110 HVKLLGPS-SERATPAFH 1126

>hg18||uc002rff
        |2|NM_019595|Q9NZM3-2|Q9NZM3-2|ITSN2|NM_019595|NP_062541|intersectin 2
        isoform 3

          Length = 1669

 Score =  34 bits (77), Expect = 0.358
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query:  393 NGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENE---KNKMRGWFPFS 449
            | .  .  . |         || . | .| |.. .   ||  || .   | . .|||| |
Sbjct: 1024 NKKPEIAQVTSAYVASGSEQLSLAPGQLI-LILKKNTSGWWQGELQARGKKRQKGWFPAS 1082

Query:  450 YTRVLPESDSEKLKVNLH 467
            . ..|  | ||.     |
Sbjct: 1083 HVKLLGPS-SERATPAFH 1099

>hg18||uc002rfg
        |2|NM_147152|Q9NZM3-3|Q9NZM3-3|ITSN2|NM_147152|NP_671494|intersectin 2
        isoform 2

          Length = 1248

 Score =  34 bits (77), Expect = 0.358
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query:  393 NGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENE---KNKMRGWFPFS 449
            | .  .  . |         || . | .| |.. .   ||  || .   | . .|||| |
Sbjct: 1051 NKKPEIAQVTSAYVASGSEQLSLAPGQLI-LILKKNTSGWWQGELQARGKKRQKGWFPAS 1109

Query:  450 YTRVLPESDSEKLKVNLH 467
            . ..|  | ||.     |
Sbjct: 1110 HVKLLGPS-SERATPAFH 1126

>hg18||uc003ezv |3|NM_015595|NA|NA|SGEF|NM_015595|NP_056410|Src homology 3
        domain-containing guanine

          Length = 871

 Score =  33 bits (75), Expect = 0.611
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 413 LSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFP 447
           ||    ||. |.     |||. ||  ..  |||||
Sbjct: 808 LSLQVADVV-LIYQRVSDGWYEGERLRDGERGWFP 841

>hg18||uc003ezx |3|AF415176|NA|NA|SGEF|NA|NA|Homo sapiens putative SH3
        domain-containing guanine exchange factor SGEF (SGEF) mRNA, complete
        cds, alternatively spliced

          Length = 154

 Score =  33 bits (75), Expect = 0.611
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 413 LSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFP 447
           ||    ||. |.     |||. ||  ..  |||||
Sbjct:  91 LSLQVADVV-LIYQRVSDGWYEGERLRDGERGWFP 124

>hg18||uc002jze
        |17|BC014043|Q9UQB8-5|Q9UQB8-5|BAIAP2|NM_006340|NP_006331|BAI1-associat
        ed protein 2 isoform 3

          Length = 553

 Score =  32 bits (72), Expect = 1.360
 Identities = 12/23 (52%), Positives = 21/23 (91%)

Query:  8 TMSRTDEVNRLTENVYKTIMEQF 30
          ..||..|..|||||||| . |..
Sbjct:  2 SLSRSEEMHRLTENVYKRVEEKY 24

>hg18||uc002qzh
        |2|NM_003887|O43150|DDEF2_HUMAN|DDEF2|NM_003887|NP_003878|development-
        and differentiation-enhancing

          Length = 1006

 Score =  32 bits (72), Expect = 1.360
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 5/90 (5%)

Query:  367 PAKNKNPVGETRTLPRSSSMAAGLEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVP 426
            |  |   .     .|| |       |    ||.|...  | ||   |.||||||| .   
Sbjct:  922 PLSNAMVLQPPAPMPRKSQAT----KLKPKRVKALYNCVA-DNPDELTFSEGDVIIVDGE 976

Query:  427 EARDGWHYGENEKNKMRGWFPFSYTRVLPE 456
            | .. |    .     .| || |.   . .
Sbjct:  977 EDQEWWIGHIDGDPGRKGAFPVSFVHFIAD 1006

>hg18||uc002qzi
        |2|BC063308|O43150-2|O43150-2|DDEF2|NM_003887|NP_003878|development-
        and differentiation-enhancing

          Length = 961

 Score =  32 bits (72), Expect = 1.360
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 5/90 (5%)

Query: 367 PAKNKNPVGETRTLPRSSSMAAGLEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVP 426
           |  |   .     .|| |       |    ||.|...  | ||   |.||||||| .   
Sbjct: 877 PLSNAMVLQPPAPMPRKSQAT----KLKPKRVKALYNCVA-DNPDELTFSEGDVIIVDGE 931

Query: 427 EARDGWHYGENEKNKMRGWFPFSYTRVLPE 456
           | .. |    .     .| || |.   . .
Sbjct: 932 EDQEWWIGHIDGDPGRKGAFPVSFVHFIAD 961

>hg18||uc003wel |7|NM_005435|Q6ZML7|Q6ZML7_HUMAN|ARHGEF5|NM_005435|NP_005426|rho
        guanine nucleotide exchange factor 5

          Length = 1597

 Score =  32 bits (72), Expect = 1.360
 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 4/76 (5%)

Query:  390 LEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFS 449
            ||     .|| . ..   .|   |.  . ||. ..  .. |||  |    .  |||||  
Sbjct: 1507 LECYNSPQVQCLRAYKPRENDE-LALEKADVV-MVTQQSSDGWLEGVRLSDGERGWFPVQ 1564

Query:  450 YTRVL--PESDSEKLK 463
                .  ||  .. ||
Sbjct: 1565 QVEFISNPEVRAQNLK 1580

>hg18||uc003wem |7|AX746515|Q12774|ARHG5_HUMAN|ARHGEF5|NA|NA|Rho guanine
        nucleotide exchange factor 5 (Guanine nucleotide regulatory protein
        TIM) (Oncogene TIM) (p60 TIM) (Transforming immortalized mammary
        oncogene)

          Length = 398

 Score =  32 bits (72), Expect = 1.360
 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 4/76 (5%)

Query: 390 LEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENEKNKMRGWFPFS 449
           ||     .|| . ..   .|   |.  . ||. ..  .. |||  |    .  |||||  
Sbjct: 308 LECYNSPQVQCLRAYKPRENDE-LALEKADVV-MVTQQSSDGWLEGVRLSDGERGWFPVQ 365

Query: 450 YTRVL--PESDSEKLK 463
               .  ||  .. ||
Sbjct: 366 QVEFISNPEVRAQNLK 381

>hg18||uc002jor |17|AF418293|NA|NA|KIAA1783|NA|NA|Homo sapiens mRNA for KIAA1783
        protein, partial cds

          Length = 977

 Score =  30 bits (67), Expect = 5.170
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 6/70 (8%)

Query: 408 DNGTLLSFSEGDVITLL-VPEARDGWHYGENEKNKMRGWFPFSYTRVLPESD---SEKLK 463
           || .||||  ||.| || |     || .|        | ||    .     |   |.. .
Sbjct: 401 DNCSLLSFHRGDLIKLLPVATLEPGWQFG--SAGGRSGLFPADIVQPAAAPDFSFSKEQR 458

Query: 464 VNLHHGKSSS 473
              | |. |.
Sbjct: 459 SGWHKGQLSN 468

>hg18||uc003kkr |5|CR936768|NA|NA|DKFZp564C0469|NA|NA|Homo sapiens
        uncharacterized gastric protein YC11P mRNA, complete cds

          Length = 1058

 Score =  30 bits (67), Expect = 5.170
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 139 SLEKCQAELKKLRRKSQGSKNPSKYG----EKEMQFVETISSKQTEL 181
           .| || . ||||..||.|  . ||       |.| | .|    .| |
Sbjct: 765 NLAKCSSSLKKLKKKSEGELSCSKENCPSVVKKMNFHKTNLKGETAL 811

>hg18||uc003kks
        |5|BC063674|Q9BQI6|ANR32_HUMAN|ANKRD32|NM_032290|NP_115666|ankyrin
        repeat domain 32

          Length = 422

 Score =  30 bits (67), Expect = 5.170
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 139 SLEKCQAELKKLRRKSQGSKNPSKYG----EKEMQFVETISSKQTEL 181
           .| || . ||||..||.|  . ||       |.| | .|    .| |
Sbjct: 129 NLAKCSSSLKKLKKKSEGELSCSKENCPSVVKKMNFHKTNLKGETAL 175

>hg18||uc003kkt
        |5|NM_032290|Q9BQI6|ANR32_HUMAN|ANKRD32|NM_032290|NP_115666|ankyrin
        repeat domain 32

          Length = 422

 Score =  30 bits (67), Expect = 5.170
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 139 SLEKCQAELKKLRRKSQGSKNPSKYG----EKEMQFVETISSKQTEL 181
           .| || . ||||..||.|  . ||       |.| | .|    .| |
Sbjct: 129 NLAKCSSSLKKLKKKSEGELSCSKENCPSVVKKMNFHKTNLKGETAL 175

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,464,252
Number of Sequences: 45480
Number of Extensions: 194464252
Number of Successful Extensions: 11249806
Number of sequences better than 0.0: 0
BLASTP 7.6.0