BLASTP 7.6.0


Query=fugu4_298037 |jgi|Takru4|298037|estExt_Genewise2.C_1370124
        (834 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001qrh |12|NM_003481|P45974-2|P45974-2|USP5|NM_003481|NP...    987   1e-287
hg18||uc003fkg |3|NM_003940|Q92995|UBP13_HUMAN|USP13|NM_003940|N...    953   1e-277
hg18||uc003fkf |3|CR623689|NA|NA|USP13|NA|NA|Synthetic construct...    830   2e-240
hg18||uc001qri |12|X91349|P45974|UBP5_HUMAN|USP5|NM_003481|NP_00...    745   5e-215
hg18||uc003fkg |3|NM_003940|Q92995|UBP13_HUMAN|USP13|NM_003940|N...    181   5e-045
hg18||uc003fkg |3|NM_003940|Q92995|UBP13_HUMAN|USP13|NM_003940|N...    138   4e-032
hg18||uc001qri |12|X91349|P45974|UBP5_HUMAN|USP5|NM_003481|NP_00...    132   3e-030
hg18||uc001qri |12|X91349|P45974|UBP5_HUMAN|USP5|NM_003481|NP_00...     96   2e-019
hg18||uc001qri |12|X91349|P45974|UBP5_HUMAN|USP5|NM_003481|NP_00...     66   1e-010
hg18||uc001nuj |11|NM_015853|Q04323-2|Q04323-2|LOC51035|NM_01585...     52   4e-006
hg18||uc001nul |11|CR603968|Q04323|SAKS1_HUMAN|LOC51035|NM_01585...     52   4e-006
hg18||uc001num |11|CR603413|Q04323|SAKS1_HUMAN|LOC51035|NM_01585...     52   4e-006
hg18||uc004dun |X|NM_201286|Q70EK9|UBP51_HUMAN|USP51|NM_201286|N...     45   3e-004
hg18||uc001teg |12|NM_001042403|Q9H0E7|UBP44_HUMAN|USP44|NM_0010...     44   6e-004
hg18||uc001teh |12|NM_032147|Q9H0E7|UBP44_HUMAN|USP44|NM_032147|...     44   6e-004
hg18||uc002amf |15|NM_006537|Q8WVD0|Q8WVD0_HUMAN|USP3|NM_006537|...     44   6e-004
hg18||uc002amg |15|BX647760|NA|NA|USP3|NA|NA|Homo sapiens ubiqui...     44   6e-004
hg18||uc002amh |15|AY461579|Q6JHV3|Q6JHV3_HUMAN|USP3|NM_006537|N...     44   6e-004
hg18||uc002ami |15|AF077040|Q9Y2R8|Q9Y2R8_HUMAN|USP3|NM_006537|N...     44   6e-004
hg18||uc001bfb |1|NM_032236|Q86UV5|UBP48_HUMAN|USP48|NM_032236|N...     42   0.002
hg18||uc001bfc |1|BC104896|Q86UV5-2|Q86UV5-2|USP48|NM_032236|NP_...     42   0.002
hg18||uc001bfe |1|AK074247|Q86UV5-3|Q86UV5-3|USP48|NM_032236|NP_...     42   0.002
hg18||uc001bff |1|NM_001032730|Q86UV5-7|Q86UV5-7|USP48|NM_001032...     42   0.002
hg18||uc002qny |19|NM_020903|Q9HBJ7|UBP29_HUMAN|USP29|NM_020903|...     42   0.003
hg18||uc003ija |4|BC039115|Q3ZCV1|Q3ZCV1_HUMAN|USP38|NM_032557|N...     42   0.003
hg18||uc003ijb |4|NM_032557|Q8NB14|UBP38_HUMAN|USP38|NM_032557|N...     42   0.003
hg18||uc002kkf |18|NM_005151|P54578|UBP14_HUMAN|USP14|NM_005151|...     42   0.004
hg18||uc002kkg |18|NM_001037334|Q53XY5|Q53XY5_HUMAN|USP14|NM_001...     42   0.004
hg18||uc001poh |11|NM_020886|Q96RU2|UBP28_HUMAN|USP28|NM_020886|...     41   0.005
hg18||uc001poj |11|BC065928|Q6NZX9|Q6NZX9_HUMAN|USP28|NM_020886|...     41   0.005
hg18||uc002vie |2|AK128583|Q7Z3A5|Q7Z3A5_HUMAN|USP37|NM_020935|N...     40   0.009
hg18||uc002vif |2|BC133007|Q7Z3A5|Q7Z3A5_HUMAN|USP37|NM_020935|N...     40   0.009
hg18||uc002vig |2|BC112901|Q2KHT2|Q2KHT2_HUMAN|USP37|NM_020935|N...     40   0.009
hg18||uc002yjy |21|NM_013396|Q9UHP3-2|Q9UHP3-2|USP25|NM_013396|N...     40   0.009
hg18||uc002yjz |21|AF170562|Q9UHP3|UBP25_HUMAN|USP25|NM_013396|N...     40   0.009
hg18||uc003ori |6|NM_018561|Q70CQ1-2|Q70CQ1-2|USP49|NM_018561|NP...     40   0.009
hg18||uc001daj |1|NM_001017415|O94782|UBP1_HUMAN|USP1|NM_0010174...     40   0.015
hg18||uc001dak |1|NM_001017416|O94782|UBP1_HUMAN|USP1|NM_0010174...     40   0.015
hg18||uc001dal |1|NM_003368|O94782|UBP1_HUMAN|USP1|NM_003368|NP_...     40   0.015
hg18||uc001tsn |12|NM_006768|Q7Z569|BRAP_HUMAN|BRAP|NM_006768|NP...     39   0.019
hg18||uc001fye |1|NM_001014443|NA|NA|USP21|NM_001014443|NP_00101...     39   0.025
hg18||uc001fyf |1|NM_012475|NA|NA|USP21|NM_012475|NP_036607|ubiq...     39   0.025
hg18||uc001oze |11|AJ586137|NA|NA|KIAA1372|NA|NA|Homo sapiens mR...     39   0.025
hg18||uc001ozf |11|AB037793|NA|NA|KIAA1372|NA|NA|Homo sapiens mR...     39   0.025
hg18||uc002qny |19|NM_020903|Q9HBJ7|UBP29_HUMAN|USP29|NM_020903|...     39   0.033
hg18||uc004dhp |X|NM_004651|P51784|UBP11_HUMAN|USP11|NM_004651|N...     39   0.033
hg18||uc004dhq |X|AK055588|NA|NA|usp11|NA|NA|Homo sapiens usp11 ...     39   0.033
hg18||uc001dht |1|NM_015017|Q8TEY7|UBP33_HUMAN|USP33|NM_015017|N...     38   0.043
hg18||uc001dhu |1|NM_201624|Q8TEY7-2|Q8TEY7-2|USP33|NM_201624|NP...     38   0.043
hg18||uc001dhw |1|NM_201626|Q8TEY7-3|Q8TEY7-3|USP33|NM_201626|NP...     38   0.043
hg18||uc002gym |17|AB028986|Q9UPT9|UBP22_HUMAN|USP22|NA|NA|Ubiqu...     38   0.043
hg18||uc002gyn |17|BC110499|Q2NLE2|Q2NLE2_HUMAN|USP22|NA|NA|USP2...     38   0.043
hg18||uc004exa |X|NM_031907|Q9BXU7|UBP26_HUMAN|USP26|NM_031907|N...     38   0.043
hg18||uc001ozc |11|AK056231|NA|NA|KIAA1372|NA|NA|Homo sapiens mR...     37   0.074
hg18||uc001mjq |11|AX747455|Q96K76|UBP47_HUMAN|USP47|NM_017944|N...     37   0.096
hg18||uc001mjr |11|NM_017944|Q96K76-2|Q96K76-2|USP47|NM_017944|N...     37   0.096
hg18||uc001mjs |11|BC071559|Q96K76|UBP47_HUMAN|USP47|NM_017944|N...     37   0.096
hg18||uc001zyl |15|NM_005154|Q2TB31|Q2TB31_HUMAN|USP8|NM_005154|...     37   0.096
hg18||uc001zyn |15|D29956|P40818|UBP8_HUMAN|USP8|NM_005154|NP_00...     37   0.096
hg18||uc004byr |9|NM_006676|Q9Y2K6|UBP20_HUMAN|USP20|NM_006676|N...     37   0.125
hg18||uc004bys |9|BC033669|Q9Y2K6|UBP20_HUMAN|USP20|NM_006676|NP...     37   0.125
hg18||uc004byt |9|NM_001008563|Q9Y2K6|UBP20_HUMAN|USP20|NM_00100...     37   0.125
hg18||uc001srb |12|NM_006313|Q9Y4E8-2|Q9Y4E8-2|USP15|NM_006313|N...     36   0.164
hg18||uc001src |12|AF153604|Q9Y4E8|UBP15_HUMAN|USP15|NM_006313|N...     36   0.164
hg18||uc001pyi |11|NM_032873|Q8TF42|STS1_HUMAN|STS-1|NM_032873|N...     36   0.214
hg18||uc002vie |2|AK128583|Q7Z3A5|Q7Z3A5_HUMAN|USP37|NM_020935|N...     36   0.214
hg18||uc002vif |2|BC133007|Q7Z3A5|Q7Z3A5_HUMAN|USP37|NM_020935|N...     36   0.214
hg18||uc002vig |2|BC112901|Q2KHT2|Q2KHT2_HUMAN|USP37|NM_020935|N...     36   0.214
hg18||uc003cvz |3|BC014934|Q641Q9|Q641Q9_HUMAN|USP19|NM_006677|N...     35   0.279
hg18||uc003cwa |3|BC082241|Q641Q9|Q641Q9_HUMAN|USP19|NM_006677|N...     35   0.279
hg18||uc003cwb |3|BC106029|NA|NA|KIAA0891|NA|NA|Homo sapiens mRN...     35   0.279
hg18||uc003cwc |3|BC128088|Q641Q9|Q641Q9_HUMAN|USP19|NM_006677|N...     35   0.279
hg18||uc003cwd |3|NM_006677|O94966|UBP19_HUMAN|USP19|NM_006677|N...     35   0.279
hg18||uc004exa |X|NM_031907|Q9BXU7|UBP26_HUMAN|USP26|NM_031907|N...     35   0.279
hg18||uc001pwm |11|NM_004205|O75604|UBP2_HUMAN|USP2|NM_004205|NP...     35   0.477
hg18||uc002kkg |18|NM_001037334|Q53XY5|Q53XY5_HUMAN|USP14|NM_001...     35   0.477
hg18||uc004cgs |9|CR599174|Q9BSL1|UBDC1_HUMAN|UBADC1|NM_016172|N...     35   0.477
hg18||uc004cgt |9|NM_016172|Q9BSL1|UBDC1_HUMAN|UBADC1|NM_016172|...     35   0.477
hg18||uc002amf |15|NM_006537|Q8WVD0|Q8WVD0_HUMAN|USP3|NM_006537|...     34   0.623
hg18||uc002amg |15|BX647760|NA|NA|USP3|NA|NA|Homo sapiens ubiqui...     34   0.623
hg18||uc002amh |15|AY461579|Q6JHV3|Q6JHV3_HUMAN|USP3|NM_006537|N...     34   0.623
hg18||uc002kkf |18|NM_005151|P54578|UBP14_HUMAN|USP14|NM_005151|...     34   0.623
hg18||uc001pwl |11|NM_171997|Q8IUM2|Q8IUM2_HUMAN|USP2|NM_171997|...     34   0.813
hg18||uc001pwn |11|BC041366|O75604-2|O75604-2|USP2|NM_171997|NP_...     34   0.813
hg18||uc002zbe |21|NM_018961|P57075|STS2_HUMAN|UBASH3A|NM_018961...     34   0.813
hg18||uc002zbf |21|NM_001001895|P57075-2|P57075-2|UBASH3A|NM_001...     34   0.813
hg18||uc002vid |2|NM_020935|Q7Z3A5|Q7Z3A5_HUMAN|USP37|NM_020935|...     33   1.062
hg18||uc002sbe |2|NM_014709|NA|NA|USP34|NM_014709|NP_055524|ubiq...     33   1.387
hg18||uc002sbf |2|AL831918|NA|NA|KIAA0570|NA|NA|Homo sapiens mRN...     33   1.387
hg18||uc002vum |2|NM_018218|Q9NVE5|UBP40_HUMAN|USP40|NM_018218|N...     33   1.387
hg18||uc002gau |17|BX647719|P35125|UBP6_HUMAN|USP6|NM_004505|NP_...     32   2.366
hg18||uc002gav |17|NM_004505|P35125|UBP6_HUMAN|USP6|NM_004505|NP...     32   2.366
hg18||uc001vhz |13|BC030514|Q9H7E2|TDRD3_HUMAN|TDRD3|NM_030794|N...     32   3.090
hg18||uc001via |13|NM_030794|Q9H7E2|TDRD3_HUMAN|TDRD3|NM_030794|...     32   3.090
hg18||uc001vib |13|BC060876|Q5VUZ2|Q5VUZ2_HUMAN|TDRD3|NM_030794|...     32   3.090
hg18||uc002amf |15|NM_006537|Q8WVD0|Q8WVD0_HUMAN|USP3|NM_006537|...     32   3.090
hg18||uc002amg |15|BX647760|NA|NA|USP3|NA|NA|Homo sapiens ubiqui...     32   3.090
hg18||uc002amh |15|AY461579|Q6JHV3|Q6JHV3_HUMAN|USP3|NM_006537|N...     32   3.090
hg18||uc002ami |15|AF077040|Q9Y2R8|Q9Y2R8_HUMAN|USP3|NM_006537|N...     32   3.090
hg18||uc001uqy |13|NM_182488|O75317|UBP12_HUMAN|USP12|NM_182488|...     32   4.035

>hg18||uc001qrh
        |12|NM_003481|P45974-2|P45974-2|USP5|NM_003481|NP_003472|Ubiquitin
        isopeptidase T

          Length = 835

 Score =  987 bits (2550), Expect = 1e-287
 Identities = 480/856 (56%), Positives = 633/856 (73%), Gaps = 57/856 (6%)

Query:   7 ELLVPYMPTIRVPRTGDRVFKSECAFSFDSPESEGGLYVCMNTFLGFGREHVERHYRKTG 66
           | |.  .||||||. |||| | |||||||.||||||||.|||||||||...||||. |||
Sbjct:   7 EALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVERHFNKTG 66

Query:  67 QSVYMHLK--RHVKEKATGAAGGAIPRRRNGKVFLDLELNRDFNGDDYEYEDEAKLVIFP 124
           | ||.||.  |  ||.      |  ||..  .. . .|   | . . .| ... |.|| |
Sbjct:  67 QRVYLHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILP 126

Query: 125 DHFEIPLPNIEELPAL----VTIACDAVLNASSAYKKQEPESWDEEI-QVSRHARSLRQL 179
           |. ||    .  || .    || | .|.|.| || .||| ..|| |. |||.|| ||.||
Sbjct: 127 DYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHAFSLKQL 186

Query: 180 DNGVRIPPSGWKCQKCEMRENLWLNLTDGAVLCGKWFFDGSGGNGHALEHYRETSYPLAV 239
           ||  |||| |||| ||.||||||||||||..|||. .||||||| ||.|||||| |||||
Sbjct: 187 DNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAV 246

Query: 240 KMDTITPDGADIYSFEEEEAVLDPHISDHLSHFGIDMLQMQKRTENGHHRENNSRPRVSE 299
           |. ||||||||.||..|.. |||| ...||||||||||.|||  .     | .   |. |
Sbjct: 247 KLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDMNQRIGE 306

Query: 300 WEVIQESGMKLKAVFGSGYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYVGNLQRIFDYSP 359
           ||.|||||. || .|| |||||.||||.|||..|.||||||||||| ||  |..||  .|
Sbjct: 307 WELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEKIFQNAP 366

Query: 360 LDPSQDFATQMAKLGHGLLSGQYSKPPMKSELIEQVMNEEHKMLNWHQQKGVSPRMLKAL 419
            ||.|||.||.||||||||||.||||  .|   |.|  ..        | |..||| |||
Sbjct: 367 TDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQK------EVQDGIAPRMFKAL 420

Query: 420 VSRGHPEFSSNRQQDAHEFLLHLINLVERNSAGSENPSDVFRFLVEERVQCCQSRQVRYS 479
           . .||||||.|||||| || |||||.||||   ||||..|||||||||..|  . .|.|.
Sbjct: 421 IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEERIKCLATEKVKYT 480

Query: 480 QRVDYCIQLPAPLEAAINREELLTYEAKKKEAEENMQPPPEPVRARIPFTACLQAFTEPE 539
           ||||| .||| |..||.|.|||| || ||..|||     || |||..||..||.|.  ||
Sbjct: 481 QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPE 540

Query: 540 NVPDFWSSALQAKSAGVKTSRFASFPEYLILQIKKFTFGVDWVPKKLDNSMSSIDFIDAV 599
            | ||||.||||||  |||.||||||.||..||||||||.|||||||| |.   . .|  
Sbjct: 541 QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS 600

Query: 600 FV-----------------------SLAAPEIDEAAVMQLAEMGFPLEACRKAVYYTGNM 636
            .                          || .||. ..|| |||||..||||||||| | 
Sbjct: 601 QLRGTGLQPGEEELPDIAPPLVTPDEPKAPMLDESVIIQLVEMGFPMDACRKAVYYTDNS 660

Query: 637 GPEMAFNWIIAHMEEPDFAEPLTLPSLMDSAPSTSDSVMGATPLDPNPPPEESISILTSM 696
           | | | ||...||..|||| || ||    | |       |.|    .||||. .. . ||
Sbjct: 661 GAEAAMNWVMSHMDDPDFANPLILPG--SSGP-------GSTSAAADPPPEDCVTTIVSM 711

Query: 697 GFPRTHSINALKAMNNNLERALDWIFTHPEPEESDALSDMADTEPNDNAFSNANSHSDAT 756
           || |  .. ||.| ||.||||.||||.| .  ...|  |...        | |.| |.. 
Sbjct: 712 GFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGR------SAADSISESV 765

Query: 757 LSPDRDTTGPRIKDGPGRYELFAFISHMGESTMSGHYVCHIKKEGRWVIYNDHKVCLSER 816
                   ||...||||.|.||||||||| ||| |||||||||||||||||| ||| ||.
Sbjct: 766 ------PVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEK 819

Query: 817 PPKDLGYIYFYHRLSS 832
           ||||||||||| |..|
Sbjct: 820 PPKDLGYIYFYQRVAS 835

>hg18||uc003fkg
        |3|NM_003940|Q92995|UBP13_HUMAN|USP13|NM_003940|NP_003931|ubiquitin
        specific protease 13 (isopeptidase

          Length = 863

 Score =  953 bits (2463), Expect = 1e-277
 Identities = 449/596 (75%), Positives = 523/596 (87%), Gaps = 6/596 (1%)

Query:   2 ATDLGELLVPYMPTIRVPRTGDRVFKSECAFSFDSPESEGGLYVCMNTFLGFGREHVERH 61
           | |.||||||.||||||||.||||.|.|||||.||| ||||||||||||| |||||||||
Sbjct:  21 AGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEGGLYVCMNTFLAFGREHVERH 80

Query:  62 YRKTGQSVYMHLKRHVKEKATGAAGGAIPRRRNGKVFLDLELNRDFNGDDYEYEDEAKLV 121
           .|||||||||||||| .||  ||.|||.|.||| |.||||. . | | ||||||||||||
Sbjct:  81 FRKTGQSVYMHLKRHAREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLV 140

Query: 122 IFPDHFEIPLPNIEELPALVTIACDAVLNASSAYKKQEPESWDEEIQVSRHARSLRQLDN 181
           |||||.|| |||||||||||||||||||.. | |.||.|..|. |. ||..| .| ||||
Sbjct: 141 IFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDN 200

Query: 182 GVRIPPSGWKCQKCEMRENLWLNLTDGAVLCGKWFFDGSGGNGHALEHYRETSYPLAVKM 241
           ||||||||||| .|..|||||||||||.||||||||| ||||||||||||.  ||||||.
Sbjct: 201 GVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKL 260

Query: 242 DTITPDGADIYSFEEEEAVLDPHISDHLSHFGIDMLQMQKRTENGHHRENNSRPRVSEWE 301
            ||||||||.|||.||| |||||.. ||.||||||| |   ||||  ..|. . ||||||
Sbjct: 261 GTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMH-GTENG-LQDNDIKLRVSEWE 318

Query: 302 VIQESGMKLKAVFGSGYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYVGNLQRIFDYSPLD 361
           |||||| ||| ..| ||||.|||||.||||.||| .||||.||| ||||| |||||||||
Sbjct: 319 VIQESGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEFQRAYVGNLPRIFDYSPLD 378

Query: 362 PSQDFATQMAKLGHGLLSGQYSKPPMKSELIEQVMNEEHKMLNWHQQKGVSPRMLKALVS 421
           |.||| ||| |||||||||||||||.||||||||| ||||     || |.|||| || ||
Sbjct: 379 PTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHK----PQQNGISPRMFKAFVS 434

Query: 422 RGHPEFSSNRQQDAHEFLLHLINLVERNSAGSENPSDVFRFLVEERVQCCQSRQVRYSQR 481
           . |||||||||||| || |||.||||||  ||||||||||||||||.||||.|.|||..|
Sbjct: 435 KSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEERIQCCQTRKVRYTER 494

Query: 482 VDYCIQLPAPLEAAINREELLTYEAKKKEAEENMQPPPEPVRARIPFTACLQAFTEPENV 541
           ||| .|||  .||| |..||. ||  ..||| | .| || |||.|||.||||||.|||||
Sbjct: 495 VDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIPFSACLQAFSEPENV 554

Query: 542 PDFWSSALQAKSAGVKTSRFASFPEYLILQIKKFTFGVDWVPKKLDNSMSSIDFID 597
            ||||||||||||||||||||||||||..||||||||.|||||| | |.   | .|
Sbjct: 555 DDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFDVSIDMPDLLD 610

>hg18||uc003fkf |3|CR623689|NA|NA|USP13|NA|NA|Synthetic construct Homo sapiens
        mRNA for hypothetical protein (USP13 gene), clone IMAGE:3910925.1E1

          Length = 560

 Score =  830 bits (2142), Expect = 2e-240
 Identities = 389/519 (74%), Positives = 455/519 (87%), Gaps = 6/519 (1%)

Query:   2 ATDLGELLVPYMPTIRVPRTGDRVFKSECAFSFDSPESEGGLYVCMNTFLGFGREHVERH 61
           | |.||||||.||||||||.||||.|.|||||.||| ||||||||||||| |||||||||
Sbjct:  21 AGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEGGLYVCMNTFLAFGREHVERH 80

Query:  62 YRKTGQSVYMHLKRHVKEKATGAAGGAIPRRRNGKVFLDLELNRDFNGDDYEYEDEAKLV 121
           .|||||||||||||||.||  ||.|||.|.||| |.||||. . | | ||||||||||||
Sbjct:  81 FRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLV 140

Query: 122 IFPDHFEIPLPNIEELPALVTIACDAVLNASSAYKKQEPESWDEEIQVSRHARSLRQLDN 181
           |||||.|| |||||||||||||||||||.. | |.||.|..|. |. ||..| .| ||||
Sbjct: 141 IFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDN 200

Query: 182 GVRIPPSGWKCQKCEMRENLWLNLTDGAVLCGKWFFDGSGGNGHALEHYRETSYPLAVKM 241
           ||||||||||| .|..|||||||||||.||||||||| ||||||||||||.  ||||||.
Sbjct: 201 GVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKL 260

Query: 242 DTITPDGADIYSFEEEEAVLDPHISDHLSHFGIDMLQMQKRTENGHHRENNSRPRVSEWE 301
            ||||||||.|||.||| |||||.. ||.||||||| |   ||||  ..|. . ||||||
Sbjct: 261 GTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMH-GTENG-LQDNDIKLRVSEWE 318

Query: 302 VIQESGMKLKAVFGSGYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYVGNLQRIFDYSPLD 361
           |||||| ||| ..| ||||.|||||.||||.||| .||||.||| ||||| |||||||||
Sbjct: 319 VIQESGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEFQRAYVGNLPRIFDYSPLD 378

Query: 362 PSQDFATQMAKLGHGLLSGQYSKPPMKSELIEQVMNEEHKMLNWHQQKGVSPRMLKALVS 421
           |.||| ||| |||||||||||||||.||||||||| ||||     || |.|||| || ||
Sbjct: 379 PTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHK----PQQNGISPRMFKAFVS 434

Query: 422 RGHPEFSSNRQQDAHEFLLHLINLVERNSAGSENPSDVFRFLVEERVQCCQSRQVRYSQR 481
           . |||||||||||| || |||.||||||  ||||||||||||||||.||||.|.|||..|
Sbjct: 435 KSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEERIQCCQTRKVRYTER 494

Query: 482 VDYCIQLPAPLEAAINREELLTYEAKKKEAEENMQPPPE 520
           ||| .|||  .||| |..||. ||  ..||| | .| ||
Sbjct: 495 VDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPE 533

>hg18||uc001qri |12|X91349|P45974|UBP5_HUMAN|USP5|NM_003481|NP_003472|Ubiquitin
        isopeptidase T

          Length = 858

 Score =  745 bits (1923), Expect = 5e-215
 Identities = 355/598 (59%), Positives = 467/598 (78%), Gaps = 13/598 (2%)

Query:   7 ELLVPYMPTIRVPRTGDRVFKSECAFSFDSPESEGGLYVCMNTFLGFGREHVERHYRKTG 66
           | |.  .||||||. |||| | |||||||.||||||||.|||||||||...||||. |||
Sbjct:   7 EALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVERHFNKTG 66

Query:  67 QSVYMHLK--RHVKEKATGAAGGAIPRRRNGKVFLDLELNRDFNGDDYEYEDEAKLVIFP 124
           | ||.||.  |  ||.      |  ||..  .. . .|   | . . .| ... |.|| |
Sbjct:  67 QRVYLHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILP 126

Query: 125 DHFEIPLPNIEELPAL----VTIACDAVLNASSAYKKQEPESWDEEI-QVSRHARSLRQL 179
           |. ||    .  || .    || | .|.|.| || .||| ..|| |. |||.|| ||.||
Sbjct: 127 DYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHAFSLKQL 186

Query: 180 DNGVRIPPSGWKCQKCEMRENLWLNLTDGAVLCGKWFFDGSGGNGHALEHYRETSYPLAV 239
           ||  |||| |||| ||.||||||||||||..|||. .||||||| ||.|||||| |||||
Sbjct: 187 DNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAV 246

Query: 240 KMDTITPDGADIYSFEEEEAVLDPHISDHLSHFGIDMLQMQKRTENGHHRENNSRPRVSE 299
           |. ||||||||.||..|.. |||| ...||||||||||.|||  .     | .   |. |
Sbjct: 247 KLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDMNQRIGE 306

Query: 300 WEVIQESGMKLKAVFGSGYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYVGNLQRIFDYSP 359
           ||.|||||. || .|| |||||.||||.|||..|.||||||||||| ||  |..||  .|
Sbjct: 307 WELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEKIFQNAP 366

Query: 360 LDPSQDFATQMAKLGHGLLSGQYSKPPMKSELIEQVMNEEHKMLNWHQQKGVSPRMLKAL 419
            ||.|||.||.||||||||||.||||  .|   |.|  ..        | |..||| |||
Sbjct: 367 TDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQK------EVQDGIAPRMFKAL 420

Query: 420 VSRGHPEFSSNRQQDAHEFLLHLINLVERNSAGSENPSDVFRFLVEERVQCCQSRQVRYS 479
           . .||||||.|||||| || |||||.||||   ||||..||||||||...|  . .|.|.
Sbjct: 421 IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT 480

Query: 480 QRVDYCIQLPAPLEAAINREELLTYEAKKKEAEENMQPPPEPVRARIPFTACLQAFTEPE 539
           ||||| .||| |..||.|.|||| || ||..|||     || |||..||..||.|.  ||
Sbjct: 481 QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPE 540

Query: 540 NVPDFWSSALQAKSAGVKTSRFASFPEYLILQIKKFTFGVDWVPKKLDNSMSSIDFID 597
            | ||||.||||||  |||.||||||.||..||||||||.|||||||| |.   . .|
Sbjct: 541 QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELD 598

>hg18||uc003fkg
        |3|NM_003940|Q92995|UBP13_HUMAN|USP13|NM_003940|NP_003931|ubiquitin
        specific protease 13 (isopeptidase

          Length = 863

 Score =  181 bits (457), Expect = 5e-045
 Identities = 92/143 (64%), Positives = 106/143 (74%), Gaps = 2/143 (1%)

Query: 607 EIDEAAVMQLAEMGFPLEACRKAVYYTGNMGPEMAFNWIIAHMEEPDFAEPLTLPSLMDS 666
           .|||..|||||||||||||||||||.||||| |.|||||| ||||||||||||.|     
Sbjct: 652 DIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPG-YGG 710

Query: 667 APSTSDSVMGATPLDPNPPPEESISILTSMGFPRTHSINALKAMNNNLERALDWIFTHPE 726
           | |   || ||. || | |||| ..|.||||| |  .| ||.| ||||||||||||.|||
Sbjct: 711 AASAGASVFGASGLD-NQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPE 769

Query: 727 PEESDALSDMADTEPNDNAFSNA 749
            ||        .   | |  | |
Sbjct: 770 FEEDSDFVIEMENNANANIISEA 792

>hg18||uc003fkg
        |3|NM_003940|Q92995|UBP13_HUMAN|USP13|NM_003940|NP_003931|ubiquitin
        specific protease 13 (isopeptidase

          Length = 863

 Score =  138 bits (346), Expect = 4e-032
 Identities = 62/86 (72%), Positives = 71/86 (82%), Gaps = 4/86 (4%)

Query: 747 SNANSHSDATLSPDRDTTGPRIKDGPGRYELFAFISHMGESTMSGHYVCHIKKEGRWVIY 806
           .|||..  .   |.    |||.||| | ||||||||||| |||||||.||||||||||||
Sbjct: 782 NNANANIISEAKPE----GPRVKDGSGTYELFAFISHMGTSTMSGHYICHIKKEGRWVIY 837

Query: 807 NDHKVCLSERPPKDLGYIYFYHRLSS 832
           |||||| ||||||||||.||| |. |
Sbjct: 838 NDHKVCASERPPKDLGYMYFYRRIPS 863

>hg18||uc001qri |12|X91349|P45974|UBP5_HUMAN|USP5|NM_003481|NP_003472|Ubiquitin
        isopeptidase T

          Length = 858

 Score =  132 bits (330), Expect = 3e-030
 Identities = 55/68 (80%), Positives = 63/68 (92%)

Query: 765 GPRIKDGPGRYELFAFISHMGESTMSGHYVCHIKKEGRWVIYNDHKVCLSERPPKDLGYI 824
           ||...||||.|.||||||||| ||| |||||||||||||||||| ||| ||.||||||||
Sbjct: 791 GPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKPPKDLGYI 850

Query: 825 YFYHRLSS 832
           ||| |..|
Sbjct: 851 YFYQRVAS 858

>hg18||uc001qri |12|X91349|P45974|UBP5_HUMAN|USP5|NM_003481|NP_003472|Ubiquitin
        isopeptidase T

          Length = 858

 Score =  96 bits (236), Expect = 2e-019
 Identities = 43/87 (49%), Positives = 58/87 (66%), Gaps = 2/87 (2%)

Query: 595 FIDAVFVSLAAPEIDEAAVMQLAEMGFPLEACRKAVYYTGNMGPEMAFNWIIAHMEEPDF 654
           |    | |  .| .||. ..|| |||||..||||||||||| | | | ||...||..|||
Sbjct: 642 FCSPHFSSPTSPMLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDF 701

Query: 655 AEPLTLPSLMDSAPSTSDSVMGATPLD 681
           | || ||    | | .. .     | |
Sbjct: 702 ANPLILPG--SSGPGSTSAAADPPPED 726

>hg18||uc001qri |12|X91349|P45974|UBP5_HUMAN|USP5|NM_003481|NP_003472|Ubiquitin
        isopeptidase T

          Length = 858

 Score =  66 bits (160), Expect = 1e-010
 Identities = 27/63 (42%), Positives = 46/63 (73%)

Query: 676 GATPLDPNPPPEESISILTSMGFPRTHSINALKAMNNNLERALDWIFTHPEPEESDALSD 735
           |.|    .||||. .. . |||| |  .. ||.| ||.||||.||||.| .  ...|  |
Sbjct: 714 GSTSAAADPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMD 773

Query: 736 MAD 738
           ...
Sbjct: 774 ISE 776

>hg18||uc001nuj
        |11|NM_015853|Q04323-2|Q04323-2|LOC51035|NM_015853|NP_056937|SAPK
        substrate protein 1

          Length = 312

 Score =  52 bits (122), Expect = 4e-006
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 612 AVMQLAEMGFPLEACRKAVYYTGNMGPEMAFNWIIAHMEEPDFAEPLTLP--SLMDSAPS 669
           |.  | |||||     ||.  ||| | | | .|.. | ..||  |||  |   ..   |.
Sbjct:   6 ALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPT 65

Query: 670 TSD 672
           .|.
Sbjct:  66 SSE 68

>hg18||uc001nul
        |11|CR603968|Q04323|SAKS1_HUMAN|LOC51035|NM_015853|NP_056937|SAPK
        substrate protein 1

          Length = 297

 Score =  52 bits (122), Expect = 4e-006
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 612 AVMQLAEMGFPLEACRKAVYYTGNMGPEMAFNWIIAHMEEPDFAEPLTLP--SLMDSAPS 669
           |.  | |||||     ||.  ||| | | | .|.. | ..||  |||  |   ..   |.
Sbjct:   6 ALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPT 65

Query: 670 TSD 672
           .|.
Sbjct:  66 SSE 68

>hg18||uc001num
        |11|CR603413|Q04323|SAKS1_HUMAN|LOC51035|NM_015853|NP_056937|SAPK
        substrate protein 1

          Length = 293

 Score =  52 bits (122), Expect = 4e-006
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 612 AVMQLAEMGFPLEACRKAVYYTGNMGPEMAFNWIIAHMEEPDFAEPLTLP--SLMDSAPS 669
           |.  | |||||     ||.  ||| | | | .|.. | ..||  |||  |   ..   |.
Sbjct:   6 ALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPT 65

Query: 670 TSD 672
           .|.
Sbjct:  66 SSE 68

>hg18||uc004dun
        |X|NM_201286|Q70EK9|UBP51_HUMAN|USP51|NM_201286|NP_958443|ubiquitin
        specific protease 51

          Length = 711

 Score =  45 bits (106), Expect = 3e-004
 Identities = 31/141 (21%), Positives = 66/141 (46%), Gaps = 5/141 (3%)

Query: 269 LSHFGIDMLQMQKRTENGHHRENNSRPRVSEWEVIQ-ESGMKLKAVFGSGYTGIKNLGNT 327
           |.    |.   |  |     ...    .  | .... .   . |.|.  |  |. |||||
Sbjct: 312 LTSTSTDVSHQQFMTSGFEDKQSTCETKEQEPKLVKPKKKRRKKSVYTVGLRGLINLGNT 371

Query: 328 CYLSTVMQVLFSIPDFQRMYVGNLQRIFDYSPLDPSQDFATQMAKLGHGLLSGQYSKPPM 387
           |... ..| |  ||  .  .. .  .    |   ||     .|. | | . ||  . | .
Sbjct: 372 CFMNCIVQALTHIPLLKDFFLSDKHKCIMTS---PSLCLVCEMSSLFHAMYSGSRT-PHI 427

Query: 388 KSELIEQVMNEEHKMLNWHQQ 408
             .|.  .      .  . ||
Sbjct: 428 PYKLLHLIWIHAEHLAGYRQQ 448

>hg18||uc001teg
        |12|NM_001042403|Q9H0E7|UBP44_HUMAN|USP44|NM_001042403|NP_001035862|ubi
        quitin specific protease 44

          Length = 712

 Score =  44 bits (103), Expect = 6e-004
 Identities = 17/46 (36%), Positives = 33/46 (71%)

Query: 303 IQESGMKLKAVFGSGYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYV 348
           . .| .| . .   | ||..|||||||...|.|||  .  |.. ..
Sbjct: 257 VSDSSVKRRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQCFL 302

>hg18||uc001teh
        |12|NM_032147|Q9H0E7|UBP44_HUMAN|USP44|NM_032147|NP_115523|ubiquitin
        specific protease 44

          Length = 712

 Score =  44 bits (103), Expect = 6e-004
 Identities = 17/46 (36%), Positives = 33/46 (71%)

Query: 303 IQESGMKLKAVFGSGYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYV 348
           . .| .| . .   | ||..|||||||...|.|||  .  |.. ..
Sbjct: 257 VSDSSVKRRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQCFL 302

>hg18||uc002amf
        |15|NM_006537|Q8WVD0|Q8WVD0_HUMAN|USP3|NM_006537|NP_006528|ubiquitin
        specific protease 3

          Length = 520

 Score =  44 bits (103), Expect = 6e-004
 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 775 YELFAFISHMGESTMSGHYVCHIKKEGRWVIYNDHKVCLS--ERPPKDLGYIYFY 827
           |.| | . | |    ||||  .   ||||  .||  | |.  |   |   || ||
Sbjct: 454 YDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFY 508

>hg18||uc002amg |15|BX647760|NA|NA|USP3|NA|NA|Homo sapiens ubiquitin-specific
        protease 3 (USP3) mRNA, complete cds

          Length = 435

 Score =  44 bits (103), Expect = 6e-004
 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 775 YELFAFISHMGESTMSGHYVCHIKKEGRWVIYNDHKVCLS--ERPPKDLGYIYFY 827
           |.| | . | |    ||||  .   ||||  .||  | |.  |   |   || ||
Sbjct: 369 YDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFY 423

>hg18||uc002amh
        |15|AY461579|Q6JHV3|Q6JHV3_HUMAN|USP3|NM_006537|NP_006528|ubiquitin
        specific protease 3

          Length = 498

 Score =  44 bits (103), Expect = 6e-004
 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 775 YELFAFISHMGESTMSGHYVCHIKKEGRWVIYNDHKVCLS--ERPPKDLGYIYFY 827
           |.| | . | |    ||||  .   ||||  .||  | |.  |   |   || ||
Sbjct: 432 YDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFY 486

>hg18||uc002ami
        |15|AF077040|Q9Y2R8|Q9Y2R8_HUMAN|USP3|NM_006537|NP_006528|ubiquitin
        specific protease 3

          Length = 351

 Score =  44 bits (103), Expect = 6e-004
 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 775 YELFAFISHMGESTMSGHYVCHIKKEGRWVIYNDHKVCLS--ERPPKDLGYIYFY 827
           |.| | . | |    ||||  .   ||||  .||  | |.  |   |   || ||
Sbjct: 285 YDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFY 339

>hg18||uc001bfb
        |1|NM_032236|Q86UV5|UBP48_HUMAN|USP48|NM_032236|NP_115612|ubiquitin
        specific protease 48 isoform a

          Length = 1035

 Score =  42 bits (98), Expect = 0.002
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 769 KDGPGRYELFAFISHMGESTMSGHYVCHIK--KEGRWVIYNDHKVCLSERPPKDLG 822
           | |   ||| | . | | |  ||||. |.|  . | |  .||  .   |     ||
Sbjct: 330 KGGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLG 385

>hg18||uc001bfc
        |1|BC104896|Q86UV5-2|Q86UV5-2|USP48|NM_032236|NP_115612|ubiquitin
        specific protease 48 isoform a

          Length = 983

 Score =  42 bits (98), Expect = 0.002
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 769 KDGPGRYELFAFISHMGESTMSGHYVCHIK--KEGRWVIYNDHKVCLSERPPKDLG 822
           | |   ||| | . | | |  ||||. |.|  . | |  .||  .   |     ||
Sbjct: 330 KGGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLG 385

>hg18||uc001bfe
        |1|AK074247|Q86UV5-3|Q86UV5-3|USP48|NM_032236|NP_115612|ubiquitin
        specific protease 48 isoform a

          Length = 629

 Score =  42 bits (98), Expect = 0.002
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 769 KDGPGRYELFAFISHMGESTMSGHYVCHIK--KEGRWVIYNDHKVCLSERPPKDLG 822
           | |   ||| | . | | |  ||||. |.|  . | |  .||  .   |     ||
Sbjct: 330 KGGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLG 385

>hg18||uc001bff
        |1|NM_001032730|Q86UV5-7|Q86UV5-7|USP48|NM_001032730|NP_001027902|ubiqu
        itin specific protease 48 isoform b

          Length = 485

 Score =  42 bits (98), Expect = 0.002
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 769 KDGPGRYELFAFISHMGESTMSGHYVCHIK--KEGRWVIYNDHKVCLSERPPKDLG 822
           | |   ||| | . | | |  ||||. |.|  . | |  .||  .   |     ||
Sbjct: 330 KGGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLG 385

>hg18||uc002qny
        |19|NM_020903|Q9HBJ7|UBP29_HUMAN|USP29|NM_020903|NP_065954|ubiquitin
        specific protease 29

          Length = 922

 Score =  42 bits (97), Expect = 0.003
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 15/100 (15%)

Query: 737 ADTEPNDNAFSNANSHSDATLSPDRDTTGPRIKDGPGRYELFAFISHMGESTMSGHYVCH 796
           .|   | |     |.  .|       |   .. |    | | . .||.| |  ||||.  
Sbjct: 789 SDNPGNKNILDAENTRGEA----KELTRNVKMGDPLQAYRLISVVSHIGSSPNSGHYISD 844

Query: 797 IK--KEGRWVIYNDHKVCLSERPPKDL-------GYIYFY 827
           .   ..  |  |||  .|.||     .       |||.||
Sbjct: 845 VYDFQKQAWFTYND--LCVSEISETKMQEARLHSGYIFFY 882

>hg18||uc003ija
        |4|BC039115|Q3ZCV1|Q3ZCV1_HUMAN|USP38|NM_032557|NP_115946|ubiquitin
        specific protease 38

          Length = 1004

 Score =  42 bits (97), Expect = 0.003
 Identities = 17/30 (56%), Positives = 24/30 (80%)

Query: 316 SGYTGIKNLGNTCYLSTVMQVLFSIPDFQR 345
           .| ||. |||||||...|.| ||   ||.|
Sbjct: 442 TGKTGLINLGNTCYMNSVIQALFMATDFRR 471

>hg18||uc003ijb
        |4|NM_032557|Q8NB14|UBP38_HUMAN|USP38|NM_032557|NP_115946|ubiquitin
        specific protease 38

          Length = 1042

 Score =  42 bits (97), Expect = 0.003
 Identities = 17/30 (56%), Positives = 24/30 (80%)

Query: 316 SGYTGIKNLGNTCYLSTVMQVLFSIPDFQR 345
           .| ||. |||||||...|.| ||   ||.|
Sbjct: 442 TGKTGLINLGNTCYMNSVIQALFMATDFRR 471

>hg18||uc002kkf
        |18|NM_005151|P54578|UBP14_HUMAN|USP14|NM_005151|NP_005142|ubiquitin
        specific protease 14 isoform a

          Length = 494

 Score =  42 bits (96), Expect = 0.004
 Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 773 GRYELFAFISHMGESTMSGHYVCHIK-KEGRWVIYNDHKVCL 813
           | |.| | ..| | |. |||||  .| |.  |. ..| || .
Sbjct: 416 GYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSI 457

>hg18||uc002kkg
        |18|NM_001037334|Q53XY5|Q53XY5_HUMAN|USP14|NM_001037334|NP_001032411|ub
        iquitin specific protease 14 isoform b

          Length = 459

 Score =  42 bits (96), Expect = 0.004
 Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 773 GRYELFAFISHMGESTMSGHYVCHIK-KEGRWVIYNDHKVCL 813
           | |.| | ..| | |. |||||  .| |.  |. ..| || .
Sbjct: 381 GYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSI 422

>hg18||uc001poh
        |11|NM_020886|Q96RU2|UBP28_HUMAN|USP28|NM_020886|NP_065937|ubiquitin
        specific protease 28

          Length = 1077

 Score =  41 bits (95), Expect = 0.005
 Identities = 15/27 (55%), Positives = 23/27 (85%)

Query: 320 GIKNLGNTCYLSTVMQVLFSIPDFQRM 346
           |.||.||||. | |.| || .|.|.|.
Sbjct: 163 GLKNVGNTCWFSAVIQSLFQLPEFRRL 189

>hg18||uc001poj
        |11|BC065928|Q6NZX9|Q6NZX9_HUMAN|USP28|NM_020886|NP_065937|ubiquitin
        specific protease 28

          Length = 583

 Score =  41 bits (95), Expect = 0.005
 Identities = 15/27 (55%), Positives = 23/27 (85%)

Query: 320 GIKNLGNTCYLSTVMQVLFSIPDFQRM 346
           |.||.||||. | |.| || .|.|.|.
Sbjct: 163 GLKNVGNTCWFSAVIQSLFQLPEFRRL 189

>hg18||uc002vie
        |2|AK128583|Q7Z3A5|Q7Z3A5_HUMAN|USP37|NM_020935|NP_065986|ubiquitin
        specific protease 37

          Length = 979

 Score =  40 bits (93), Expect = 0.009
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 772 PGRYELFAFISHMGESTMSGHYVCHIK--KEGRWVIYNDHKVCLSERPPKD-----LGYI 824
           |  | | . .||.| .. ||||.  .   |.  |  ||| .|   .           |||
Sbjct: 886 PHSYRLISVVSHIGSTSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEAAVQSDRDRSGYI 945

Query: 825 YFY 827
           .||
Sbjct: 946 FFY 948

>hg18||uc002vif
        |2|BC133007|Q7Z3A5|Q7Z3A5_HUMAN|USP37|NM_020935|NP_065986|ubiquitin
        specific protease 37

          Length = 979

 Score =  40 bits (93), Expect = 0.009
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 772 PGRYELFAFISHMGESTMSGHYVCHIK--KEGRWVIYNDHKVCLSERPPKD-----LGYI 824
           |  | | . .||.| .. ||||.  .   |.  |  ||| .|   .           |||
Sbjct: 886 PHSYRLISVVSHIGSTSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEAAVQSDRDRSGYI 945

Query: 825 YFY 827
           .||
Sbjct: 946 FFY 948

>hg18||uc002vig
        |2|BC112901|Q2KHT2|Q2KHT2_HUMAN|USP37|NM_020935|NP_065986|ubiquitin
        specific protease 37

          Length = 885

 Score =  40 bits (93), Expect = 0.009
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 772 PGRYELFAFISHMGESTMSGHYVCHIK--KEGRWVIYNDHKVCLSERPPKD-----LGYI 824
           |  | | . .||.| .. ||||.  .   |.  |  ||| .|   .           |||
Sbjct: 792 PHSYRLISVVSHIGSTSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEAAVQSDRDRSGYI 851

Query: 825 YFY 827
           .||
Sbjct: 852 FFY 854

>hg18||uc002yjy
        |21|NM_013396|Q9UHP3-2|Q9UHP3-2|USP25|NM_013396|NP_037528|ubiquitin
        specific protease 25

          Length = 1055

 Score =  40 bits (93), Expect = 0.009
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 7/46 (15%)

Query: 320 GIKNLGNTCYLSTVMQVLFSIPDFQRMYVGNLQRIFDYSPLDPSQD 365
           |.||.||||. | |.| ||.. .|.|.       . .| |   .||
Sbjct: 170 GLKNVGNTCWFSAVIQSLFNLLEFRRL-------VLNYKPPSNAQD 208

>hg18||uc002yjz
        |21|AF170562|Q9UHP3|UBP25_HUMAN|USP25|NM_013396|NP_037528|ubiquitin
        specific protease 25

          Length = 1087

 Score =  40 bits (93), Expect = 0.009
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 7/46 (15%)

Query: 320 GIKNLGNTCYLSTVMQVLFSIPDFQRMYVGNLQRIFDYSPLDPSQD 365
           |.||.||||. | |.| ||.. .|.|.       . .| |   .||
Sbjct: 170 GLKNVGNTCWFSAVIQSLFNLLEFRRL-------VLNYKPPSNAQD 208

>hg18||uc003ori
        |6|NM_018561|Q70CQ1-2|Q70CQ1-2|USP49|NM_018561|NP_061031|ubiquitin
        specific protease 49

          Length = 640

 Score =  40 bits (93), Expect = 0.009
 Identities = 14/41 (34%), Positives = 28/41 (68%)

Query: 308 MKLKAVFGSGYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYV 348
           .. .     | ||..|||||||.....|||  .  |.  ..
Sbjct: 242 LRRQPAMAPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFL 282

>hg18||uc001daj
        |1|NM_001017415|O94782|UBP1_HUMAN|USP1|NM_001017415|NP_001017415|ubiqui
        tin specific protease 1

          Length = 785

 Score =  40 bits (91), Expect = 0.015
 Identities = 14/27 (51%), Positives = 22/27 (81%)

Query: 318 YTGIKNLGNTCYLSTVMQVLFSIPDFQ 344
           . |. ||||||||....|||.  | |.
Sbjct:  80 FVGLNNLGNTCYLNSILQVLYFCPGFK 106

>hg18||uc001dak
        |1|NM_001017416|O94782|UBP1_HUMAN|USP1|NM_001017416|NP_001017416|ubiqui
        tin specific protease 1

          Length = 785

 Score =  40 bits (91), Expect = 0.015
 Identities = 14/27 (51%), Positives = 22/27 (81%)

Query: 318 YTGIKNLGNTCYLSTVMQVLFSIPDFQ 344
           . |. ||||||||....|||.  | |.
Sbjct:  80 FVGLNNLGNTCYLNSILQVLYFCPGFK 106

>hg18||uc001dal
        |1|NM_003368|O94782|UBP1_HUMAN|USP1|NM_003368|NP_003359|ubiquitin
        specific protease 1

          Length = 785

 Score =  40 bits (91), Expect = 0.015
 Identities = 14/27 (51%), Positives = 22/27 (81%)

Query: 318 YTGIKNLGNTCYLSTVMQVLFSIPDFQ 344
           . |. ||||||||....|||.  | |.
Sbjct:  80 FVGLNNLGNTCYLNSILQVLYFCPGFK 106

>hg18||uc001tsn |12|NM_006768|Q7Z569|BRAP_HUMAN|BRAP|NM_006768|NP_006759|BRCA1
        associated protein

          Length = 592

 Score =  39 bits (90), Expect = 0.019
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 6/51 (11%)

Query: 191 KCQKCEMRENLWLNLTDGAVLCGKWFFDGSGGNGHALEHYRETSYPLAVKM 241
           || .| ..||||. |  | . ||..       . || .|. || .  |...
Sbjct: 316 KCFECGVQENLWICLICGHIGCGRYV------SRHAYKHFEETQHTYAMQL 360

>hg18||uc001fye
        |1|NM_001014443|NA|NA|USP21|NM_001014443|NP_001014443|ubiquitin-specifi
        c protease 21

          Length = 565

 Score =  39 bits (89), Expect = 0.025
 Identities = 15/27 (55%), Positives = 22/27 (81%)

Query: 313 VFGSGYTGIKNLGNTCYLSTVMQVLFS 339
           . |||. |..||||||.|. |.| | |
Sbjct: 206 LLGSGHVGLRNLGNTCFLNAVLQCLSS 232

>hg18||uc001fyf |1|NM_012475|NA|NA|USP21|NM_012475|NP_036607|ubiquitin-specific
        protease 21

          Length = 565

 Score =  39 bits (89), Expect = 0.025
 Identities = 15/27 (55%), Positives = 22/27 (81%)

Query: 313 VFGSGYTGIKNLGNTCYLSTVMQVLFS 339
           . |||. |..||||||.|. |.| | |
Sbjct: 206 LLGSGHVGLRNLGNTCFLNAVLQCLSS 232

>hg18||uc001oze |11|AJ586137|NA|NA|KIAA1372|NA|NA|Homo sapiens mRNA for KIAA1372
        protein, partial cds

          Length = 286

 Score =  39 bits (89), Expect = 0.025
 Identities = 16/36 (44%), Positives = 25/36 (69%)

Query: 309 KLKAVFGSGYTGIKNLGNTCYLSTVMQVLFSIPDFQ 344
           .| |   .|  |. |||||||.....| ||   ||.
Sbjct: 187 RLMAKSDTGKIGLINLGNTCYVNSILQALFMASDFR 222

>hg18||uc001ozf |11|AB037793|NA|NA|KIAA1372|NA|NA|Homo sapiens mRNA for KIAA1372
        protein, partial cds

          Length = 749

 Score =  39 bits (89), Expect = 0.025
 Identities = 16/36 (44%), Positives = 25/36 (69%)

Query: 309 KLKAVFGSGYTGIKNLGNTCYLSTVMQVLFSIPDFQ 344
           .| |   .|  |. |||||||.....| ||   ||.
Sbjct: 162 RLMAKSDTGKIGLINLGNTCYVNSILQALFMASDFR 197

>hg18||uc002qny
        |19|NM_020903|Q9HBJ7|UBP29_HUMAN|USP29|NM_020903|NP_065954|ubiquitin
        specific protease 29

          Length = 922

 Score =  39 bits (88), Expect = 0.033
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 320 GIKNLGNTCYLSTVMQVLFSIPDF 343
           |  |||||||.. |.| ||.|| |
Sbjct: 286 GFPNLGNTCYMNAVLQSLFAIPSF 309

>hg18||uc004dhp
        |X|NM_004651|P51784|UBP11_HUMAN|USP11|NM_004651|NP_004642|ubiquitin
        specific protease 11

          Length = 963

 Score =  39 bits (88), Expect = 0.033
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 317 GYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYVGN--LQRIFDYSPLDPSQDFATQMAKLG 374
           |  |. ||||||.... .| | ..|     .. |  |. .   .||    . |   | | 
Sbjct: 307 GICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAEAYADLV 366

Query: 375 HGLLSGQY 382
               || .
Sbjct: 367 KQAWSGHH 374

>hg18||uc004dhq |X|AK055588|NA|NA|usp11|NA|NA|Homo sapiens usp11 mRNA for
        deubiquitinating enzyme, complete cds

          Length = 689

 Score =  39 bits (88), Expect = 0.033
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 317 GYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYVGN--LQRIFDYSPLDPSQDFATQMAKLG 374
           |  |. ||||||.... .| | ..|     .. |  |. .   .||    . |   | | 
Sbjct:  34 GICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAEAYADLV 93

Query: 375 HGLLSGQY 382
               || .
Sbjct:  94 KQAWSGHH 101

>hg18||uc001dht
        |1|NM_015017|Q8TEY7|UBP33_HUMAN|USP33|NM_015017|NP_055832|ubiquitin
        specific protease 33 isoform 1

          Length = 942

 Score =  38 bits (87), Expect = 0.043
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 317 GYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYV--GNLQR 353
           | ||.||.|||||..  .| | . |   . ..  | | |
Sbjct: 183 GLTGLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLAR 221

>hg18||uc001dhu
        |1|NM_201624|Q8TEY7-2|Q8TEY7-2|USP33|NM_201624|NP_963918|ubiquitin
        specific protease 33 isoform 2

          Length = 911

 Score =  38 bits (87), Expect = 0.043
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 317 GYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYV--GNLQR 353
           | ||.||.|||||..  .| | . |   . ..  | | |
Sbjct: 152 GLTGLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLAR 190

>hg18||uc001dhw
        |1|NM_201626|Q8TEY7-3|Q8TEY7-3|USP33|NM_201626|NP_963920|ubiquitin
        specific protease 33 isoform 3

          Length = 828

 Score =  38 bits (87), Expect = 0.043
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 317 GYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYV--GNLQR 353
           | ||.||.|||||..  .| | . |   . ..  | | |
Sbjct: 183 GLTGLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLAR 221

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 65,424,984
Number of Sequences: 45480
Number of Extensions: 65424984
Number of Successful Extensions: 5071428
Number of sequences better than 0.0: 0
BLASTP 7.6.0