BLASTP 7.6.0


Query=fugu4_550611 |jgi|Takru4|550611|e_gw2.139.189.1
        (808 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002gnr |17|NM_014859|Q17R89|Q17R89_HUMAN|KIAA0672|NM_014...    839   4e-243
hg18||uc002gns |17|BC094754|NA|NA|KIAA0672|NA|NA|Homo sapiens mR...    538   1e-152
hg18||uc002dnb |16|NM_001006634|Q68EM7|Q68EM7_HUMAN|ARHGAP17|NM_...    536   5e-152
hg18||uc002dnc |16|NM_018054|Q9H8U5|Q9H8U5_HUMAN|ARHGAP17|NM_018...    536   5e-152
hg18||uc002gnt |17|AY320403|NA|NA|KIAA0672|NM_014859|NP_055674|h...    366   7e-101
hg18||uc002dnf |16|CR620475|NA|NA|ARHGAP17|NM_018054|NP_060524|n...    310   6e-084
hg18||uc002dng |16|AJ306732|Q96KS2|Q96KS2_HUMAN|RICH1|NA|NA|RICH...    231   3e-060
hg18||uc002dna |16|AK125358|Q6ZUS4|Q6ZUS4_HUMAN|ARHGAP17|NM_0010...    228   3e-059
hg18||uc003ath |22|AK024971|Q5R3N0|Q5R3N0_HUMAN|SH3BP1|NM_018957...    217   5e-056
hg18||uc003ati |22|NM_018957|Q9Y3L3|3BP1_HUMAN|SH3BP1|NM_018957|...    217   5e-056
hg18||uc003atj |22|AK126873|Q6ZT62|Q6ZT62_HUMAN|DKFZp762E117|NA|...    217   5e-056
hg18||uc003atk |22|AK126556|Q6ZTJ5|Q6ZTJ5_HUMAN|DKFZp762E117|NA|...    217   5e-056
hg18||uc003ath |22|AK024971|Q5R3N0|Q5R3N0_HUMAN|SH3BP1|NM_018957...    136   2e-031
hg18||uc003ati |22|NM_018957|Q9Y3L3|3BP1_HUMAN|SH3BP1|NM_018957|...    136   2e-031
hg18||uc002hqc |17|AB040934|Q9P227|Q9P227_HUMAN|ARHGAP23|NA|NA|K...    112   2e-024
hg18||uc001isb |10|NM_020824|Q9P2C3|Q9P2C3_HUMAN|ARHGAP21|NM_020...    107   7e-023
hg18||uc003hpm |4|NM_031305|Q9H0T6|Q9H0T6_HUMAN|ARHGAP24|NM_0313...    101   4e-021
hg18||uc001jgs |10|AK127586|Q6ZSB0|Q6ZSB0_HUMAN|ARHGAP22|NM_0212...    101   5e-021
hg18||uc001jgt |10|NM_021226|Q7Z5H3|Q7Z5H3_HUMAN|ARHGAP22|NM_021...    101   5e-021
hg18||uc001jgu |10|BC126444|A0AVP7|A0AVP7_HUMAN|ARHGAP22|NM_0212...    101   5e-021
hg18||uc003hpk |4|NM_001025616|Q8N264|Q8N264_HUMAN|ARHGAP24|NM_0...    101   5e-021
hg18||uc003hpl |4|NM_001042669|Q4KMG1|Q4KMG1_HUMAN|ARHGAP24|NM_0...    101   5e-021
hg18||uc001qez |11|NM_014715|Q86YL6|Q86YL6_HUMAN|RICS|NM_014715|...     92   3e-018
hg18||uc001qfa |11|AL833062|Q86T64|Q86T64_HUMAN|DKFZp451F1115|NA...     92   3e-018
hg18||uc001ndd |11|NM_004308|Q07960|RHG01_HUMAN|ARHGAP1|NM_00430...     89   3e-017
hg18||uc001fxk |1|NM_181720|Q5SY53|Q5SY53_HUMAN|ARHGAP30|NM_1817...     87   6e-017
hg18||uc001fxl |1|NM_001025598|Q6ZML6|Q6ZML6_HUMAN|ARHGAP30|NM_0...     87   6e-017
hg18||uc003ecj |3|NM_020754|Q2M1Z3|Q2M1Z3_HUMAN|CDGAP|NM_020754|...     85   4e-016
hg18||uc004dww |X|NM_002547|O60890|OPHN1_HUMAN|OPHN1|NM_002547|N...     84   5e-016
hg18||uc001wrl |14|BC050059|Q05BE8|Q05BE8_HUMAN|ARHGAP5|NM_00103...     83   1e-015
hg18||uc001wrm |14|NM_001173|Q05BE8|Q05BE8_HUMAN|ARHGAP5|NM_0011...     83   1e-015
hg18||uc001wrn |14|NM_001030055|Q05BE8|Q05BE8_HUMAN|ARHGAP5|NM_0...     83   1e-015
hg18||uc002fsd |17|NM_021962|Q12979|ABR_HUMAN|ABR|NM_021962|NP_0...     82   2e-015
hg18||uc002fse |17|AK124547|Q12979|ABR_HUMAN|ABR|NM_021962|NP_06...     82   2e-015
hg18||uc002fsf |17|AK127851|NA|NA|ABR|NA|NA|Homo sapiens cDNA FL...     82   2e-015
hg18||uc002fsg |17|NM_001092|Q12979-2|Q12979-2|ABR|NM_001092|NP_...     82   2e-015
hg18||uc002zww |22|NM_004327|Q4LE80|Q4LE80_HUMAN|BCR|NM_004327|N...     82   2e-015
hg18||uc002zwx |22|NM_021574|Q4LE80|Q4LE80_HUMAN|BCR|NM_021574|N...     82   2e-015
hg18||uc002nfi |19|AB209997|Q4LE74|Q4LE74_HUMAN|MYO9B|NM_004145|...     81   4e-015
hg18||uc002nfj |19|U42391|Q4LE74|Q4LE74_HUMAN|MYO9B|NM_004145|NP...     81   4e-015
hg18||uc002nfk |19|NM_004145|Q4LE74|Q4LE74_HUMAN|MYO9B|NM_004145...     81   4e-015
hg18||uc001wro |14|BC129928|NA|NA|ARHGAP5|NA|NA|Homo sapiens mRN...     81   6e-015
hg18||uc002seu |2|NM_001007231|P42331|RHG25_HUMAN|ARHGAP25|NM_00...     81   6e-015
hg18||uc002sev |2|BC039591|P42331-2|P42331-2|ARHGAP25|NA|NA|Rho ...     81   6e-015
hg18||uc002ujg |2|CR456864|P15882-2|P15882-2|CHN1|NA|NA|N-chimae...     80   1e-014
hg18||uc002ujh |2|NM_001025201|P15882|CHIN_HUMAN|CHN1|NM_0010252...     80   1e-014
hg18||uc002uji |2|NM_001822|P15882|CHIN_HUMAN|CHN1|NM_001822|NP_...     80   1e-014
hg18||uc002ujj |2|AB209788|Q59EM3|Q59EM3_HUMAN|CHN1|NA|NA|Chimer...     80   1e-014
hg18||uc002iix |17|NM_199282|Q6ZUM4|Q6ZUM4_HUMAN|ARHGAP27|NM_199...     79   2e-014
hg18||uc002tvn |2|AF217507|NA|NA|ARHGAP15|NM_018460|NP_060930|AR...     79   3e-014
hg18||uc002atk |15|AL137287|Q9NTG2|Q9NTG2_HUMAN|MYO9A|NM_006901|...     78   4e-014
hg18||uc002atl |15|NM_006901|Q9UNJ2|Q9UNJ2_HUMAN|MYO9A|NM_006901...     78   4e-014
hg18||uc003ilf |4|NM_024605|Q2VPC4|Q2VPC4_HUMAN|ARHGAP10|NM_0246...     76   1e-013
hg18||uc003ilg |4|AK123034|NA|NA|ARHGAP10|NM_024605|NP_078881|Rh...     76   1e-013
hg18||uc002tvm |2|NM_018460|Q8IXX1|Q8IXX1_HUMAN|ARHGAP15|NM_0184...     76   2e-013
hg18||uc003wwk |8|NM_006094|Q96QB1|RHG07_HUMAN|DLC1|NM_006094|NP...     76   2e-013
hg18||uc003wwl |8|AK025544|Q96QB1|RHG07_HUMAN|DLC1|NM_006094|NP_...     76   2e-013
hg18||uc003wwm |8|NM_182643|Q7Z5R8|Q7Z5R8_HUMAN|DLC1|NM_182643|N...     76   2e-013
hg18||uc001ivy |10|AK000744|Q8IWW6-3|Q8IWW6-3|ARHGAP12|NM_018287...     75   2e-013
hg18||uc001ivz |10|NM_018287|Q8IWW6|RHG12_HUMAN|ARHGAP12|NM_0182...     75   2e-013
hg18||uc001iwa |10|BC115363|Q1RLN5|Q1RLN5_HUMAN|ARHGAP12|NM_0182...     75   2e-013
hg18||uc001iwb |10|BC094719|Q504X1|Q504X1_HUMAN|ARHGAP12|NM_0182...     75   2e-013
hg18||uc001iwc |10|AY033594|Q8IWW6-2|Q8IWW6-2|ARHGAP12|NM_018287...     75   2e-013
hg18||uc001hdx |1|NM_001042758|Q5VZB5|Q5VZB5_HUMAN|SRGAP2|NM_001...     75   3e-013
hg18||uc001hdy |1|NM_015326|Q5VZB5|Q5VZB5_HUMAN|SRGAP2|NM_015326...     75   3e-013
hg18||uc002obr |19|BC128586|NA|NA|SNX26|NM_052948|NP_443180|sort...     75   3e-013
hg18||uc002obs |19|NM_052948|O14559-11|O14559-11|SNX26|NM_052948...     75   3e-013
hg18||uc002obt |19|AK127255|O14559|TCGAP_HUMAN|SNX26|NM_052948|N...     75   3e-013
hg18||uc002atj |15|CR596085|Q9NUY2|Q9NUY2_HUMAN|DKFZp434F1016|NA...     75   4e-013
hg18||uc003atj |22|AK126873|Q6ZT62|Q6ZT62_HUMAN|DKFZp762E117|NA|...     74   5e-013
hg18||uc001wrp |14|BC129929|Q6DHZ3|Q6DHZ3_HUMAN|ARHGAP5|NA|NA|AR...     74   9e-013
hg18||uc001zgw |15|NM_199357|NA|NA|ARHGAP11A|NM_199357|NP_955389...     74   9e-013
hg18||uc001zgx |15|CR625523|NA|NA|ARHGAP11A|NM_199357|NP_955389|...     74   9e-013
hg18||uc001zgy |15|NM_014783|Q6P4F7|RHGBA_HUMAN|ARHGAP11A|NM_014...     74   9e-013
hg18||uc003qbr |6|NM_033515|Q8N392-2|Q8N392-2|ARHGAP18|NM_033515...     73   2e-012
hg18||uc003szz |7|NM_004067|P52757|CHIO_HUMAN|CHN2|NM_004067|NP_...     72   2e-012
hg18||uc003taa |7|NM_001039936|NA|NA|CHN2|NM_001039936|NP_001035...     72   2e-012
hg18||uc001pgc |11|AK057372|NA|NA|AK057372|NA|NA|Homo sapiens cD...     72   3e-012
hg18||uc003ilh |4|BC047914|Q8ND72|Q8ND72_HUMAN|ARHGAP10|NM_02460...     70   8e-012
hg18||uc001ivx |10|AK001833|Q9NV28|Q9NV28_HUMAN|DKFZp434L0130|NA...     69   2e-011
hg18||uc001zet |15|NM_001039841|Q3KRB8|Q3KRB8_HUMAN|FAM7A2|NM_00...     69   2e-011
hg18||uc001snz |12|NM_001080156|Q9BRR9-3|Q9BRR9-3|ARHGAP9|NM_001...     68   4e-011
hg18||uc001soa |12|AK057573|Q9BRR9-3|Q9BRR9-3|ARHGAP9|NM_0010801...     68   4e-011
hg18||uc001soc |12|NM_032496|Q9BRR9-2|Q9BRR9-2|ARHGAP9|NM_032496...     68   4e-011
hg18||uc001sod |12|BC006107|Q9BRR9|RHG09_HUMAN|ARHGAP9|NM_032496...     68   4e-011
hg18||uc001uuu |13|NM_178007|Q9Y3M8-3|Q9Y3M8-3|STARD13|NM_178007...     64   7e-010
hg18||uc001uuv |13|NM_052851|Q9Y3M8-3|Q9Y3M8-3|STARD13|NM_052851...     64   7e-010
hg18||uc001uuw |13|NM_178006|Q9Y3M8|STA13_HUMAN|STARD13|NM_17800...     64   7e-010
hg18||uc001uux |13|BX647695|Q9Y3M8-3|Q9Y3M8-3|STARD13|NM_052851|...     64   7e-010
hg18||uc003hpj |4|BC047918|Q86TI5|Q86TI5_HUMAN|ARHGAP24|NM_00102...     60   8e-009
hg18||uc003ath |22|AK024971|Q5R3N0|Q5R3N0_HUMAN|SH3BP1|NM_018957...     60   1e-008
hg18||uc003ati |22|NM_018957|Q9Y3L3|3BP1_HUMAN|SH3BP1|NM_018957|...     60   1e-008
hg18||uc003atj |22|AK126873|Q6ZT62|Q6ZT62_HUMAN|DKFZp762E117|NA|...     60   1e-008
hg18||uc003atk |22|AK126556|Q6ZTJ5|Q6ZTJ5_HUMAN|DKFZp762E117|NA|...     60   1e-008
hg18||uc001qfb |11|BC065371|Q86UT2|Q86UT2_HUMAN|RICS|NA|NA|RICS ...     57   1e-007
hg18||uc004dxa |X|NM_014725|Q92502|STAR8_HUMAN|STARD8|NM_014725|...     57   1e-007
hg18||uc004dxb |X|CR749411|Q92502|STAR8_HUMAN|STARD8|NM_014725|N...     57   1e-007
hg18||uc004dxc |X|D80011|Q92502|STAR8_HUMAN|STARD8|NM_014725|NP_...     57   1e-007
hg18||uc003atk |22|AK126556|Q6ZTJ5|Q6ZTJ5_HUMAN|DKFZp762E117|NA|...     53   2e-006
hg18||uc002lqz |19|NM_012292|Q8HX84|Q8HX84_HUMAN|HMHA1|NM_012292...     50   1e-005

>hg18||uc002gnr
        |17|NM_014859|Q17R89|Q17R89_HUMAN|KIAA0672|NM_014859|NP_055674|hypothet
        ical protein LOC9912

          Length = 818

 Score =  839 bits (2166), Expect = 4e-243
 Identities = 415/532 (78%), Positives = 463/532 (87%), Gaps = 2/532 (0%)

Query:   1 MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLDLVKQVTHSTHKKLTACLQGQQGA 60
           ||||||||||||||||||||||||||||||||||||.|||||.|||||||||||||||||
Sbjct:   1 MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGA 60

Query:  61 DTEKRSKKLPLTTLAQCLIEGAAVLGDDSLLGKMLKLCGETEERLAQELIQFEFQIERDV 120
           . .|||||||||||||||.||.|.||||.|||||||||||||..|||||| || |.||||
Sbjct:  61 EADKRSKKLPLTTLAQCLMEGSAILGDDTLLGKMLKLCGETEDKLAQELIHFELQVERDV 120

Query: 121 VEPLCLVAEVDIPNIQKQRKHLAKLVLDMDSARTRYQQXXXXXXXXXXLQP-GTKSESLX 179
           .||| |.|||.||||||||||||||||||||.|||.||          ||| | |...| 
Sbjct: 121 IEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALR 180

Query: 180 XXXXXXXXXXXICRDQLSADMYSFVAKEIDYANYFQTLIETQAEYHRKSLEILHSILPQI 239
                      ||||||||||||||||||||||||||||| ||||||||| .| ..||||
Sbjct: 181 EEMEEAANRVEICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQI 240

Query: 240 KAHQEAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXX 299
           || |||||||||||| ||||| ||||||||||||||||||||||||||||||        
Sbjct: 241 KAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLLECGMQEEGLFRVAPSASKLK 300

Query: 300 XXXXXXDCGIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRL 359
                 || .|||||||.|||||||||||||||||||||| |||||||||||||. ||.|
Sbjct: 301 KLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNVQEQDKKL 360

Query: 360 QTLMSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMT 419
           | | . |||||  | || |||||||.|||.||| ||||||||||||||.|||   | |.|
Sbjct: 361 QALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQAEGNIT 420

Query: 420 EMMTTLSLQIVGIIEPIIQHADWFFPGEIEFNLTGSYGSPIHTNHNSNYIPMPSPDIDQS 479
           |||||.||||||||||||||||||||||||||.||.||||.| |||.||  |||||.| .
Sbjct: 421 EMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPSPDMDPA 480

Query: 480 EHKQQHDQSRRPLSVATDNMMLEFYKKDGIRKIQSMGVRVMDTSWVSRKGSA 531
           . ..| .|.||||||||||||||||||||.|||||||||||||.||.|.||.
Sbjct: 481 D-RRQPEQARRPLSVATDNMMLEFYKKDGLRKIQSMGVRVMDTNWVARRGSS 531

>hg18||uc002gns |17|BC094754|NA|NA|KIAA0672|NA|NA|Homo sapiens mRNA for KIAA0672
        protein, partial cds

          Length = 568

 Score =  538 bits (1385), Expect = 1e-152
 Identities = 278/404 (68%), Positives = 311/404 (76%), Gaps = 21/404 (5%)

Query: 200 MYSFVAKEIDYANYFQTLIETQAEYHRKSLEILHSILPQIKAHQEAWVEKPSFGKSLEEH 259
           |||||||||||||||||||| ||||||||| .| ..|||||| |||||||||||| ||||
Sbjct:   1 MYSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEH 60

Query: 260 LNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVDVQEYSSDP 319
           | ||||||||||||||||||||||||||||||              || .|||||||.||
Sbjct:  61 LTISGREIAFPIEACVTMLLECGMQEEGLFRVAPSASKLKKLKAALDCCVVDVQEYSADP 120

Query: 320 HAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRY 379
           |||||||||||||||||||| |||||||||||||. ||.|| | . |||||  | || ||
Sbjct: 121 HAIAGALKSYLRELPEPLMTFELYDEWIQASNVQEQDKKLQALWNACEKLPKANHNNIRY 180

Query: 380 LIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTLSLQIVGIIEPIIQH 439
           |||||.|||.||| ||||||||||||||.|||   | |.||||||.||||||||||||||
Sbjct: 181 LIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQAEGNITEMMTTVSLQIVGIIEPIIQH 240

Query: 440 ADWFFPGEIEFNLTGSYGSPIHTNHNSNYIPMPSPDIDQSEHKQQHDQSRRPLSVATDNM 499
           ||||||||||||.||.||||.| |||.||  |||||.| .. ..| .|.|||||||||||
Sbjct: 241 ADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPSPDMDPAD-RRQPEQARRPLSVATDNM 299

Query: 500 MLEFYKKDGIRKIQSMGVRVMDTSWVSRKGSATLARKXXXX-------XXXXXXXXXXDA 552
           |||||||||      ||||||||.||.|.||.   ||                      .
Sbjct: 300 MLEFYKKDG------MGVRVMDTNWVARRGSSA-GRKVSCAPPSMQPPAPPAELAAPLPS 352

Query: 553 LIPEQPGE------LGASLLGTPPPAERLCSLKSKELSPVTGHK 590
            .|||| .      |  | ||  |  ||  . ||||||| .  |
Sbjct: 353 PLPEQPLDSPAAPALSPSGLGLQPGPERTSTTKSKELSPGSAQK 396

>hg18||uc002dnb
        |16|NM_001006634|Q68EM7|Q68EM7_HUMAN|ARHGAP17|NM_001006634|NP_001006635
        |nadrin isoform 1

          Length = 881

 Score =  536 bits (1380), Expect = 5e-152
 Identities = 269/472 (56%), Positives = 334/472 (70%), Gaps = 7/472 (1%)

Query:   1 MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLDLVKQVTHSTHKKLTACLQGQQGA 60
           ||||||||.||||||||||||||||||||||.|.||| |. . | .||.| || ||| | 
Sbjct:   1 MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSICHHSHKRLVACFQGQHGT 60

Query:  61 DTEKRSKKLPLTTLAQCLIEGAAVLGDDSLLGKMLKLCGETEERLAQELIQFEFQIERDV 120
           | |.| |||||| ||| . | .  | .||||||||. ||. | .|| || | |  .|...
Sbjct:  61 DAERRHKKLPLTALAQNMQEASTQL-EDSLLGKMLETCGDAENQLALELSQHEVFVEKEI 119

Query: 121 VEPLCLVAEVDIPNIQKQRKHLAKLVLDMDSARTRYQQXXXXXXXXXXLQPGTKSESLXX 180
           |.||  .|||.||||||||| ||.|||| || | |. |            | .| ..|  
Sbjct: 120 VDPLYGIAEVEIPNIQKQRKQLARLVLDWDSVRARWNQAHKSSGTNFQGLP-SKIDTLKE 178

Query: 181 XXXXXXXXXXICRDQLSADMYSFVAKEIDYANYFQTLIETQAEYHRKSLEILHSILPQIK 240
                      |.|||.||||.|.||| .|  .| ||.| ||.||||.| .|   ||...
Sbjct: 179 EMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKTLPEMR 238

Query: 241 AHQEAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXX 300
           |||. | |||.||  |||||  |||||| |||||| .||| ||.||||||.         
Sbjct: 239 AHQDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKK 298

Query: 301 XXXXXDCGIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQ 360
                ||    . |. |||||.|||||||||||||||||  ||.|| | ..||| ||.||
Sbjct: 299 LKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQ 358

Query: 361 TLMSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTE 420
            |  ||.|||  |  ||||||||||||.   | |||||||.||||||.|||   |  . |
Sbjct: 359 DLWRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWARNEGTLAE 418

Query: 421 MMTTLSLQIVGIIEPIIQHADWFFPGEIEFNLTGSY-----GSPIHTNHNSN 467
           |    |. .| .||||||||||||| |.|||.. ..      |  |. |  |
Sbjct: 419 MAAATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLTTPSSNHSFHTGN 470

>hg18||uc002dnc
        |16|NM_018054|Q9H8U5|Q9H8U5_HUMAN|ARHGAP17|NM_018054|NP_060524|nadrin
        isoform 2

          Length = 803

 Score =  536 bits (1380), Expect = 5e-152
 Identities = 269/472 (56%), Positives = 334/472 (70%), Gaps = 7/472 (1%)

Query:   1 MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLDLVKQVTHSTHKKLTACLQGQQGA 60
           ||||||||.||||||||||||||||||||||.|.||| |. . | .||.| || ||| | 
Sbjct:   1 MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSICHHSHKRLVACFQGQHGT 60

Query:  61 DTEKRSKKLPLTTLAQCLIEGAAVLGDDSLLGKMLKLCGETEERLAQELIQFEFQIERDV 120
           | |.| |||||| ||| . | .  | .||||||||. ||. | .|| || | |  .|...
Sbjct:  61 DAERRHKKLPLTALAQNMQEASTQL-EDSLLGKMLETCGDAENQLALELSQHEVFVEKEI 119

Query: 121 VEPLCLVAEVDIPNIQKQRKHLAKLVLDMDSARTRYQQXXXXXXXXXXLQPGTKSESLXX 180
           |.||  .|||.||||||||| ||.|||| || | |. |            | .| ..|  
Sbjct: 120 VDPLYGIAEVEIPNIQKQRKQLARLVLDWDSVRARWNQAHKSSGTNFQGLP-SKIDTLKE 178

Query: 181 XXXXXXXXXXICRDQLSADMYSFVAKEIDYANYFQTLIETQAEYHRKSLEILHSILPQIK 240
                      |.|||.||||.|.||| .|  .| ||.| ||.||||.| .|   ||...
Sbjct: 179 EMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKTLPEMR 238

Query: 241 AHQEAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXX 300
           |||. | |||.||  |||||  |||||| |||||| .||| ||.||||||.         
Sbjct: 239 AHQDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKK 298

Query: 301 XXXXXDCGIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQ 360
                ||    . |. |||||.|||||||||||||||||  ||.|| | ..||| ||.||
Sbjct: 299 LKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQ 358

Query: 361 TLMSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTE 420
            |  ||.|||  |  ||||||||||||.   | |||||||.||||||.|||   |  . |
Sbjct: 359 DLWRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWARNEGTLAE 418

Query: 421 MMTTLSLQIVGIIEPIIQHADWFFPGEIEFNLTGSY-----GSPIHTNHNSN 467
           |    |. .| .||||||||||||| |.|||.. ..      |  |. |  |
Sbjct: 419 MAAATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLTTPSSNHSFHTGN 470

>hg18||uc002gnt |17|AY320403|NA|NA|KIAA0672|NM_014859|NP_055674|hypothetical
        protein LOC9912

          Length = 251

 Score =  366 bits (939), Expect = 7e-101
 Identities = 176/232 (75%), Positives = 197/232 (84%), Gaps = 1/232 (0%)

Query: 277 MLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVDVQEYSSDPHAIAGALKSYLRELPEP 336
           |||||||||||||||              || .|||||||.|||||||||||||||||||
Sbjct:   1 MLLECGMQEEGLFRVAPSASKLKKLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEP 60

Query: 337 LMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKM 396
           ||| |||||||||||||. ||.|| | . |||||  | || |||||||.|||.||| |||
Sbjct:  61 LMTFELYDEWIQASNVQEQDKKLQALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKM 120

Query: 397 TPSNMAIVLGPSLLWTHTEPNMTEMMTTLSLQIVGIIEPIIQHADWFFPGEIEFNLTGSY 456
           |||||||||||.|||   | |.||||||.||||||||||||||||||||||||||.||.|
Sbjct: 121 TPSNMAIVLGPNLLWPQAEGNITEMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNITGNY 180

Query: 457 GSPIHTNHNSNYIPMPSPDIDQSEHKQQHDQSRRPLSVATDNMMLEFYKKDG 508
           |||.| |||.||  |||||.| .. ..| .|.||||||||||||||||||||
Sbjct: 181 GSPVHVNHNANYSSMPSPDMDPAD-RRQPEQARRPLSVATDNMMLEFYKKDG 231

>hg18||uc002dnf |16|CR620475|NA|NA|ARHGAP17|NM_018054|NP_060524|nadrin isoform
        2

          Length = 286

 Score =  310 bits (793), Expect = 6e-084
 Identities = 153/287 (53%), Positives = 195/287 (67%), Gaps = 1/287 (0%)

Query:  94 MLKLCGETEERLAQELIQFEFQIERDVVEPLCLVAEVDIPNIQKQRKHLAKLVLDMDSAR 153
           ||. ||. | .|| || | |  .|...|.||  .|||.||||||||| ||.|||| || |
Sbjct:   1 MLETCGDAENQLALELSQHEVFVEKEIVDPLYGIAEVEIPNIQKQRKQLARLVLDWDSVR 60

Query: 154 TRYQQXXXXXXXXXXLQPGTKSESLXXXXXXXXXXXXICRDQLSADMYSFVAKEIDYANY 213
            |. |            | .| ..|             |.|||.||||.|.||| .|  .
Sbjct:  61 ARWNQAHKSSGTNFQGLP-SKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKF 119

Query: 214 FQTLIETQAEYHRKSLEILHSILPQIKAHQEAWVEKPSFGKSLEEHLNISGREIAFPIEA 273
           | ||.| ||.||||.| .|   ||...|||. | |||.||  |||||  |||||| ||||
Sbjct: 120 FVTLLEAQADYHRKALAVLEKTLPEMRAHQDKWAEKPAFGTPLEEHLKRSGREIALPIEA 179

Query: 274 CVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVDVQEYSSDPHAIAGALKSYLREL 333
           || .||| ||.||||||.              ||    . |. |||||.|||||||||||
Sbjct: 180 CVMLLLETGMKEEGLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAGALKSYLREL 239

Query: 334 PEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYL 380
           ||||||  ||.|| | ..||| ||.|| |  ||.|||  |  ||||.
Sbjct: 240 PEPLMTFNLYEEWTQVASVQDQDKKLQDLWRTCQKLPPQNFVNFRYV 286

>hg18||uc002dng |16|AJ306732|Q96KS2|Q96KS2_HUMAN|RICH1|NA|NA|RICH1B protein

          Length = 226

 Score =  231 bits (589), Expect = 3e-060
 Identities = 121/217 (55%), Positives = 154/217 (70%), Gaps = 2/217 (0%)

Query:   1 MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLDLVKQVTHSTHKKLTACLQGQQGA 60
           ||||||||.||||||||||||||||||||||.|.||| |. . | .||.| || ||| | 
Sbjct:   1 MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSICHHSHKRLVACFQGQHGT 60

Query:  61 DTEKRSKKLPLTTLAQCLIEGAAVLGDDSLLGKMLKLCGETEERLAQELIQFEFQIERDV 120
           | |.| |||||| ||| . | .  | .||||||||. ||. | .|| || | |  .|...
Sbjct:  61 DAERRHKKLPLTALAQNMQEASTQL-EDSLLGKMLETCGDAENQLALELSQHEVFVEKEI 119

Query: 121 VEPLCLVAEVDIPNIQKQRKHLAKLVLDMDSARTRYQQXXXXXXXXXXLQPGTKSESLXX 180
           |.||  .|||.||||||||| ||.|||| || | |. |            | .| ..|  
Sbjct: 120 VDPLYGIAEVEIPNIQKQRKQLARLVLDWDSVRARWNQAHKSSGTNFQGLP-SKIDTLKE 178

Query: 181 XXXXXXXXXXICRDQLSADMYSFVAKEIDYANYFQTL 217
                      |.|||.||||.|.||| .|  .| |.
Sbjct: 179 EMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTI 215

>hg18||uc002dna
        |16|AK125358|Q6ZUS4|Q6ZUS4_HUMAN|ARHGAP17|NM_001006634|NP_001006635|nad
        rin isoform 1

          Length = 608

 Score =  228 bits (580), Expect = 3e-059
 Identities = 110/196 (56%), Positives = 134/196 (68%), Gaps = 5/196 (2%)

Query: 277 MLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVDVQEYSSDPHAIAGALKSYLRELPEP 336
           .||| ||.||||||.              ||    . |. |||||.||||||||||||||
Sbjct:   2 LLLETGMKEEGLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEP 61

Query: 337 LMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKM 396
           |||  ||.|| | ..||| ||.|| |  ||.|||  |  ||||||||||||.   | |||
Sbjct:  62 LMTFNLYEEWTQVASVQDQDKKLQDLWRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKM 121

Query: 397 TPSNMAIVLGPSLLWTHTEPNMTEMMTTLSLQIVGIIEPIIQHADWFFPGEIEFNLTGSY 456
           ||||.||||||.|||   |  . ||    |. .| .||||||||||||| |.|||.. ..
Sbjct: 122 TPSNIAIVLGPNLLWARNEGTLAEMAAATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAF 181

Query: 457 -----GSPIHTNHNSN 467
                 |  |. |  |
Sbjct: 182 VPLTTPSSNHSFHTGN 197

>hg18||uc003ath
        |22|AK024971|Q5R3N0|Q5R3N0_HUMAN|SH3BP1|NM_018957|NP_061830|SH3-domain
        binding protein 1

          Length = 603

 Score =  217 bits (552), Expect = 5e-056
 Identities = 106/210 (50%), Positives = 145/210 (69%), Gaps = 3/210 (1%)

Query: 252 FGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVD 311
           .| ||  ||   ||||| |||||| |||  ||.||||||.                    
Sbjct: 274 YGVSLATHLQELGREIALPIEACVMMLLSEGMKEEGLFRLAAGASVLKRLKQTMASDPHS 333

Query: 312 VQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPT 371
           ..|. |||||.||||||||||||||||| .|||.|..|.....   ||| |   | .|| 
Sbjct: 334 LEEFCSDPHAVAGALKSYLRELPEPLMTFDLYDDWMRAASLKEPGARLQALQEVCSRLPP 393

Query: 372 DNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLW---THTEPNMTEMMTTLSLQ 428
           .||.| |||.||||.|.. |. |||||||.||||||.|||      .    .  .  |.|
Sbjct: 394 ENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQ 453

Query: 429 IVGIIEPIIQHADWFFPGEIEFNLTGSYGS 458
           .||..| .|| ||  |||.| ||..| . .
Sbjct: 454 VVGVVEALIQSADTLFPGDINFNVSGLFSA 483

>hg18||uc003ati
        |22|NM_018957|Q9Y3L3|3BP1_HUMAN|SH3BP1|NM_018957|NP_061830|SH3-domain
        binding protein 1

          Length = 701

 Score =  217 bits (552), Expect = 5e-056
 Identities = 106/210 (50%), Positives = 145/210 (69%), Gaps = 3/210 (1%)

Query: 252 FGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVD 311
           .| ||  ||   ||||| |||||| |||  ||.||||||.                    
Sbjct: 274 YGVSLATHLQELGREIALPIEACVMMLLSEGMKEEGLFRLAAGASVLKRLKQTMASDPHS 333

Query: 312 VQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPT 371
           ..|. |||||.||||||||||||||||| .|||.|..|.....   ||| |   | .|| 
Sbjct: 334 LEEFCSDPHAVAGALKSYLRELPEPLMTFDLYDDWMRAASLKEPGARLQALQEVCSRLPP 393

Query: 372 DNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLW---THTEPNMTEMMTTLSLQ 428
           .||.| |||.||||.|.. |. |||||||.||||||.|||      .    .  .  |.|
Sbjct: 394 ENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQ 453

Query: 429 IVGIIEPIIQHADWFFPGEIEFNLTGSYGS 458
           .||..| .|| ||  |||.| ||..| . .
Sbjct: 454 VVGVVEALIQSADTLFPGDINFNVSGLFSA 483

>hg18||uc003atj |22|AK126873|Q6ZT62|Q6ZT62_HUMAN|DKFZp762E117|NA|NA|CDNA
        FLJ44925 fis, clone BRAMY3014613, highly similar to Homo sapiens
        SH3-domain binding protein 1 (SH3BP1)

          Length = 605

 Score =  217 bits (552), Expect = 5e-056
 Identities = 106/210 (50%), Positives = 145/210 (69%), Gaps = 3/210 (1%)

Query: 252 FGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVD 311
           .| ||  ||   ||||| |||||| |||  ||.||||||.                    
Sbjct: 210 YGVSLATHLQELGREIALPIEACVMMLLSEGMKEEGLFRLAAGASVLKRLKQTMASDPHS 269

Query: 312 VQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPT 371
           ..|. |||||.||||||||||||||||| .|||.|..|.....   ||| |   | .|| 
Sbjct: 270 LEEFCSDPHAVAGALKSYLRELPEPLMTFDLYDDWMRAASLKEPGARLQALQEVCSRLPP 329

Query: 372 DNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLW---THTEPNMTEMMTTLSLQ 428
           .||.| |||.||||.|.. |. |||||||.||||||.|||      .    .  .  |.|
Sbjct: 330 ENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQ 389

Query: 429 IVGIIEPIIQHADWFFPGEIEFNLTGSYGS 458
           .||..| .|| ||  |||.| ||..| . .
Sbjct: 390 VVGVVEALIQSADTLFPGDINFNVSGLFSA 419

>hg18||uc003atk |22|AK126556|Q6ZTJ5|Q6ZTJ5_HUMAN|DKFZp762E117|NA|NA|CDNA
        FLJ44592 fis, clone BLADE2002310, highly similar to Homo sapiens
        SH3-domain binding protein 1 (SH3BP1). (Fragment)

          Length = 517

 Score =  217 bits (552), Expect = 5e-056
 Identities = 106/210 (50%), Positives = 145/210 (69%), Gaps = 3/210 (1%)

Query: 252 FGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVD 311
           .| ||  ||   ||||| |||||| |||  ||.||||||.                    
Sbjct: 188 YGVSLATHLQELGREIALPIEACVMMLLSEGMKEEGLFRLAAGASVLKRLKQTMASDPHS 247

Query: 312 VQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPT 371
           ..|. |||||.||||||||||||||||| .|||.|..|.....   ||| |   | .|| 
Sbjct: 248 LEEFCSDPHAVAGALKSYLRELPEPLMTFDLYDDWMRAASLKEPGARLQALQEVCSRLPP 307

Query: 372 DNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLW---THTEPNMTEMMTTLSLQ 428
           .||.| |||.||||.|.. |. |||||||.||||||.|||      .    .  .  |.|
Sbjct: 308 ENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQ 367

Query: 429 IVGIIEPIIQHADWFFPGEIEFNLTGSYGS 458
           .||..| .|| ||  |||.| ||..| . .
Sbjct: 368 VVGVVEALIQSADTLFPGDINFNVSGLFSA 397

>hg18||uc003ath
        |22|AK024971|Q5R3N0|Q5R3N0_HUMAN|SH3BP1|NM_018957|NP_061830|SH3-domain
        binding protein 1

          Length = 603

 Score =  136 bits (340), Expect = 2e-031
 Identities = 77/179 (43%), Positives = 111/179 (62%), Gaps = 4/179 (2%)

Query:   3 KQFNRMRQLANQ-TVGRAEKT-EVLSEDLLQVEKRLDLVKQVTHSTHKKLTACLQGQQGA 60
           .| .||||||   ..||  .| | | |||||||.||.  |.  |. ||.| |||||| ||
Sbjct:   4 RQLHRMRQLAQTGSLGRTPETAEFLGEDLLQVEQRLEPAKRAAHNIHKRLQACLQGQSGA 63

Query:  61 DTEKRSKKLPLTTLAQCLIEGAAVLGDDSLLGKMLKLCGETEERLAQELIQFEFQIERDV 120
           | .|| |||||  |.  . |    |  || .|| |..    . .||. | .||  .||||
Sbjct:  64 DMDKRVKKLPLMALSTTMAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLERDV 123

Query: 121 VEPLCLVAEVDIPNIQKQRKHLAKLVLDMDSARTRYQQXXXXXXXXXXL--QPGTKSES 177
           ..||  ..| ..| | | .| | ||| | .. ..|  |          |   ||. | .
Sbjct: 124 LQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGSPGSHSHT 182

>hg18||uc003ati
        |22|NM_018957|Q9Y3L3|3BP1_HUMAN|SH3BP1|NM_018957|NP_061830|SH3-domain
        binding protein 1

          Length = 701

 Score =  136 bits (340), Expect = 2e-031
 Identities = 77/179 (43%), Positives = 111/179 (62%), Gaps = 4/179 (2%)

Query:   3 KQFNRMRQLANQ-TVGRAEKT-EVLSEDLLQVEKRLDLVKQVTHSTHKKLTACLQGQQGA 60
           .| .||||||   ..||  .| | | |||||||.||.  |.  |. ||.| |||||| ||
Sbjct:   4 RQLHRMRQLAQTGSLGRTPETAEFLGEDLLQVEQRLEPAKRAAHNIHKRLQACLQGQSGA 63

Query:  61 DTEKRSKKLPLTTLAQCLIEGAAVLGDDSLLGKMLKLCGETEERLAQELIQFEFQIERDV 120
           | .|| |||||  |.  . |    |  || .|| |..    . .||. | .||  .||||
Sbjct:  64 DMDKRVKKLPLMALSTTMAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLERDV 123

Query: 121 VEPLCLVAEVDIPNIQKQRKHLAKLVLDMDSARTRYQQXXXXXXXXXXL--QPGTKSES 177
           ..||  ..| ..| | | .| | ||| | .. ..|  |          |   ||. | .
Sbjct: 124 LQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGSPGSHSHT 182

>hg18||uc002hqc |17|AB040934|Q9P227|Q9P227_HUMAN|ARHGAP23|NA|NA|KIAA1501 protein
        (Fragment)

          Length = 636

 Score =  112 bits (280), Expect = 2e-024
 Identities = 65/201 (32%), Positives = 110/201 (54%), Gaps = 6/201 (2%)

Query: 251 SFGKSLEE-HLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGI 309
           .||  |||       . .   . ||  ..   |..  |..||              . | 
Sbjct: 394 AFGVRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRGP 453

Query: 310 VDV---QEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTC 366
            |.    |   | . |.  |||. |.||||| | . |...|.|. ..|  .|..||    
Sbjct: 454 GDINLQDERWQDLNVISSLLKSFFRKLPEPLFTDDKYNDFIEANRIEDARERMRTLRKLI 513

Query: 367 EKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTLS 426
             ||       ..|.  |  ..|. . ||| | |.|.| ||.|. | .| |||.|.| . 
Sbjct: 514 RDLPGHYYETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRT-SEDNMTDMVTHMP 572

Query: 427 LQIVGIIEPIIQHADWFFPGE 447
                |.| .|||.||||  |
Sbjct: 573 -DRYKIVETLIQHSDWFFSDE 592

>hg18||uc001isb
        |10|NM_020824|Q9P2C3|Q9P2C3_HUMAN|ARHGAP21|NM_020824|NP_065875|Rho
        GTPase activating protein 21

          Length = 1957

 Score =  107 bits (266), Expect = 7e-023
 Identities = 68/204 (33%), Positives = 109/204 (53%), Gaps = 12/204 (5%)

Query:  251 SFGKSLEE----HLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXD 306
            .||  |..    | |   | |   .. |  .. | |..  |..||              .
Sbjct: 1143 TFGVRLDDCPPAHTN---RYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELN 1199

Query:  307 CGIVDV---QEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLM 363
             |. |.    .   | . |.  |||. |.||||| | . | ..|.|.  .|   ||.|| 
Sbjct: 1200 KGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLK 1259

Query:  364 STCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMT 423
                 ||  .    ..|   |  ...  . ||| | |.||| ||.|. | .| ||| |.|
Sbjct: 1260 RLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRT-SEDNMTHMVT 1318

Query:  424 TLSLQIVGIIEPIIQHADWFFPGE 447
             .  |   |.| .||| ||||  |
Sbjct: 1319 HMPDQ-YKIVETLIQHHDWFFTEE 1341

>hg18||uc003hpm
        |4|NM_031305|Q9H0T6|Q9H0T6_HUMAN|ARHGAP24|NM_031305|NP_112595|Rho
        GTPase activating protein 24 isoform 2

          Length = 655

 Score =  101 bits (251), Expect = 4e-021
 Identities = 62/207 (29%), Positives = 106/207 (51%), Gaps = 8/207 (3%)

Query: 249 KPSFGKSLEEHLNIS---GREIA-FPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXX 304
           |  ||. ||. .      |  .|   .| ||  . . |..||||||.             
Sbjct:  37 KGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDA 96

Query: 305 XDCGIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNV--QDMDKRLQTL 362
            |||     . ..| | .|  || ||||||||..    |....  . .  .. .  .. |
Sbjct:  97 FDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKEL 156

Query: 363 MSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMM 422
               . ||  | |  .|. .|| ..  |   |||.  |.| | ||..|    |  .| | 
Sbjct: 157 AKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIME 216

Query: 423 TTLSLQIVGIIEPIIQHADWFFPGEIE 449
            |. .|   ..  .|   |  || . |
Sbjct: 217 GTVVVQ--QLMSVMISKHDCLFPKDAE 241

>hg18||uc001jgs
        |10|AK127586|Q6ZSB0|Q6ZSB0_HUMAN|ARHGAP22|NM_021226|NP_067049|Rho
        GTPase activating protein 2

          Length = 608

 Score =  101 bits (250), Expect = 5e-021
 Identities = 63/183 (34%), Positives = 93/183 (50%), Gaps = 6/183 (3%)

Query: 252 FGKSLEE---HLNISGREIA-FPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDC 307
           ||. |||   |    |  .|   .| ||  . | |. ||||||.              ||
Sbjct:  63 FGQRLEETVHHERKYGPRLAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSFDC 122

Query: 308 GIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQT--LMST 365
           |   . . ..| | .|  || ||||||||..    |....  . .   |.   |  |   
Sbjct: 123 GEKPLFDSTTDVHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQ 182

Query: 366 CEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTL 425
              ||  | |  ||. ||| ..  | . |||.  |.| | ||..|    |  .| |  | 
Sbjct: 183 VSNLPQANYNLLRYICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTS 242

Query: 426 SLQ 428
            .|
Sbjct: 243 LVQ 245

>hg18||uc001jgt
        |10|NM_021226|Q7Z5H3|Q7Z5H3_HUMAN|ARHGAP22|NM_021226|NP_067049|Rho
        GTPase activating protein 2

          Length = 698

 Score =  101 bits (250), Expect = 5e-021
 Identities = 63/183 (34%), Positives = 93/183 (50%), Gaps = 6/183 (3%)

Query: 252 FGKSLEE---HLNISGREIA-FPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDC 307
           ||. |||   |    |  .|   .| ||  . | |. ||||||.              ||
Sbjct: 153 FGQRLEETVHHERKYGPRLAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSFDC 212

Query: 308 GIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQT--LMST 365
           |   . . ..| | .|  || ||||||||..    |....  . .   |.   |  |   
Sbjct: 213 GEKPLFDSTTDVHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQ 272

Query: 366 CEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTL 425
              ||  | |  ||. ||| ..  | . |||.  |.| | ||..|    |  .| |  | 
Sbjct: 273 VSNLPQANYNLLRYICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTS 332

Query: 426 SLQ 428
            .|
Sbjct: 333 LVQ 335

>hg18||uc001jgu
        |10|BC126444|A0AVP7|A0AVP7_HUMAN|ARHGAP22|NM_021226|NP_067049|Rho
        GTPase activating protein 2

          Length = 714

 Score =  101 bits (250), Expect = 5e-021
 Identities = 63/183 (34%), Positives = 93/183 (50%), Gaps = 6/183 (3%)

Query: 252 FGKSLEE---HLNISGREIA-FPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDC 307
           ||. |||   |    |  .|   .| ||  . | |. ||||||.              ||
Sbjct: 169 FGQRLEETVHHERKYGPRLAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSFDC 228

Query: 308 GIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQT--LMST 365
           |   . . ..| | .|  || ||||||||..    |....  . .   |.   |  |   
Sbjct: 229 GEKPLFDSTTDVHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQ 288

Query: 366 CEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTL 425
              ||  | |  ||. ||| ..  | . |||.  |.| | ||..|    |  .| |  | 
Sbjct: 289 VSNLPQANYNLLRYICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTS 348

Query: 426 SLQ 428
            .|
Sbjct: 349 LVQ 351

>hg18||uc003hpk
        |4|NM_001025616|Q8N264|Q8N264_HUMAN|ARHGAP24|NM_001025616|NP_001020787|
        Rho GTPase activating protein 24 isoform 1

          Length = 748

 Score =  101 bits (250), Expect = 5e-021
 Identities = 61/204 (29%), Positives = 105/204 (51%), Gaps = 8/204 (3%)

Query: 252 FGKSLEEHLNIS---GREIA-FPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDC 307
           ||. ||. .      |  .|   .| ||  . . |..||||||.              ||
Sbjct: 133 FGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDC 192

Query: 308 GIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNV--QDMDKRLQTLMST 365
           |     . ..| | .|  || ||||||||..    |....  . .  .. .  .. |   
Sbjct: 193 GEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQ 252

Query: 366 CEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTL 425
            . ||  | |  .|. .|| ..  |   |||.  |.| | ||..|    |  .| |  |.
Sbjct: 253 VKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTV 312

Query: 426 SLQIVGIIEPIIQHADWFFPGEIE 449
            .|   ..  .|   |  || . |
Sbjct: 313 VVQ--QLMSVMISKHDCLFPKDAE 334

>hg18||uc003hpl
        |4|NM_001042669|Q4KMG1|Q4KMG1_HUMAN|ARHGAP24|NM_001042669|NP_001036134|
        Rho GTPase activating protein 24 isoform 3

          Length = 653

 Score =  101 bits (250), Expect = 5e-021
 Identities = 61/204 (29%), Positives = 105/204 (51%), Gaps = 8/204 (3%)

Query: 252 FGKSLEEHLNIS---GREIA-FPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDC 307
           ||. ||. .      |  .|   .| ||  . . |..||||||.              ||
Sbjct:  38 FGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDC 97

Query: 308 GIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNV--QDMDKRLQTLMST 365
           |     . ..| | .|  || ||||||||..    |....  . .  .. .  .. |   
Sbjct:  98 GEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQ 157

Query: 366 CEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTL 425
            . ||  | |  .|. .|| ..  |   |||.  |.| | ||..|    |  .| |  |.
Sbjct: 158 VKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTV 217

Query: 426 SLQIVGIIEPIIQHADWFFPGEIE 449
            .|   ..  .|   |  || . |
Sbjct: 218 VVQ--QLMSVMISKHDCLFPKDAE 239

>hg18||uc001qez |11|NM_014715|Q86YL6|Q86YL6_HUMAN|RICS|NM_014715|NP_055530|Rho
        GTPase-activating protein

          Length = 1738

 Score =  92 bits (226), Expect = 3e-018
 Identities = 69/270 (25%), Positives = 122/270 (45%), Gaps = 11/270 (4%)

Query: 240 KAHQEAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXX 299
           |  |   ...  ||  | |||  || |.   ...|   .   |.  .|..|.        
Sbjct:   9 KLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGI-VDGIYRLSGVASNIQ 67

Query: 300 XXXXXXDCGIV---DVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMD 356
                 |   |     . |  | |..    | | |||| ||.| .||...  | .    .
Sbjct:  68 RLRHEFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDE 127

Query: 357 KRLQTLMSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEP 416
           .||  .    ..||  .     .|.. |. |.||     |   |.|||  |.|| .    
Sbjct: 128 ERLIKIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIE 187

Query: 417 NM----TEMMTTLSLQIVGIIEPIIQHADWFFPGEIEFNLTGSYGSPIHTNHNSNYIPMP 472
           .     |     . .| | ..| |. | |  | | |  ..    |.   .   |  .  |
Sbjct: 188 SACFSGTAAFMEVRIQSV-VVEFILNHVDVLFSGRI--SMAMQEGAASLSRPKSLLVSSP 244

Query: 473 SPDIDQSEHKQQHDQSRRPLSVATDNMMLE 502
           |  .   |  |   |..    . |.|  .|
Sbjct: 245 STKLLTLEEAQARTQAQVNSPIVTENKYIE 274

>hg18||uc001qfa
        |11|AL833062|Q86T64|Q86T64_HUMAN|DKFZp451F1115|NA|NA|Hypothetical
        protein DKFZp451F1115 (Fragment)

          Length = 946

 Score =  92 bits (226), Expect = 3e-018
 Identities = 69/270 (25%), Positives = 122/270 (45%), Gaps = 11/270 (4%)

Query: 240 KAHQEAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXX 299
           |  |   ...  ||  | |||  || |.   ...|   .   |.  .|..|.        
Sbjct: 284 KLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGI-VDGIYRLSGVASNIQ 342

Query: 300 XXXXXXDCGIV---DVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMD 356
                 |   |     . |  | |..    | | |||| ||.| .||...  | .    .
Sbjct: 343 RLRHEFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDE 402

Query: 357 KRLQTLMSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEP 416
           .||  .    ..||  .     .|.. |. |.||     |   |.|||  |.|| .    
Sbjct: 403 ERLIKIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIE 462

Query: 417 NM----TEMMTTLSLQIVGIIEPIIQHADWFFPGEIEFNLTGSYGSPIHTNHNSNYIPMP 472
           .     |     . .| | ..| |. | |  | | |  ..    |.   .   |  .  |
Sbjct: 463 SACFSGTAAFMEVRIQSV-VVEFILNHVDVLFSGRI--SMAMQEGAASLSRPKSLLVSSP 519

Query: 473 SPDIDQSEHKQQHDQSRRPLSVATDNMMLE 502
           |  .   |  |   |..    . |.|  .|
Sbjct: 520 STKLLTLEEAQARTQAQVNSPIVTENKYIE 549

>hg18||uc001ndd |11|NM_004308|Q07960|RHG01_HUMAN|ARHGAP1|NM_004308|NP_004299|Rho
        GTPase activating protein 1

          Length = 439

 Score =  89 bits (218), Expect = 3e-017
 Identities = 55/163 (33%), Positives = 84/163 (51%), Gaps = 5/163 (3%)

Query: 252 FGKSLE--EHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGI 309
           || ||.  .  |     |   .   |  |    .  ||.||               . |.
Sbjct: 242 FGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMGL 301

Query: 310 -VDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEK 368
            ||  .| .. |  |  ||..||||||||.| .||   .   |. |  .|.   .   . 
Sbjct: 302 PVDFDQY-NELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNI-DESQRVPATLQVLQT 359

Query: 369 LPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLW 411
           || .|    |.|  || ..| . | |||| .|.|.| ||.|||
Sbjct: 360 LPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLW 402

>hg18||uc001fxk
        |1|NM_181720|Q5SY53|Q5SY53_HUMAN|ARHGAP30|NM_181720|NP_859071|Rho
        GTPase activating protein 30 isoform 2

          Length = 890

 Score =  87 bits (215), Expect = 6e-017
 Identities = 58/214 (27%), Positives = 105/214 (49%), Gaps = 9/214 (4%)

Query: 240 KAHQEAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXX 299
           |  ..   ..  ||  |.|||  ||.|.   ...|   . | |.  .|..|.        
Sbjct:   6 KGKKKGSAKERVFGCDLQEHLQHSGQEVPQVLKSCAEFVEEYGV-VDGIYRLSGVSSNIQ 64

Query: 300 XXXXXXDC-GIVDVQE--YSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMD 356
                 .     |..   |  | | ..   |.| ||||.||.|  |||.. .|  ||   
Sbjct:  65 KLRQEFESERKPDLRRDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAEAVGVQLEP 124

Query: 357 KRLQTLMSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTH--- 413
           .||  ..    .||  |     .|.. |  .. .     |   |.|||  |.|| .    
Sbjct: 125 ERLVKILEVLRELPVPNYRTLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRSKDIE 184

Query: 414 -TEPNMTEMMTTLSLQIVGIIEPIIQHADWFFPG 446
            .  | |     . .| . ..| |. | |  | |
Sbjct: 185 ASGFNGTAAFMEVRVQSI-VVEFILTHVDQLFGG 217

>hg18||uc001fxl
        |1|NM_001025598|Q6ZML6|Q6ZML6_HUMAN|ARHGAP30|NM_001025598|NP_001020769|
        Rho GTPase activating protein 30 isoform 1

          Length = 1101

 Score =  87 bits (215), Expect = 6e-017
 Identities = 58/214 (27%), Positives = 105/214 (49%), Gaps = 9/214 (4%)

Query: 240 KAHQEAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXX 299
           |  ..   ..  ||  |.|||  ||.|.   ...|   . | |.  .|..|.        
Sbjct:   6 KGKKKGSAKERVFGCDLQEHLQHSGQEVPQVLKSCAEFVEEYGV-VDGIYRLSGVSSNIQ 64

Query: 300 XXXXXXDC-GIVDVQE--YSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMD 356
                 .     |..   |  | | ..   |.| ||||.||.|  |||.. .|  ||   
Sbjct:  65 KLRQEFESERKPDLRRDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAEAVGVQLEP 124

Query: 357 KRLQTLMSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTH--- 413
           .||  ..    .||  |     .|.. |  .. .     |   |.|||  |.|| .    
Sbjct: 125 ERLVKILEVLRELPVPNYRTLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRSKDIE 184

Query: 414 -TEPNMTEMMTTLSLQIVGIIEPIIQHADWFFPG 446
            .  | |     . .| . ..| |. | |  | |
Sbjct: 185 ASGFNGTAAFMEVRVQSI-VVEFILTHVDQLFGG 217

>hg18||uc003ecj |3|NM_020754|Q2M1Z3|Q2M1Z3_HUMAN|CDGAP|NM_020754|NP_065805|Cdc42
        GTPase-activating protein

          Length = 1444

 Score =  85 bits (208), Expect = 4e-016
 Identities = 57/210 (27%), Positives = 100/210 (47%), Gaps = 13/210 (6%)

Query: 251 SFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFR---VXXXXXXXXXXXXXXDC 307
           .||  | |.|  ||... . ...|   .   |.  .|..|   |               |
Sbjct:  18 AFGCDLTEYLESSGQDVPYVLKSCAEFIETHGI-VDGIYRLSGVTSNIQRLRQEFGSDQC 76

Query: 308 GIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCE 367
             .  . |  | | .    | | |||| ||.| |||... .| .    . .|  . .  .
Sbjct:  77 PDLTREVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAVSHCPEEGQLARIQNVIQ 136

Query: 368 KLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTH----TEPNMTEMMT 423
           .||  .     |||. || .. .     |   |.|.|  |.|| .     |  |      
Sbjct: 137 ELPPSHYRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLRSKEIEATGCNGDAAFL 196

Query: 424 TLSLQIVGIIEPIIQHADWFF----PGEIE 449
            . .| | .|| |. | |  |    || .|
Sbjct: 197 AVRVQQV-VIEFILNHVDQIFNNGAPGSLE 225

>hg18||uc004dww
        |X|NM_002547|O60890|OPHN1_HUMAN|OPHN1|NM_002547|NP_002538|oligophrenin
        1

          Length = 802

 Score =  84 bits (207), Expect = 5e-016
 Identities = 56/207 (27%), Positives = 95/207 (45%), Gaps = 8/207 (3%)

Query: 248 EKPSFGKSLEEHLNISGREIAFP-IEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXX- 305
           ..| .   . .   .   |. |  .  |. ..   |.. |||.|                
Sbjct: 366 KEPIYHSPITKQQEMELNEVGFKFVRKCINIIETKGIKTEGLYRTVGSNIQVQKLLNAFF 425

Query: 306 --DC-GIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTL 362
              | | ||      |   |  .|| ||| | ||.||  |. | . |.   ..| ||  .
Sbjct: 426 DPKCPGDVDFHNSDWDIKTITSSLKFYLRNLSEPVMTYRLHKELVSAAKSDNLDYRLGAI 485

Query: 363 MSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMM 422
            |   |||  |      ||. |  . ..   | |||||| .. ||.|.    . .    |
Sbjct: 486 HSLVYKLPEKNREMLELLIRHLVNVCEHSKENLMTPSNMGVIFGPTLM--RAQEDTVAAM 543

Query: 423 TTLSLQIVGIIEPIIQHADWFFPGEIE 449
             .  | . ..| .|.|    . |  |
Sbjct: 544 MNIKFQNI-VVEILIEHFGKIYLGPPE 569

>hg18||uc001wrl
        |14|BC050059|Q05BE8|Q05BE8_HUMAN|ARHGAP5|NM_001030055|NP_001025226|Rho
        GTPase activating protein 5 isoform a

          Length = 1502

 Score =  83 bits (204), Expect = 1e-015
 Identities = 59/203 (29%), Positives = 99/203 (48%), Gaps = 6/203 (2%)

Query:  248 EKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDC 307
            |   ||  |.. |  . . |   .| ||  . . |.  |||.||              | 
Sbjct: 1256 ESNYFGMPLQD-LVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQ 1314

Query:  308 G-IVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTC 366
               ...       .|.|||||..  .||.||.   |. | ..|. . |  .||  |    
Sbjct: 1315 DHNINLVSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIV 1374

Query:  367 EKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTLS 426
            .|    | . |||.|  | ..|     | ||  |..|   |.|.    |    | ..|  
Sbjct: 1375 KKFHPVNYDVFRYVITHLNRVSQQHKINLMTADNLSICFWPTLMRPDFENR--EFLSTTK 1432

Query:  427 LQIVGIIEPIIQHADWFF-PGEI 448
            .    ..|  ||   .||  |||
Sbjct: 1433 IH-QSVVETFIQQCQFFFYNGEI 1454

>hg18||uc001wrm
        |14|NM_001173|Q05BE8|Q05BE8_HUMAN|ARHGAP5|NM_001173|NP_001164|Rho
        GTPase activating protein 5 isoform b

          Length = 1501

 Score =  83 bits (204), Expect = 1e-015
 Identities = 59/203 (29%), Positives = 99/203 (48%), Gaps = 6/203 (2%)

Query:  248 EKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDC 307
            |   ||  |.. |  . . |   .| ||  . . |.  |||.||              | 
Sbjct: 1255 ESNYFGMPLQD-LVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQ 1313

Query:  308 G-IVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTC 366
               ...       .|.|||||..  .||.||.   |. | ..|. . |  .||  |    
Sbjct: 1314 DHNINLVSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIV 1373

Query:  367 EKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTLS 426
            .|    | . |||.|  | ..|     | ||  |..|   |.|.    |    | ..|  
Sbjct: 1374 KKFHPVNYDVFRYVITHLNRVSQQHKINLMTADNLSICFWPTLMRPDFENR--EFLSTTK 1431

Query:  427 LQIVGIIEPIIQHADWFF-PGEI 448
            .    ..|  ||   .||  |||
Sbjct: 1432 IH-QSVVETFIQQCQFFFYNGEI 1453

>hg18||uc001wrn
        |14|NM_001030055|Q05BE8|Q05BE8_HUMAN|ARHGAP5|NM_001030055|NP_001025226|
        Rho GTPase activating protein 5 isoform a

          Length = 1502

 Score =  83 bits (204), Expect = 1e-015
 Identities = 59/203 (29%), Positives = 99/203 (48%), Gaps = 6/203 (2%)

Query:  248 EKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDC 307
            |   ||  |.. |  . . |   .| ||  . . |.  |||.||              | 
Sbjct: 1256 ESNYFGMPLQD-LVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQ 1314

Query:  308 G-IVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTC 366
               ...       .|.|||||..  .||.||.   |. | ..|. . |  .||  |    
Sbjct: 1315 DHNINLVSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIV 1374

Query:  367 EKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTLS 426
            .|    | . |||.|  | ..|     | ||  |..|   |.|.    |    | ..|  
Sbjct: 1375 KKFHPVNYDVFRYVITHLNRVSQQHKINLMTADNLSICFWPTLMRPDFENR--EFLSTTK 1432

Query:  427 LQIVGIIEPIIQHADWFF-PGEI 448
            .    ..|  ||   .||  |||
Sbjct: 1433 IH-QSVVETFIQQCQFFFYNGEI 1454

>hg18||uc002fsd |17|NM_021962|Q12979|ABR_HUMAN|ABR|NM_021962|NP_068781|active
        breakpoint cluster region-related

          Length = 859

 Score =  82 bits (202), Expect = 2e-015
 Identities = 46/147 (31%), Positives = 77/147 (52%), Gaps = 2/147 (1%)

Query: 266 EIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVDVQEYSSDP--HAIA 323
           .. . .  ||  . . |..| |..|.              |    |.    ||   .|||
Sbjct: 659 KVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIA 718

Query: 324 GALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKF 383
           | || | |||||||.|  ||  ...   . |   .   .|     ||  ||  | .|.. 
Sbjct: 719 GTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEH 778

Query: 384 LAKLSDYQDANKMTPSNMAIVLGPSLL 410
           | .... .  |||.  |.| | ||.||
Sbjct: 779 LKRVAEKEPINKMSLHNLATVFGPTLL 805

>hg18||uc002fse |17|AK124547|Q12979|ABR_HUMAN|ABR|NM_021962|NP_068781|active
        breakpoint cluster region-related

          Length = 813

 Score =  82 bits (202), Expect = 2e-015
 Identities = 46/147 (31%), Positives = 77/147 (52%), Gaps = 2/147 (1%)

Query: 266 EIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVDVQEYSSDP--HAIA 323
           .. . .  ||  . . |..| |..|.              |    |.    ||   .|||
Sbjct: 613 KVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIA 672

Query: 324 GALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKF 383
           | || | |||||||.|  ||  ...   . |   .   .|     ||  ||  | .|.. 
Sbjct: 673 GTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEH 732

Query: 384 LAKLSDYQDANKMTPSNMAIVLGPSLL 410
           | .... .  |||.  |.| | ||.||
Sbjct: 733 LKRVAEKEPINKMSLHNLATVFGPTLL 759

>hg18||uc002fsf |17|AK127851|NA|NA|ABR|NA|NA|Homo sapiens cDNA FLJ37225 fis,
        clone BRAMY2000086

          Length = 396

 Score =  82 bits (202), Expect = 2e-015
 Identities = 46/147 (31%), Positives = 77/147 (52%), Gaps = 2/147 (1%)

Query: 266 EIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVDVQEYSSDP--HAIA 323
           .. . .  ||  . . |..| |..|.              |    |.    ||   .|||
Sbjct: 196 KVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIA 255

Query: 324 GALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKF 383
           | || | |||||||.|  ||  ...   . |   .   .|     ||  ||  | .|.. 
Sbjct: 256 GTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEH 315

Query: 384 LAKLSDYQDANKMTPSNMAIVLGPSLL 410
           | .... .  |||.  |.| | ||.||
Sbjct: 316 LKRVAEKEPINKMSLHNLATVFGPTLL 342

>hg18||uc002fsg |17|NM_001092|Q12979-2|Q12979-2|ABR|NM_001092|NP_001083|active
        breakpoint cluster region-related

          Length = 822

 Score =  82 bits (202), Expect = 2e-015
 Identities = 46/147 (31%), Positives = 77/147 (52%), Gaps = 2/147 (1%)

Query: 266 EIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVDVQEYSSDP--HAIA 323
           .. . .  ||  . . |..| |..|.              |    |.    ||   .|||
Sbjct: 622 KVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIA 681

Query: 324 GALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKF 383
           | || | |||||||.|  ||  ...   . |   .   .|     ||  ||  | .|.. 
Sbjct: 682 GTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEH 741

Query: 384 LAKLSDYQDANKMTPSNMAIVLGPSLL 410
           | .... .  |||.  |.| | ||.||
Sbjct: 742 LKRVAEKEPINKMSLHNLATVFGPTLL 768

>hg18||uc002zww
        |22|NM_004327|Q4LE80|Q4LE80_HUMAN|BCR|NM_004327|NP_004318|breakpoint
        cluster region isoform 1

          Length = 1271

 Score =  82 bits (202), Expect = 2e-015
 Identities = 48/147 (32%), Positives = 74/147 (50%), Gaps = 2/147 (1%)

Query:  266 EIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVDVQEYSS--DPHAIA 323
            .. . .  ||  .   ||.| |..||              |    ||    |  | .|||
Sbjct: 1066 KVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIA 1125

Query:  324 GALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKF 383
            | || | ||||||| | | |  . .   . |   .   ...    ||  ||  | .|.  
Sbjct: 1126 GTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDH 1185

Query:  384 LAKLSDYQDANKMTPSNMAIVLGPSLL 410
            | .... .  |||.  |.| | ||.||
Sbjct: 1186 LKRVAEKEAVNKMSLHNLATVFGPTLL 1212

>hg18||uc002zwx
        |22|NM_021574|Q4LE80|Q4LE80_HUMAN|BCR|NM_021574|NP_067585|breakpoint
        cluster region isoform 2

          Length = 1227

 Score =  82 bits (202), Expect = 2e-015
 Identities = 48/147 (32%), Positives = 74/147 (50%), Gaps = 2/147 (1%)

Query:  266 EIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCGIVDVQEYSS--DPHAIA 323
            .. . .  ||  .   ||.| |..||              |    ||    |  | .|||
Sbjct: 1022 KVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIA 1081

Query:  324 GALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKF 383
            | || | ||||||| | | |  . .   . |   .   ...    ||  ||  | .|.  
Sbjct: 1082 GTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDH 1141

Query:  384 LAKLSDYQDANKMTPSNMAIVLGPSLL 410
            | .... .  |||.  |.| | ||.||
Sbjct: 1142 LKRVAEKEAVNKMSLHNLATVFGPTLL 1168

>hg18||uc002nfi
        |19|AB209997|Q4LE74|Q4LE74_HUMAN|MYO9B|NM_004145|NP_004136|myosin IXB

          Length = 2022

 Score =  81 bits (199), Expect = 4e-015
 Identities = 56/197 (28%), Positives = 95/197 (48%), Gaps = 6/197 (3%)

Query:  244 EAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXX 303
            |  ||   ||  ..  |      .   .|  .  .   |.  |||.|             
Sbjct: 1690 EPGVEPGHFGVCVDS-LTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAANRTRELRQ 1748

Query:  304 XXDCGIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLM 363
                    |.  .   ||| | || .||||||||||   | ....|  . .  ..|  . 
Sbjct: 1749 ALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEKQEQLAAIY 1808

Query:  364 STCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMT 423
            .  | ||  | |.   ||  | |..  .| |.|.|  .||.  | ||     |. .. .|
Sbjct: 1809 AVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRC---PDNSDPLT 1865

Query:  424 TLS--LQIVGIIEPIIQ 438
            ..   |.|   .| .|.
Sbjct: 1866 SMKDVLKITTCVEMLIK 1882

>hg18||uc002nfj |19|U42391|Q4LE74|Q4LE74_HUMAN|MYO9B|NM_004145|NP_004136|myosin
        IXB

          Length = 1960

 Score =  81 bits (199), Expect = 4e-015
 Identities = 56/197 (28%), Positives = 95/197 (48%), Gaps = 6/197 (3%)

Query:  244 EAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXX 303
            |  ||   ||  ..  |      .   .|  .  .   |.  |||.|             
Sbjct: 1690 EPGVEPGHFGVCVDS-LTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAANRTRELRQ 1748

Query:  304 XXDCGIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLM 363
                    |.  .   ||| | || .||||||||||   | ....|  . .  ..|  . 
Sbjct: 1749 ALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEKQEQLAAIY 1808

Query:  364 STCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMT 423
            .  | ||  | |.   ||  | |..  .| |.|.|  .||.  | ||     |. .. .|
Sbjct: 1809 AVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRC---PDNSDPLT 1865

Query:  424 TLS--LQIVGIIEPIIQ 438
            ..   |.|   .| .|.
Sbjct: 1866 SMKDVLKITTCVEMLIK 1882

>hg18||uc002nfk
        |19|NM_004145|Q4LE74|Q4LE74_HUMAN|MYO9B|NM_004145|NP_004136|myosin IXB

          Length = 2157

 Score =  81 bits (199), Expect = 4e-015
 Identities = 56/197 (28%), Positives = 95/197 (48%), Gaps = 6/197 (3%)

Query:  244 EAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXX 303
            |  ||   ||  ..  |      .   .|  .  .   |.  |||.|             
Sbjct: 1690 EPGVEPGHFGVCVDS-LTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAANRTRELRQ 1748

Query:  304 XXDCGIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLM 363
                    |.  .   ||| | || .||||||||||   | ....|  . .  ..|  . 
Sbjct: 1749 ALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEKQEQLAAIY 1808

Query:  364 STCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMT 423
            .  | ||  | |.   ||  | |..  .| |.|.|  .||.  | ||     |. .. .|
Sbjct: 1809 AVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRC---PDNSDPLT 1865

Query:  424 TLS--LQIVGIIEPIIQ 438
            ..   |.|   .| .|.
Sbjct: 1866 SMKDVLKITTCVEMLIK 1882

>hg18||uc001wro |14|BC129928|NA|NA|ARHGAP5|NA|NA|Homo sapiens mRNA for Rho
        GTPase activating protein 5 variant protein

          Length = 241

 Score =  81 bits (198), Expect = 6e-015
 Identities = 53/180 (29%), Positives = 89/180 (49%), Gaps = 5/180 (2%)

Query: 271 IEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDCG-IVDVQEYSSDPHAIAGALKSY 329
           .| ||  . . |.  |||.||              |    ...       .|.|||||..
Sbjct:  17 VEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINLVSMEVTVNAVAGALKAF 76

Query: 330 LRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKFLAKLSD 389
             .||.||.   |. | ..|. . |  .||  |    .|    | . |||.|  | ..| 
Sbjct:  77 FADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPVNYDVFRYVITHLNRVSQ 136

Query: 390 YQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTLSLQIVGIIEPIIQHADWFF-PGEI 448
               | ||  |..|   |.|.    |    | ..|  .    ..|  ||   .||  |||
Sbjct: 137 QHKINLMTADNLSICFWPTLMRPDFENR--EFLSTTKIH-QSVVETFIQQCQFFFYNGEI 193

>hg18||uc002seu
        |2|NM_001007231|P42331|RHG25_HUMAN|ARHGAP25|NM_001007231|NP_001007232|R
        ho GTPase activating protein 25 isoform a

          Length = 645

 Score =  81 bits (198), Expect = 6e-015
 Identities = 54/185 (29%), Positives = 85/185 (45%), Gaps = 6/185 (3%)

Query: 252 FGKSLEEHL----NISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDC 307
           ||. |.| .          .   .| |   .|| |  |||.||.              | 
Sbjct: 157 FGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDA 216

Query: 308 GIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMD--KRLQTLMST 365
           |     .  .| | .|  || |||.||||..    |. ..    . . |  |  | ||  
Sbjct: 217 GERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQ 276

Query: 366 CEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTL 425
              || || .   |. .|| ..      |||.  |.| |.| .|. .  |     |  | 
Sbjct: 277 LSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTP 336

Query: 426 SLQIV 430
            .| |
Sbjct: 337 QIQRV 341

>hg18||uc002sev |2|BC039591|P42331-2|P42331-2|ARHGAP25|NA|NA|Rho
        GTPase-activating protein 25

          Length = 458

 Score =  81 bits (198), Expect = 6e-015
 Identities = 54/185 (29%), Positives = 85/185 (45%), Gaps = 6/185 (3%)

Query: 252 FGKSLEEHL----NISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXDC 307
           ||. |.| .          .   .| |   .|| |  |||.||.              | 
Sbjct: 151 FGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDA 210

Query: 308 GIVDVQEYSSDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMD--KRLQTLMST 365
           |     .  .| | .|  || |||.||||..    |. ..    . . |  |  | ||  
Sbjct: 211 GERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQ 270

Query: 366 CEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTEMMTTL 425
              || || .   |. .|| ..      |||.  |.| |.| .|. .  |     |  | 
Sbjct: 271 LSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTP 330

Query: 426 SLQIV 430
            .| |
Sbjct: 331 QIQRV 335

>hg18||uc002ujg |2|CR456864|P15882-2|P15882-2|CHN1|NA|NA|N-chimaerin (NC)
        (N-chimerin) (Alpha chimerin) (A-chimaerin) (Rho GTPase-activating
        protein 2)

          Length = 334

 Score =  80 bits (195), Expect = 1e-014
 Identities = 44/144 (30%), Positives = 75/144 (52%), Gaps = 5/144 (3%)

Query: 271 IEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXD----CGIVDVQEYSSDPHAIAGAL 326
           .. |.  .   |.  |||.||              |       . |  |  | . | |||
Sbjct: 160 VDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMY-EDINIITGAL 218

Query: 327 KSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKFLAK 386
           | | |.|| ||.| . | ..|... . | |..|.||    . ||  .    |||.  | .
Sbjct: 219 KLYFRDLPIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKR 278

Query: 387 LSDYQDANKMTPSNMAIVLGPSLL 410
           .. ..  | |   |. || ||.|.
Sbjct: 279 VTLHEKENLMNAENLGIVFGPTLM 302

>hg18||uc002ujh
        |2|NM_001025201|P15882|CHIN_HUMAN|CHN1|NM_001025201|NP_001020372|chimer
        in (chimaerin) 1

          Length = 459

 Score =  80 bits (195), Expect = 1e-014
 Identities = 44/144 (30%), Positives = 75/144 (52%), Gaps = 5/144 (3%)

Query: 271 IEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXD----CGIVDVQEYSSDPHAIAGAL 326
           .. |.  .   |.  |||.||              |       . |  |  | . | |||
Sbjct: 285 VDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMY-EDINIITGAL 343

Query: 327 KSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKFLAK 386
           | | |.|| ||.| . | ..|... . | |..|.||    . ||  .    |||.  | .
Sbjct: 344 KLYFRDLPIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKR 403

Query: 387 LSDYQDANKMTPSNMAIVLGPSLL 410
           .. ..  | |   |. || ||.|.
Sbjct: 404 VTLHEKENLMNAENLGIVFGPTLM 427

>hg18||uc002uji |2|NM_001822|P15882|CHIN_HUMAN|CHN1|NM_001822|NP_001813|chimerin
        (chimaerin) 1

          Length = 459

 Score =  80 bits (195), Expect = 1e-014
 Identities = 44/144 (30%), Positives = 75/144 (52%), Gaps = 5/144 (3%)

Query: 271 IEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXD----CGIVDVQEYSSDPHAIAGAL 326
           .. |.  .   |.  |||.||              |       . |  |  | . | |||
Sbjct: 285 VDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMY-EDINIITGAL 343

Query: 327 KSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKFLAK 386
           | | |.|| ||.| . | ..|... . | |..|.||    . ||  .    |||.  | .
Sbjct: 344 KLYFRDLPIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKR 403

Query: 387 LSDYQDANKMTPSNMAIVLGPSLL 410
           .. ..  | |   |. || ||.|.
Sbjct: 404 VTLHEKENLMNAENLGIVFGPTLM 427

>hg18||uc002ujj |2|AB209788|Q59EM3|Q59EM3_HUMAN|CHN1|NA|NA|Chimerin (Chimaerin)
        1 variant (Fragment)

          Length = 234

 Score =  80 bits (195), Expect = 1e-014
 Identities = 44/144 (30%), Positives = 75/144 (52%), Gaps = 5/144 (3%)

Query: 271 IEACVTMLLECGMQEEGLFRVXXXXXXXXXXXXXXD----CGIVDVQEYSSDPHAIAGAL 326
           .. |.  .   |.  |||.||              |       . |  |  | . | |||
Sbjct:  60 VDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMY-EDINIITGAL 118

Query: 327 KSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKFLAK 386
           | | |.|| ||.| . | ..|... . | |..|.||    . ||  .    |||.  | .
Sbjct: 119 KLYFRDLPIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKR 178

Query: 387 LSDYQDANKMTPSNMAIVLGPSLL 410
           .. ..  | |   |. || ||.|.
Sbjct: 179 VTLHEKENLMNAENLGIVFGPTLM 202

>hg18||uc002iix
        |17|NM_199282|Q6ZUM4|Q6ZUM4_HUMAN|ARHGAP27|NM_199282|NP_954976|Rho
        GTPase activating protein 27

          Length = 548

 Score =  79 bits (194), Expect = 2e-014
 Identities = 54/205 (26%), Positives = 95/205 (46%), Gaps = 4/205 (1%)

Query: 243 QEAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXXXXXXXXX 302
           .. ...   || .|          .   .. |.  .   |.  .||.|.           
Sbjct: 345 EKGYIKDQVFGCALAALCERERSRVPRFVQQCIRAVEARGLDIDGLYRISGNLATIQKLR 404

Query: 303 XXXDCG-IVDVQEYS-SDPHAIAGALKSYLRELPEPLMTLELYDEWIQASNVQDMDKRLQ 360
              |    .|. .    | | | |||| . |||||||     . ..| |  .||  .| .
Sbjct: 405 YKVDHDERLDLDDGRWEDVHVITGALKLFFRELPEPLFPFSHFRQFIAAIKLQDQARRSR 464

Query: 361 TLMSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPSLLWTHTEPNMTE 420
            .      ||  | .  | | . | .. .. . |.|.  ..||| ||.||    |     
Sbjct: 465 CVRDLVRSLPAPNHDTLRMLFQHLCRVIEHGEQNRMSVQSVAIVFGPTLLRPEVEETSMP 524

Query: 421 MMTTLSLQIVGIIEPIIQHADWFFP 445
           |      |.| .|  . | || | |
Sbjct: 525 MTMVFQNQVVELI--LQQCADIFPP 547

>hg18||uc002tvn |2|AF217507|NA|NA|ARHGAP15|NM_018460|NP_060930|ARHGAP15

          Length = 241

 Score =  79 bits (192), Expect = 3e-014
 Identities = 50/187 (26%), Positives = 87/187 (46%), Gaps = 13/187 (6%)

Query: 237 PQIKAHQEAWVEKPS-FGKSLEEHLNISGREIAFPIEACVTMLLECGMQEEGLFRVXXXX 295
           | .|  ||  . |   ||  | .        . . .. |.  . . |.  .|..||    
Sbjct:  29 PSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNL 88

Query: 296 XXXXXXXXXXDCGIVDVQEYSS-------DPHAIAGALKSYLRELPEPLMTLELYDEWIQ 348
                        ||. .|  .       | | . |||| . |||||||     ......
Sbjct:  89 ATIQKLRF-----IVNQEEKLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYSFFEQFVE 143

Query: 349 ASNVQDMDKRLQTLMSTCEKLPTDNLNNFRYLIKFLAKLSDYQDANKMTPSNMAIVLGPS 408
           |   || . |.. . |  .|||  | .  . |   | |.      | |.  .. || ||.
Sbjct: 144 AIKKQDNNTRIEAVKSLVQKLPPPNRDTMKVLFGHLTKIVAKASKNLMSTQSLGIVFGPT 203

Query: 409 LLWTHTE 415
           ||    |
Sbjct: 204 LLRAENE 210

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,464,252
Number of Sequences: 45480
Number of Extensions: 194464252
Number of Successful Extensions: 11249806
Number of sequences better than 0.0: 0
BLASTP 7.6.0