BLASTP 7.6.0


Query=fugu4_301869 |jgi|Takru4|301869|estExt_Genewise2.C_4000026
        (125 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003hvg |4|NM_021970|Q9UHA4|MK1I1_HUMAN|MAP2K1IP1|NM_0219...    216   4e-057
hg18||uc003hvh |4|CR611511|NA|NA|MAP2K1IP1|NA|NA|Homo sapiens cl...    197   2e-051

>hg18||uc003hvg
        |4|NM_021970|Q9UHA4|MK1I1_HUMAN|MAP2K1IP1|NM_021970|NP_068805|mitogen-a
        ctivated protein kinase kinase 1

          Length = 124

 Score =  216 bits (549), Expect = 4e-057
 Identities = 109/124 (87%), Positives = 117/124 (94%)

Query:   1 MADDLKRFLYKQLQSVEGLHAIVVTDRDGVPVVKVANDSAPVPALRPGFLSTFALATDQG 60
           |||||||||||.| ||||||||||.|||||||.|||||.||  |||||||||||||||||
Sbjct:   1 MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQG 60

Query:  61 SKLGLSKNKSIICYYNDYQIVQFNRLPLVISFIAGSSANTGLIMSLENELAPLIEELRQV 120
           |||||||||||||||| ||.|||||||||.|||| ||||||||.||| ||||| ||||||
Sbjct:  61 SKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQV 120

Query: 121 VEVT 124
           |||.
Sbjct: 121 VEVS 124

>hg18||uc003hvh |4|CR611511|NA|NA|MAP2K1IP1|NA|NA|Homo sapiens clone FLC0368
        PRO2783 mRNA, complete cds

          Length = 117

 Score =  197 bits (499), Expect = 2e-051
 Identities = 103/124 (83%), Positives = 110/124 (88%), Gaps = 7/124 (5%)

Query:   1 MADDLKRFLYKQLQSVEGLHAIVVTDRDGVPVVKVANDSAPVPALRPGFLSTFALATDQG 60
           |||||||||||.| ||||||||||.|||||||.|         |||||||||||||||||
Sbjct:   1 MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIK-------EHALRPGFLSTFALATDQG 53

Query:  61 SKLGLSKNKSIICYYNDYQIVQFNRLPLVISFIAGSSANTGLIMSLENELAPLIEELRQV 120
           |||||||||||||||| ||.|||||||||.|||| ||||||||.||| ||||| ||||||
Sbjct:  54 SKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQV 113

Query: 121 VEVT 124
           |||.
Sbjct: 114 VEVS 117

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,969,116
Number of Sequences: 45480
Number of Extensions: 193969116
Number of Successful Extensions: 11336309
Number of sequences better than 0.0: 0
BLASTP 7.6.0