BLASTP 7.6.0


Query=fugu4_301412 |jgi|Takru4|301412|estExt_Genewise2.C_3440029
        (692 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003cpq |3|NM_002343|P02788|TRFL_HUMAN|LTF|NM_002343|NP_0...    603   3e-172
hg18||uc003cpr |3|AK093852|P02788|TRFL_HUMAN|LTF|NM_002343|NP_00...    603   3e-172
hg18||uc003epu |3|CR936810|Q1HBA5|Q1HBA5_HUMAN|TF|NM_001063|NP_0...    597   3e-170
hg18||uc003epv |3|NM_001063|P02787|TRFE_HUMAN|TF|NM_001063|NP_00...    597   3e-170
hg18||uc003fxk |3|NM_005929|P08582|TRFM_HUMAN|MFI2|NM_005929|NP_...    447   2e-125
hg18||uc003fxk |3|NM_005929|P08582|TRFM_HUMAN|MFI2|NM_005929|NP_...    228   3e-059
hg18||uc003fzr |3_random|M18642|NA|NA|LTF|NM_002343|NP_002334|la...    203   6e-052
hg18||uc003cpq |3|NM_002343|P02788|TRFL_HUMAN|LTF|NM_002343|NP_0...    203   8e-052
hg18||uc003cpr |3|AK093852|P02788|TRFL_HUMAN|LTF|NM_002343|NP_00...    203   8e-052
hg18||uc003fxl |3|NM_033316|Q53XS6|Q53XS6_HUMAN|MFI2|NM_033316|N...    186   8e-047
hg18||uc003fxl |3|NM_033316|Q53XS6|Q53XS6_HUMAN|MFI2|NM_033316|N...    151   3e-036
hg18||uc003fzr |3_random|M18642|NA|NA|LTF|NM_002343|NP_002334|la...    111   6e-024
hg18||uc003epw |3|BC045772|NA|NA|TF|NA|NA|Homo sapiens PRO1400 m...     76   2e-013
hg18||uc003cpq |3|NM_002343|P02788|TRFL_HUMAN|LTF|NM_002343|NP_0...     54   8e-007
hg18||uc003cpr |3|AK093852|P02788|TRFL_HUMAN|LTF|NM_002343|NP_00...     54   8e-007

>hg18||uc003cpq
        |3|NM_002343|P02788|TRFL_HUMAN|LTF|NM_002343|NP_002334|lactotransferrin

          Length = 710

 Score =  603 bits (1554), Expect = 3e-172
 Identities = 324/698 (46%), Positives = 434/698 (62%), Gaps = 52/698 (7%)

Query:  24 IRWCLKSEAEYLKC-----KRLELVAPAISCVRRESTMECIVAITAKLADAITLDGGDVY 78
           ..||  |. |  ||        ..  | .||..|.| ..|| ||    |||.||||| .|
Sbjct:  25 VQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIY 84

Query:  79 TAGLKNYDLHPIIAEDYGPSSD--TCYYAVAVVKKGSSFGIKDLAGKKSCHTGLGKSAGW 136
            |||  | | |. || ||      | |||||||||| || . .| | ||||||| ..|||
Sbjct:  85 EAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGW 144

Query: 137 NIPIGTLLSMDLIKWTGIEDSPVEEAVKNFFHSSCVPGANAND--KLCQLCKG----DCS 190
           |.|||||     . |||    |.| ||  || .||||||.      ||.|| |     |.
Sbjct: 145 NVPIGTL--RPFLNWTG-PPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCA 201

Query: 191 RSHKEPYYDYAGAFQCLADGAGEVAFVKHLTV-----PESEKPSYELLCPDNTRKSIDSY 245
            | .|||. |.|||.|| ||||.|||..  ||      |.|.  ||||||||||| .| .
Sbjct: 202 FSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKF 261

Query: 246 KTCHLARVPAHAVVSRKDPQMAELIYNTLTTVR---------GFNLFSSEDYAPVQNLMF 296
           | |||||||.||||.|      . |.| |   .          | || |   .  ..|.|
Sbjct: 262 KDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSP--SGQKDLLF 319

Query: 297 KDSTIRLVKLPPNTDSFLYLGAGYMSIIRSL-KREQATSAAPTAIKWCAVGPAETAKCDT 355
           ||| |   ..||  || ||||.|| . |..| | |.  .|    . |||||  |  ||. 
Sbjct: 320 KDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQ 379

Query: 356 WSINSIEGEVTNVECHSAKSVEDCMSMIMRKRADAMAVDGGQVYTAGKCGLVPVMVEQYD 415
           ||  | || ||   | || . |||......  ||||..||| ||||||||||||. | | 
Sbjct: 380 WSGLS-EGSVT---CSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYK 435

Query: 416 EAQCX------XXXXXXXXXXXXXXXKKGMGITWETLKGKRSCHTGMGRTAGWNIPMGLI 469
             |                       .    .|| ..|||.|||| . |||||||||||.
Sbjct: 436 SQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLL 495

Query: 470 HKQTNNCDFTTFFSSGCAPGAEPTSPFCAACAGSSKSVGDEYKCKPSAEEHYYGYAGAFR 529
             || .| |  .||  ||||..| |  || | |  .    | || |.. | |||| ||||
Sbjct: 496 FNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQG---ENKCVPNSNERYYGYTGAFR 552

Query: 530 CLVEGAGDVAFIKHTIVKENSDGNGPD-WARNVNSADYELICPNKSPVPVTDFASCHLAM 588
           || | ||||||.|   | .|.|||  . ||...  ||. |.| .    |||.  ||||||
Sbjct: 553 CLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAM 612

Query: 589 VPAHAVVTRPESRGDVVRILQDQQAKFGTKGRD--GRFKLFQSESGKNLLFKDSTKCLQE 646
            | ||||.| .    . ..|  ||||||  | |   .| |||||. ||||| |.|.||  
Sbjct: 613 APNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSET-KNLLFNDNTECLAR 671

Query: 647 IPLGESFEKFLGAEYMTAMSSLRVCTDSTPDLEKICTF 684
           .    ..||.|| .|.  ...|. |  ||  | . | |
Sbjct: 672 LHGKTTYEKYLGPQYVAGITNLKKC--STSPLLEACEF 707

>hg18||uc003cpr
        |3|AK093852|P02788|TRFL_HUMAN|LTF|NM_002343|NP_002334|lactotransferrin

          Length = 697

 Score =  603 bits (1554), Expect = 3e-172
 Identities = 324/698 (46%), Positives = 434/698 (62%), Gaps = 52/698 (7%)

Query:  24 IRWCLKSEAEYLKC-----KRLELVAPAISCVRRESTMECIVAITAKLADAITLDGGDVY 78
           ..||  |. |  ||        ..  | .||..|.| ..|| ||    |||.||||| .|
Sbjct:  12 VQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIY 71

Query:  79 TAGLKNYDLHPIIAEDYGPSSD--TCYYAVAVVKKGSSFGIKDLAGKKSCHTGLGKSAGW 136
            |||  | | |. || ||      | |||||||||| || . .| | ||||||| ..|||
Sbjct:  72 EAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGW 131

Query: 137 NIPIGTLLSMDLIKWTGIEDSPVEEAVKNFFHSSCVPGANAND--KLCQLCKG----DCS 190
           |.|||||     . |||    |.| ||  || .||||||.      ||.|| |     |.
Sbjct: 132 NVPIGTL--RPFLNWTG-PPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCA 188

Query: 191 RSHKEPYYDYAGAFQCLADGAGEVAFVKHLTV-----PESEKPSYELLCPDNTRKSIDSY 245
            | .|||. |.|||.|| ||||.|||..  ||      |.|.  ||||||||||| .| .
Sbjct: 189 FSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKF 248

Query: 246 KTCHLARVPAHAVVSRKDPQMAELIYNTLTTVR---------GFNLFSSEDYAPVQNLMF 296
           | |||||||.||||.|      . |.| |   .          | || |   .  ..|.|
Sbjct: 249 KDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSP--SGQKDLLF 306

Query: 297 KDSTIRLVKLPPNTDSFLYLGAGYMSIIRSL-KREQATSAAPTAIKWCAVGPAETAKCDT 355
           ||| |   ..||  || ||||.|| . |..| | |.  .|    . |||||  |  ||. 
Sbjct: 307 KDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQ 366

Query: 356 WSINSIEGEVTNVECHSAKSVEDCMSMIMRKRADAMAVDGGQVYTAGKCGLVPVMVEQYD 415
           ||  | || ||   | || . |||......  ||||..||| ||||||||||||. | | 
Sbjct: 367 WSGLS-EGSVT---CSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYK 422

Query: 416 EAQCX------XXXXXXXXXXXXXXXKKGMGITWETLKGKRSCHTGMGRTAGWNIPMGLI 469
             |                       .    .|| ..|||.|||| . |||||||||||.
Sbjct: 423 SQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLL 482

Query: 470 HKQTNNCDFTTFFSSGCAPGAEPTSPFCAACAGSSKSVGDEYKCKPSAEEHYYGYAGAFR 529
             || .| |  .||  ||||..| |  || | |  .    | || |.. | |||| ||||
Sbjct: 483 FNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQG---ENKCVPNSNERYYGYTGAFR 539

Query: 530 CLVEGAGDVAFIKHTIVKENSDGNGPD-WARNVNSADYELICPNKSPVPVTDFASCHLAM 588
           || | ||||||.|   | .|.|||  . ||...  ||. |.| .    |||.  ||||||
Sbjct: 540 CLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAM 599

Query: 589 VPAHAVVTRPESRGDVVRILQDQQAKFGTKGRD--GRFKLFQSESGKNLLFKDSTKCLQE 646
            | ||||.| .    . ..|  ||||||  | |   .| |||||. ||||| |.|.||  
Sbjct: 600 APNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSET-KNLLFNDNTECLAR 658

Query: 647 IPLGESFEKFLGAEYMTAMSSLRVCTDSTPDLEKICTF 684
           .    ..||.|| .|.  ...|. |  ||  | . | |
Sbjct: 659 LHGKTTYEKYLGPQYVAGITNLKKC--STSPLLEACEF 694

>hg18||uc003epu
        |3|CR936810|Q1HBA5|Q1HBA5_HUMAN|TF|NM_001063|NP_001054|transferrin

          Length = 698

 Score =  597 bits (1537), Expect = 3e-170
 Identities = 331/694 (47%), Positives = 434/694 (62%), Gaps = 56/694 (8%)

Query:  24 IRWCLKSEAEYLKCKR--------LELVAPAISCVRRESTMECIVAITAKLADAITLDGG 75
           .|||  || |  ||.         .    |...||.. | ..|| || |  |||.||| |
Sbjct:  25 VRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAG 84

Query:  76 DVYTAGLKNYDLHPIIAEDYGPSSD--TCYYAVAVVKKGSSFGIKDLAGKKSCHTGLGKS 133
            || | |   .| |..|| ||   |  | ||||||||| | | .  | ||||||||||.|
Sbjct:  85 LVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRS 144

Query: 134 AGWNIPIGTLLSMDLIKWTGIEDSPVEEAVKNFFHSSCVPGANAND--KLCQLCKGDCSR 191
           |||||||| ||  || .       |.|.|| |||  || | |.  |  .||||| | |  
Sbjct: 145 AGWNIPIG-LLYCDLPE----PRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPG-CGC 198

Query: 192 SHKEPYYDYAGAFQCLADGAGEVAFVKHLTVPE-----SEKPSYELLCPDNTRKSIDSYK 246
           |    |. |.|||.|| ||||.|||||| |. |     ...  ||||| ||||| .| ||
Sbjct: 199 STLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYK 258

Query: 247 TCHLARVPAHAVVSRKDPQMAELIYNTLTTV---------RGFNLFSSEDYAPVQNLMFK 297
            ||||.||.| ||.|      .||.  |            . | ||||      ..|.||
Sbjct: 259 DCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPH---GKDLLFK 315

Query: 298 DSTIRLVKLPPNTDSFLYLGAGYMSIIRSLKREQATSAAPT----AIKWCAVGPAETAKC 353
           ||    .|.||  |. .|||  |.. ||.| ||     |||     .||||.   |  ||
Sbjct: 316 DSAHGFLKVPPRMDAKMYLGYEYVTAIRNL-REGTCPEAPTDECKPVKWCALSHHERLKC 374

Query: 354 DTWSINSIEGEVTNVECHSAKSVEDCMSMIMRKRADAMAVDGGQVYTAGKCGLVPVMVEQ 413
           | ||.||    |  .|| ||.. |||.. ||   ||||..||| || |||||||||. | 
Sbjct: 375 DEWSVNS----VGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGKCGLVPVLAEN 430

Query: 414 YDEAQCXXXXXXXXXXXXXXXXKKGMGITWETLKGKRSCHTGMGRTAGWNIPMGLIHKQT 473
           |...                  |    .||. ||||.|||| .||||||||||||.. . 
Sbjct: 431 YNKSDNCEDTPEAGYFAIAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKI 490

Query: 474 NNCDFTTFFSSGCAPGAEPTSPFCAACAGSSKSVGDEYKCKPSAEEHYYGYAGAFRCLVE 533
           |.| |  ||| |||||..  |  |  | ||  ..     |.|. .| |||| ||||||||
Sbjct: 491 NHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNL-----CEPNNKEGYYGYTGAFRCLVE 545

Query: 534 GAGDVAFIKHTIVKENSDGNGPD-WARNVNSADYELICPNKSPVPVTDFASCHLAMVPAH 592
             |||||.||  | .|. |  || ||.|.|  ||||.| . .  || ..|.||||  | |
Sbjct: 546 -KGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNH 604

Query: 593 AVVTRPESRGDVVRILQDQQAKFGTKGRD--GRFKLFQSESGKNLLFKDSTKCLQEIPLG 650
           ||||| .    | .||. ||  ||.   |  | | ||.||. |.|||.| | || ..   
Sbjct: 605 AVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSET-KDLLFRDDTVCLAKLHDR 663

Query: 651 ESFEKFLGAEYMTAMSSLRVCTDSTPDLEKICTF 684
            ..||.|| ||. |. .|| |  ||  | . |||
Sbjct: 664 NTYEKYLGEEYVKAVGNLRKC--STSSLLEACTF 695

>hg18||uc003epv
        |3|NM_001063|P02787|TRFE_HUMAN|TF|NM_001063|NP_001054|transferrin

          Length = 698

 Score =  597 bits (1537), Expect = 3e-170
 Identities = 331/694 (47%), Positives = 434/694 (62%), Gaps = 56/694 (8%)

Query:  24 IRWCLKSEAEYLKCKR--------LELVAPAISCVRRESTMECIVAITAKLADAITLDGG 75
           .|||  || |  ||.         .    |...||.. | ..|| || |  |||.||| |
Sbjct:  25 VRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAG 84

Query:  76 DVYTAGLKNYDLHPIIAEDYGPSSD--TCYYAVAVVKKGSSFGIKDLAGKKSCHTGLGKS 133
            || | |   .| |..|| ||   |  | ||||||||| | | .  | ||||||||||.|
Sbjct:  85 LVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRS 144

Query: 134 AGWNIPIGTLLSMDLIKWTGIEDSPVEEAVKNFFHSSCVPGANAND--KLCQLCKGDCSR 191
           |||||||| ||  || .       |.|.|| |||  || | |.  |  .||||| | |  
Sbjct: 145 AGWNIPIG-LLYCDLPE----PRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPG-CGC 198

Query: 192 SHKEPYYDYAGAFQCLADGAGEVAFVKHLTVPE-----SEKPSYELLCPDNTRKSIDSYK 246
           |    |. |.|||.|| ||||.|||||| |. |     ...  ||||| ||||| .| ||
Sbjct: 199 STLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYK 258

Query: 247 TCHLARVPAHAVVSRKDPQMAELIYNTLTTV---------RGFNLFSSEDYAPVQNLMFK 297
            ||||.||.| ||.|      .||.  |            . | ||||      ..|.||
Sbjct: 259 DCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPH---GKDLLFK 315

Query: 298 DSTIRLVKLPPNTDSFLYLGAGYMSIIRSLKREQATSAAPT----AIKWCAVGPAETAKC 353
           ||    .|.||  |. .|||  |.. ||.| ||     |||     .||||.   |  ||
Sbjct: 316 DSAHGFLKVPPRMDAKMYLGYEYVTAIRNL-REGTCPEAPTDECKPVKWCALSHHERLKC 374

Query: 354 DTWSINSIEGEVTNVECHSAKSVEDCMSMIMRKRADAMAVDGGQVYTAGKCGLVPVMVEQ 413
           | ||.||    |  .|| ||.. |||.. ||   ||||..||| || |||||||||. | 
Sbjct: 375 DEWSVNS----VGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGKCGLVPVLAEN 430

Query: 414 YDEAQCXXXXXXXXXXXXXXXXKKGMGITWETLKGKRSCHTGMGRTAGWNIPMGLIHKQT 473
           |...                  |    .||. ||||.|||| .||||||||||||.. . 
Sbjct: 431 YNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKI 490

Query: 474 NNCDFTTFFSSGCAPGAEPTSPFCAACAGSSKSVGDEYKCKPSAEEHYYGYAGAFRCLVE 533
           |.| |  ||| |||||..  |  |  | ||  ..     |.|. .| |||| ||||||||
Sbjct: 491 NHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNL-----CEPNNKEGYYGYTGAFRCLVE 545

Query: 534 GAGDVAFIKHTIVKENSDGNGPD-WARNVNSADYELICPNKSPVPVTDFASCHLAMVPAH 592
             |||||.||  | .|. |  || ||.|.|  ||||.| . .  || ..|.||||  | |
Sbjct: 546 -KGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNH 604

Query: 593 AVVTRPESRGDVVRILQDQQAKFGTKGRD--GRFKLFQSESGKNLLFKDSTKCLQEIPLG 650
           ||||| .    | .||. ||  ||.   |  | | ||.||. |.|||.| | || ..   
Sbjct: 605 AVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSET-KDLLFRDDTVCLAKLHDR 663

Query: 651 ESFEKFLGAEYMTAMSSLRVCTDSTPDLEKICTF 684
            ..||.|| ||. |. .|| |  ||  | . |||
Sbjct: 664 NTYEKYLGEEYVKAVGNLRKC--STSSLLEACTF 695

>hg18||uc003fxk
        |3|NM_005929|P08582|TRFM_HUMAN|MFI2|NM_005929|NP_005920|melanoma-associ
        ated antigen p97 isoform 1,

          Length = 738

 Score =  447 bits (1149), Expect = 2e-125
 Identities = 268/700 (38%), Positives = 383/700 (54%), Gaps = 73/700 (10%)

Query:  24 IRWCLKSEAEYLKCKRLEL------VAPAISCVRRESTMECIVAITAKLADAITLDGGDV 77
           .|||  |. |  ||  .        . |.. |||  |   |.  | |. ||||||||| .
Sbjct:  23 VRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQEADAITLDGGAI 82

Query:  78 YTAGLKNYDLHPIIAEDYGPSSDTCYYAVAVVKKGSSFGIKDLAGKKSCHTGLGKSAGWN 137
           | || | . | |.. | |     | |||||||.. |   |  | | ||||||. .. |||
Sbjct:  83 YEAG-KEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVTIDTLKGVKSCHTGINRTVGWN 141

Query: 138 IPIGTLLSMDLIKWTGIEDSPVEEAVKNFFHSSCVPGA---NANDKLCQLCKGD------ 188
           .|.| |.    .   | .   | .|| ..|  ||||||   . .. ||.||.||      
Sbjct: 142 VPVGYLVESGRLSVMGCD---VLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSGEGV 198

Query: 189 CSRSHKEPYYDYAGAFQCLADGAGEVAFVKHLTVPESE-------------KPSYELLCP 235
           | .|  | ||||.|||.|||.|||.|||||| || |.                 .|||| 
Sbjct: 199 CDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKTLPSWGQALLSQDFELLCR 258

Query: 236 DNTRKSIDSYKTCHLARVPAHAVVSRKDPQMAELIYNTLTTVR--------GFNLFSSED 287
           | .|  .  .. |||||||||||| | |     ||.  |   .         | .|||| 
Sbjct: 259 DGSRADVTEWRQCHLARVPAHAVVVRADTD-GGLIFRLLNEGQRLFSHEGSSFQMFSSEA 317

Query: 288 YAPVQNLMFKDSTIRLVKLPPNTDSFLYLGAGYMSIIRSLKREQATSAAPTAIKWCAVGP 347
           |   ..|.|||||  || .   |    .||  |.  .. |  .   .  |  ..|| .  
Sbjct: 318 YGQ-KDLLFKDSTSELVPIATQTYE-AWLGHEYLHAMKGLLCD--PNRLPPYLRWCVLST 373

Query: 348 AETAKCDTWSINSIEGEV-TNVECHSAKSVEDCMSMIMRKRADAMAVDGGQVYTAG-KCG 405
            |  ||   ..      .   ..| |||| . ||  |  .. ||. . |  .|||| | |
Sbjct: 374 PEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTLSGEDIYTAGKKYG 433

Query: 406 LVPVMVEQYDEAQCXXXXXXXXXXXXXXXXKKGMGITWETLKGKRSCHTGMGRTAGWNIP 465
           |||   | |                           | . |.|||||| | |  |||..|
Sbjct: 434 LVPAAGEHY----APEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGFGSPAGWDVP 489

Query: 466 MGLIHK----QTNNCDFTT----FFSSGCAPGAEP---TSPFCAACAGSSKSVGDEYKCK 514
           .| . .    .  .||  |    ||.. | |   |    |  || | |  .      || 
Sbjct: 490 VGALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQG---RNKCV 546

Query: 515 PSAEEHYYGYAGAFRCLVEGAGDVAFIKHTIVKENSDG-NGPDWARNVNSADYELICPNK 573
            ...| |||| |||||||| ||||||..|| | .|..| |   ||  . | ||||.||| 
Sbjct: 547 GNSQERYYGYRGAFRCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYELLCPNG 606

Query: 574 SPVPVTDFASCHLAMVPAHAVVTRPESR-GDVVRILQDQQAKFGTKGRDGRFKLFQSES- 631
           .   |. ||.|.|| .| |||. ||..    |  .|   |  ||       ||.| | . 
Sbjct: 607 ARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNY 666

Query: 632 -GKNLLFKDSTKCLQEIPLGE--SFEKFLGAEYMTAMSSL 668
            |..|||||.|  .. .|.||  ..  .|| .|. |.  .
Sbjct: 667 HGQDLLFKDAT--VRAVPVGEKTTYRGWLGLDYVAALEGM 704

>hg18||uc003fxk
        |3|NM_005929|P08582|TRFM_HUMAN|MFI2|NM_005929|NP_005920|melanoma-associ
        ated antigen p97 isoform 1,

          Length = 738

 Score =  228 bits (579), Expect = 3e-059
 Identities = 140/360 (38%), Positives = 193/360 (53%), Gaps = 30/360 (8%)

Query: 340 IKWCAVGPAETAKCDTWSINSIE-GEVTNVECHSAKSVEDCMSMIMRKRADAMAVDGGQV 398
           ..|||    |  ||   |    | |   .. |    | . |. .|  . |||. .||| .
Sbjct:  23 VRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQEADAITLDGGAI 82

Query: 399 YTAGK-CGLVPVMVEQYDEAQCXXXXXXXXXXXXXXXXKKGMGITWETLKGKRSCHTGMG 457
           | |||  || ||. | ||.                   ..   .| .|||| .|||||. 
Sbjct:  83 YEAGKEHGLKPVVGEVYDQ-------EVGTSYYAVAVVRRSSHVTIDTLKGVKSCHTGIN 135

Query: 458 RTAGWNIPMGLI----HKQTNNCD----FTTFFSSGCAPGAEPTS---PFCAACAGSSKS 506
           || |||.|.| .          ||     . .|   | |||  ||     |  | | |  
Sbjct: 136 RTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSG 195

Query: 507 VGDEYKCKPSAEEHYYGYAGAFRCLVEGAGDVAFIKHTIVKENSDGNG-PDWARNVNSAD 565
            |    |  |  | || |.|||||| ||||||||.||. | ||.||   | | . . | |
Sbjct: 196 EG---VCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKTLPSWGQALLSQD 252

Query: 566 YELICPNKSPVPVTDFASCHLAMVPAHAVVTRPESRGDVV-RILQDQQAKFGTKGRDGRF 624
           .||.| . |   ||..  |||| ||||||| | .. | .. |.| . |  |  .|    |
Sbjct: 253 FELLCRDGSRADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQRLFSHEG--SSF 310

Query: 625 KLFQSES--GKNLLFKDSTKCLQEIPLGESFEKFLGAEYMTAMSSLRVCTDSTPDLEKIC 682
           ..| ||.   |.|||||||  |  |   ...| .|| ||. ||  |    .  |   . |
Sbjct: 311 QMFSSEAYGQKDLLFKDSTSELVPIAT-QTYEAWLGHEYLHAMKGLLCDPNRLPPYLRWC 369

>hg18||uc003fzr |3_random|M18642|NA|NA|LTF|NM_002343|NP_002334|lactotransferrin

          Length = 219

 Score =  203 bits (516), Expect = 6e-052
 Identities = 105/222 (47%), Positives = 143/222 (64%), Gaps = 9/222 (4%)

Query: 466 MGLIHKQTNNCDFTTFFSSGCAPGAEPTSPFCAACAGSSKSVGDEYKCKPSAEEHYYGYA 525
           |||.  || .| |  .||  ||||..| |  || | |  .    | || |.. | |||| 
Sbjct:   1 MGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQG---ENKCVPNSNERYYGYT 57

Query: 526 GAFRCLVEGAGDVAFIKHTIVKENSDGNGPD-WARNVNSADYELICPNKSPVPVTDFASC 584
           |||||| | ||||||.|   | .|.|||  | ||...  ||. |.| .    |||.  ||
Sbjct:  58 GAFRCLAENAGDVAFVKDVTVLQNTDGNNNDAWAKDLKLADFALLCLDGKRKPVTEARSC 117

Query: 585 HLAMVPAHAVVTRPESRGDVVRILQDQQAKFGTKGRD--GRFKLFQSESGKNLLFKDSTK 642
           |||| | ||||.| .    . ..|  ||||||  | |   .| |||||. ||||| |.|.
Sbjct: 118 HLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSET-KNLLFNDNTE 176

Query: 643 CLQEIPLGESFEKFLGAEYMTAMSSLRVCTDSTPDLEKICTF 684
           ||  .    ..||.|| .|.  ...|. |  ||  | . | |
Sbjct: 177 CLARLHGKTTYEKYLGPQYVAGITNLKKC--STSPLLEACEF 216

>hg18||uc003cpq
        |3|NM_002343|P02788|TRFL_HUMAN|LTF|NM_002343|NP_002334|lactotransferrin

          Length = 710

 Score =  203 bits (515), Expect = 8e-052
 Identities = 129/346 (37%), Positives = 174/346 (50%), Gaps = 33/346 (9%)

Query: 339 AIKWCAVGPAETAKCDTWSINSIEGEVTNVECHSAKSVEDCMSMIMRKRADAMAVDGGQV 398
           ...||||   |  ||  |  |  .     | |    |   |.  |   ||||. .||| .
Sbjct:  24 SVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFI 83

Query: 399 YTAGKC--GLVPVMVEQYDEAQCXXXXXXXXXXXXXXXXKKGMGITWETLKGKRSCHTGM 456
           | ||     | ||  | |   .                 |||       |.| .|||||.
Sbjct:  84 YEAGLAPYKLRPVAAEVYGTER-----QPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGL 138

Query: 457 GRTAGWNIPMGLIHKQTN--------NCDFTTFFSSGCAPGAEPTS--PFCAACAGSSKS 506
            ||||||.|.| .    |              |||. | |||.       |  |||.   
Sbjct: 139 RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTG-- 196

Query: 507 VGDEYKCKPSAEEHYYGYAGAFRCLVEGAGDVAFIKHTIVKENSDGNGPDWARNVNSADY 566
              | ||  |..| |. |.|||.|| .||||||||. . | |       | .      .|
Sbjct: 197 ---ENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFE-------DLSDEAERDEY 246

Query: 567 ELICPNKSPVPVTDFASCHLAMVPAHAVVTRP-ESRGDVV-RILQDQQAKFGTKGRDGRF 624
           ||.||. .  ||  |  |||| ||.|||| |    . | .  .|.  | ||| | .  .|
Sbjct: 247 ELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFG-KDKSPKF 305

Query: 625 KLFQSESG-KNLLFKDSTKCLQEIPLGESFEKFLGAEYMTAMSSLR 669
           .|| | || |.||||||      .|       .||. | ||. .||
Sbjct: 306 QLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLR 351

>hg18||uc003cpr
        |3|AK093852|P02788|TRFL_HUMAN|LTF|NM_002343|NP_002334|lactotransferrin

          Length = 697

 Score =  203 bits (515), Expect = 8e-052
 Identities = 129/346 (37%), Positives = 174/346 (50%), Gaps = 33/346 (9%)

Query: 339 AIKWCAVGPAETAKCDTWSINSIEGEVTNVECHSAKSVEDCMSMIMRKRADAMAVDGGQV 398
           ...||||   |  ||  |  |  .     | |    |   |.  |   ||||. .||| .
Sbjct:  11 SVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFI 70

Query: 399 YTAGKC--GLVPVMVEQYDEAQCXXXXXXXXXXXXXXXXKKGMGITWETLKGKRSCHTGM 456
           | ||     | ||  | |   .                 |||       |.| .|||||.
Sbjct:  71 YEAGLAPYKLRPVAAEVYGTER-----QPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGL 125

Query: 457 GRTAGWNIPMGLIHKQTN--------NCDFTTFFSSGCAPGAEPTS--PFCAACAGSSKS 506
            ||||||.|.| .    |              |||. | |||.       |  |||.   
Sbjct: 126 RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTG-- 183

Query: 507 VGDEYKCKPSAEEHYYGYAGAFRCLVEGAGDVAFIKHTIVKENSDGNGPDWARNVNSADY 566
              | ||  |..| |. |.|||.|| .||||||||. . | |       | .      .|
Sbjct: 184 ---ENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFE-------DLSDEAERDEY 233

Query: 567 ELICPNKSPVPVTDFASCHLAMVPAHAVVTRP-ESRGDVV-RILQDQQAKFGTKGRDGRF 624
           ||.||. .  ||  |  |||| ||.|||| |    . | .  .|.  | ||| | .  .|
Sbjct: 234 ELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFG-KDKSPKF 292

Query: 625 KLFQSESG-KNLLFKDSTKCLQEIPLGESFEKFLGAEYMTAMSSLR 669
           .|| | || |.||||||      .|       .||. | ||. .||
Sbjct: 293 QLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLR 338

>hg18||uc003fxl
        |3|NM_033316|Q53XS6|Q53XS6_HUMAN|MFI2|NM_033316|NP_201573|melanoma-asso
        ciated antigen p97 isoform 2,

          Length = 302

 Score =  186 bits (472), Expect = 8e-047
 Identities = 101/223 (45%), Positives = 137/223 (61%), Gaps = 21/223 (9%)

Query:  24 IRWCLKSEAEYLKCKRLEL------VAPAISCVRRESTMECIVAITAKLADAITLDGGDV 77
           .|||  |. |  ||  .        . |.. |||  |   |.  | |. ||||||||| .
Sbjct:  23 VRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQEADAITLDGGAI 82

Query:  78 YTAGLKNYDLHPIIAEDYGPSSDTCYYAVAVVKKGSSFGIKDLAGKKSCHTGLGKSAGWN 137
           | || | . | |.. | |     | |||||||.. |   |  | | ||||||. .. |||
Sbjct:  83 YEAG-KEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVTIDTLKGVKSCHTGINRTVGWN 141

Query: 138 IPIGTLLSMDLIKWTGIEDSPVEEAVKNFFHSSCVPGA---NANDKLCQLCKGD------ 188
           .|.| |.    .   | .   | .|| ..|  ||||||   . .. ||.||.||      
Sbjct: 142 VPVGYLVESGRLSVMGCD---VLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSGEGV 198

Query: 189 CSRSHKEPYYDYAGAFQCLADGAGEVAFVKHLTVPES--EKPS 229
           | .|  | ||||.|||.|||.|||.|||||| || |.  | ||
Sbjct: 199 CDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDESPS 241

>hg18||uc003fxl
        |3|NM_033316|Q53XS6|Q53XS6_HUMAN|MFI2|NM_033316|NP_201573|melanoma-asso
        ciated antigen p97 isoform 2,

          Length = 302

 Score =  151 bits (381), Expect = 3e-036
 Identities = 99/277 (35%), Positives = 131/277 (47%), Gaps = 25/277 (9%)

Query: 340 IKWCAVGPAETAKCDTWSINSIE-GEVTNVECHSAKSVEDCMSMIMRKRADAMAVDGGQV 398
           ..|||    |  ||   |    | |   .. |    | . |. .|  . |||. .||| .
Sbjct:  23 VRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQEADAITLDGGAI 82

Query: 399 YTAGK-CGLVPVMVEQYDEAQCXXXXXXXXXXXXXXXXKKGMGITWETLKGKRSCHTGMG 457
           | |||  || ||. | ||.                   ..   .| .|||| .|||||. 
Sbjct:  83 YEAGKEHGLKPVVGEVYDQ-------EVGTSYYAVAVVRRSSHVTIDTLKGVKSCHTGIN 135

Query: 458 RTAGWNIPMGLI----HKQTNNCD----FTTFFSSGCAPGAEPTS---PFCAACAGSSKS 506
           || |||.|.| .          ||     . .|   | |||  ||     |  | | |  
Sbjct: 136 RTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSG 195

Query: 507 VGDEYKCKPSAEEHYYGYAGAFRCLVEGAGDVAFIKHTIVKENSDGNGPDWARNVNSADY 566
            |    |  |  | || |.|||||| ||||||||.||. | ||.| .         | . 
Sbjct: 196 EG---VCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDESPSRRQTWTRSEEE 252

Query: 567 ELICPNKSPVPVTDFASCHLAMVPAHAVVTRPESRGD 603
           |  ||       |  .|   |     | | ||.   |
Sbjct: 253 EGECPAHEEARRTMRSSAGQAW--KWAPVHRPQDESD 287

>hg18||uc003fzr |3_random|M18642|NA|NA|LTF|NM_002343|NP_002334|lactotransferrin

          Length = 219

 Score =  111 bits (275), Expect = 6e-024
 Identities = 72/193 (37%), Positives = 96/193 (49%), Gaps = 33/193 (17%)

Query: 166 FFHSSCVPGANANDKLCQLCKGD------CSRSHKEPYYDYAGAFQCLADGAGEVAFVKH 219
           .|  || ||..    || || ||      |  .  | || | |||.|||. ||.||||| 
Sbjct:  16 YFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKD 75

Query: 220 LTVPES-------------EKPSYELLCPDNTRKSIDSYKTCHLARVPAHAVVSRKDP-- 264
           .|| ..             .   . ||| |  || .   ..||||  | |||||| |   
Sbjct:  76 VTVLQNTDGNNNDAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVE 135

Query: 265 --------QMAELIYNTLTTVRGFNLFSSEDYAPVQNLMFKDSTIRLVKLPPNTDSFLYL 316
                   | |.   |       | || ||     .||.| |.|  | .|   |    ||
Sbjct: 136 RLKQVLLHQQAKFGRNGSDCPDKFCLFQSE----TKNLLFNDNTECLARLHGKTTYEKYL 191

Query: 317 GAGYMSIIRSLKR 329
           |  |.. | .||.
Sbjct: 192 GPQYVAGITNLKK 204

>hg18||uc003epw |3|BC045772|NA|NA|TF|NA|NA|Homo sapiens PRO1400 mRNA, complete
        cds

          Length = 137

 Score =  76 bits (185), Expect = 2e-013
 Identities = 45/97 (46%), Positives = 62/97 (63%), Gaps = 5/97 (5%)

Query: 590 PAHAVVTRPESRGDVVRILQDQQAKFGTKGRD--GRFKLFQSESGKNLLFKDSTKCLQEI 647
           | |||||| .    | .||. ||  ||.   |  | | ||.||. |.|||.| | || ..
Sbjct:  41 PNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSET-KDLLFRDDTVCLAKL 99

Query: 648 PLGESFEKFLGAEYMTAMSSLRVCTDSTPDLEKICTF 684
               ..||.|| ||. |. .|| |  ||  | . |||
Sbjct: 100 HDRNTYEKYLGEEYVKAVGNLRKC--STSSLLEACTF 134

>hg18||uc003cpq
        |3|NM_002343|P02788|TRFL_HUMAN|LTF|NM_002343|NP_002334|lactotransferrin

          Length = 710

 Score =  54 bits (127), Expect = 8e-007
 Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query:  23 RIRWCLKSEAEYLKCKRLE-LVAPAISCVRRESTMECIVAITAKLADAITLDGGDVYTAG 81
           |. ||   | |  || .   |   ...|    .| .||  .    |||..|||| |||||
Sbjct: 363 RVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAG 422

Query:  82 LKNYDLHPIIAEDY 95
                | |..||.|
Sbjct: 423 --KCGLVPVLAENY 434

>hg18||uc003cpr
        |3|AK093852|P02788|TRFL_HUMAN|LTF|NM_002343|NP_002334|lactotransferrin

          Length = 697

 Score =  54 bits (127), Expect = 8e-007
 Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query:  23 RIRWCLKSEAEYLKCKRLE-LVAPAISCVRRESTMECIVAITAKLADAITLDGGDVYTAG 81
           |. ||   | |  || .   |   ...|    .| .||  .    |||..|||| |||||
Sbjct: 350 RVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAG 409

Query:  82 LKNYDLHPIIAEDY 95
                | |..||.|
Sbjct: 410 --KCGLVPVLAENY 421

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,994,661
Number of Sequences: 45480
Number of Extensions: 193994661
Number of Successful Extensions: 11136213
Number of sequences better than 0.0: 0
BLASTP 7.6.0