BLASTP 7.6.0


Query=fugu4_300690 |jgi|Takru4|300690|estExt_Genewise2.C_2780087
        (107 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002yff |20|NM_024299|Q9H3Y8|CT149_HUMAN|C20orf149|NM_024...     69   1e-012
hg18||uc003kev |5|NM_032367|Q96IU2|ZBED3_HUMAN|ZBED3|NM_032367|N...     28   2.080
hg18||uc004een |X|NM_001012980|Q86VE3|Q86VE3_HUMAN|SATL1|NM_0010...     27   4.634

>hg18||uc002yff
        |20|NM_024299|Q9H3Y8|CT149_HUMAN|C20orf149|NM_024299|NP_077275|hypothet
        ical protein LOC79144

          Length = 114

 Score =  69 bits (166), Expect = 1e-012
 Identities = 35/73 (47%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query:  1 MAAIPAGGSLVATTDXXXXXXXXXXXXXXXXXXXXXXEVIPHHPGLPKQDSGHWWSSFFF 60
          |||||. |||||| |                      | ||| ||||| | ||||.||||
Sbjct:  1 MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFF 60

Query: 61 GKQ--PGMSPLTE 71
          ||   | |. . |
Sbjct: 61 GKSTLPFMATVLE 73

>hg18||uc003kev |5|NM_032367|Q96IU2|ZBED3_HUMAN|ZBED3|NM_032367|NP_115743|zinc
        finger, BED domain containing 3

          Length = 234

 Score =  28 bits (60), Expect = 2.080
 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 2/59 (3%)

Query:  44 PGLPKQDSGHWWSSFFFGKQPGMSPLTEEKAGVSAAATNISCVAREMVMQRQASESSDA 102
           || |   |||| .    |.| |  |     || ||   ..    |  .    |  |  |
Sbjct:  56 PGRPGHPSGHWATCRLCGEQVGRGP--GFHAGTSALWRHLRSAHRRELESSGAGSSPPA 112

>hg18||uc004een
        |X|NM_001012980|Q86VE3|Q86VE3_HUMAN|SATL1|NM_001012980|NP_001012998|spe
        rmidine/spermine N1-acetyl transferase-like

          Length = 445

 Score =  27 bits (57), Expect = 4.634
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 5/57 (8%)

Query:  44 PGLPKQDSGHWWSSFFFGKQPGMSPLTEEKAGVSAAATNISCVAREMVMQRQASESS 100
           ||. .|   |   |     |||||     . |.    |. ||  .  . |  |..||
Sbjct:  14 PGISQQVPSHPDMS-----QPGMSQQVPSQPGIRQPDTSQSCKNQTDMSQPDANQSS 65

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0