BLASTP 7.6.0


Query=fugu4_297416 |jgi|Takru4|297416|estExt_Genewise2.C_1160028
        (315 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001txp |12|NM_053275|P05388|RLA0_HUMAN|RPLP0|NM_053275|N...    469   3e-132
hg18||uc001txq |12|NM_001002|P05388|RLA0_HUMAN|RPLP0|NM_001002|N...    469   3e-132
hg18||uc002rqt |2|CR609713|Q8NHW5|Q8NHW5_HUMAN|RPLP0|NM_053275|N...    459   3e-129
hg18||uc001nrz |11|NR_002775|NA|NA|NR_002775|NA|NA|Homo sapiens ...    411   1e-114
hg18||uc001txr |12|BC070194|Q3B7A4|Q3B7A4_HUMAN|RPLP0|NA|NA|RPLP...    278   6e-075
hg18||uc002rqu |2|CR624999|NA|NA|CR624999|NA|NA|full-length cDNA...    275   6e-074
hg18||uc001txr |12|BC070194|Q3B7A4|Q3B7A4_HUMAN|RPLP0|NA|NA|RPLP...     91   2e-018

>hg18||uc001txp
        |12|NM_053275|P05388|RLA0_HUMAN|RPLP0|NM_053275|NP_444505|ribosomal
        protein P0

          Length = 317

 Score =  469 bits (1205), Expect = 3e-132
 Identities = 229/269 (85%), Positives = 251/269 (93%)

Query:   1 MPREDRATWKSNYFLKIIKLLDDYPKCFIVGADNVGSKQMQTIRLSLRDKAVVLMGKNTM 60
           ||||||||||||||||||.|||||||||||||||||||||| ||.||| |||||||||||
Sbjct:   1 MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTM 60

Query:  61 MRKAIRGHLENNPALEKLLPHIKGNVGFVFTKEDLAEVRDLLLANKVPXXXXXXXXXPCD 120
           ||||||||||||||||||||||.|||||||||||| |.||.|||||||         ||.
Sbjct:  61 MRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE 120

Query: 121 VTVPGQNTGLGPEKTSFFQALGITTKISRGTIEILSDVGLIKLGDKVGASEATLLNMLNI 180
           |||| ||||||||||||||||||||||||||||||||| ||| |||||||||||||||||
Sbjct: 121 VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI 180

Query: 181 SPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNVASVCLEIGYPTLASVPHT 240
           ||||.||.||||.||||.|.|||||||| .||.||||||||||||||.|||||.|||||.
Sbjct: 181 SPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHS 240

Query: 241 VINGYKNVLAVTVETGYSFPLADKVKAYL 269
           .||||| |||..||| |.||||.||||.|
Sbjct: 241 IINGYKRVLALSVETDYTFPLAEKVKAFL 269

>hg18||uc001txq
        |12|NM_001002|P05388|RLA0_HUMAN|RPLP0|NM_001002|NP_000993|ribosomal
        protein P0

          Length = 317

 Score =  469 bits (1205), Expect = 3e-132
 Identities = 229/269 (85%), Positives = 251/269 (93%)

Query:   1 MPREDRATWKSNYFLKIIKLLDDYPKCFIVGADNVGSKQMQTIRLSLRDKAVVLMGKNTM 60
           ||||||||||||||||||.|||||||||||||||||||||| ||.||| |||||||||||
Sbjct:   1 MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTM 60

Query:  61 MRKAIRGHLENNPALEKLLPHIKGNVGFVFTKEDLAEVRDLLLANKVPXXXXXXXXXPCD 120
           ||||||||||||||||||||||.|||||||||||| |.||.|||||||         ||.
Sbjct:  61 MRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE 120

Query: 121 VTVPGQNTGLGPEKTSFFQALGITTKISRGTIEILSDVGLIKLGDKVGASEATLLNMLNI 180
           |||| ||||||||||||||||||||||||||||||||| ||| |||||||||||||||||
Sbjct: 121 VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI 180

Query: 181 SPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNVASVCLEIGYPTLASVPHT 240
           ||||.||.||||.||||.|.|||||||| .||.||||||||||||||.|||||.|||||.
Sbjct: 181 SPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHS 240

Query: 241 VINGYKNVLAVTVETGYSFPLADKVKAYL 269
           .||||| |||..||| |.||||.||||.|
Sbjct: 241 IINGYKRVLALSVETDYTFPLAEKVKAFL 269

>hg18||uc002rqt
        |2|CR609713|Q8NHW5|Q8NHW5_HUMAN|RPLP0|NM_053275|NP_444505|ribosomal
        protein P0

          Length = 317

 Score =  459 bits (1179), Expect = 3e-129
 Identities = 225/269 (83%), Positives = 246/269 (91%)

Query:   1 MPREDRATWKSNYFLKIIKLLDDYPKCFIVGADNVGSKQMQTIRLSLRDKAVVLMGKNTM 60
           ||||||||||||||||||.|||||||||||||||||||||| ||.||| | |||||||||
Sbjct:   1 MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKVVVLMGKNTM 60

Query:  61 MRKAIRGHLENNPALEKLLPHIKGNVGFVFTKEDLAEVRDLLLANKVPXXXXXXXXXPCD 120
           |||||||||||||||||||||| |||||||||||| |.||.|||||||         ||.
Sbjct:  61 MRKAIRGHLENNPALEKLLPHIWGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE 120

Query: 121 VTVPGQNTGLGPEKTSFFQALGITTKISRGTIEILSDVGLIKLGDKVGASEATLLNMLNI 180
           |||| ||||||||||||||||||||||||||||||||| ||| |||||||||||||||||
Sbjct: 121 VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI 180

Query: 181 SPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNVASVCLEIGYPTLASVPHT 240
           ||||.||.||||.||||.|.||||| || .||.||||||||||||||. ||||.|||||.
Sbjct: 181 SPFSFGLVIQQVFDNGSIYNPEVLDKTEETLHSRFLEGVRNVASVCLQTGYPTVASVPHS 240

Query: 241 VINGYKNVLAVTVETGYSFPLADKVKAYL 269
           .||||| |||..||| |.||||. |||.|
Sbjct: 241 IINGYKRVLALSVETDYTFPLAENVKAFL 269

>hg18||uc001nrz |11|NR_002775|NA|NA|NR_002775|NA|NA|Homo sapiens cDNA FLJ38013
        fis, clone CTONG2012564, highly similar to 60S ACIDIC RIBOSOMAL PROTEIN
        P0

          Length = 318

 Score =  411 bits (1054), Expect = 1e-114
 Identities = 208/269 (77%), Positives = 230/269 (85%)

Query:   1 MPREDRATWKSNYFLKIIKLLDDYPKCFIVGADNVGSKQMQTIRLSLRDKAVVLMGKNTM 60
           |||||| ||| |||||||.||||| |||||||||| ||||| ||.||  ||||||||| |
Sbjct:   1 MPREDRVTWKPNYFLKIIQLLDDYLKCFIVGADNVNSKQMQQIRMSLCGKAVVLMGKNAM 60

Query:  61 MRKAIRGHLENNPALEKLLPHIKGNVGFVFTKEDLAEVRDLLLANKVPXXXXXXXXXPCD 120
            ||||||||||.|||||||| |  ||||||||||| |.||||||||||         ||.
Sbjct:  61 TRKAIRGHLENSPALEKLLPRIWENVGFVFTKEDLTEIRDLLLANKVPAATRAGAITPCE 120

Query: 121 VTVPGQNTGLGPEKTSFFQALGITTKISRGTIEILSDVGLIKLGDKVGASEATLLNMLNI 180
           |||| ||||| |||||||||||| |||||| ||||||  ||| |||||||||||| ||||
Sbjct: 121 VTVPAQNTGLDPEKTSFFQALGIITKISRGAIEILSDAQLIKTGDKVGASEATLLTMLNI 180

Query: 181 SPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNVASVCLEIGYPTLASVPHT 240
           |||| ||.||||.||||.|.|||||||| .|..|||||||||| || .| |||.|||||.
Sbjct: 181 SPFSSGLVIQQVFDNGSIYNPEVLDITEETLYSRFLEGVRNVAGVCPQIHYPTVASVPHS 240

Query: 241 VINGYKNVLAVTVETGYSFPLADKVKAYL 269
           .|.||| |||..|||  .| ||.||||.|
Sbjct: 241 IIDGYKRVLALSVETDDNFLLAEKVKAFL 269

>hg18||uc001txr |12|BC070194|Q3B7A4|Q3B7A4_HUMAN|RPLP0|NA|NA|RPLP0 protein

          Length = 255

 Score =  278 bits (711), Expect = 6e-075
 Identities = 136/155 (87%), Positives = 142/155 (91%)

Query:   1 MPREDRATWKSNYFLKIIKLLDDYPKCFIVGADNVGSKQMQTIRLSLRDKAVVLMGKNTM 60
           ||||||||||||||||||.|||||||||||||||||||||| ||.||| |||||||||||
Sbjct:   1 MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTM 60

Query:  61 MRKAIRGHLENNPALEKLLPHIKGNVGFVFTKEDLAEVRDLLLANKVPXXXXXXXXXPCD 120
           ||||||||||||||||||||||.|||||||||||| |.||.|||||||         ||.
Sbjct:  61 MRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE 120

Query: 121 VTVPGQNTGLGPEKTSFFQALGITTKISRGTIEIL 155
           |||| ||||||||||||||||||||||||||||||
Sbjct: 121 VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEIL 155

>hg18||uc002rqu |2|CR624999|NA|NA|CR624999|NA|NA|full-length cDNA clone
        CS0DA001YH20 of Neuroblastoma of Homo sapiens (human)

          Length = 200

 Score =  275 bits (702), Expect = 6e-074
 Identities = 135/155 (87%), Positives = 140/155 (90%)

Query:   1 MPREDRATWKSNYFLKIIKLLDDYPKCFIVGADNVGSKQMQTIRLSLRDKAVVLMGKNTM 60
           ||||||||||||||||||.|||||||||||||||||||||| ||.||| | |||||||||
Sbjct:   1 MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKVVVLMGKNTM 60

Query:  61 MRKAIRGHLENNPALEKLLPHIKGNVGFVFTKEDLAEVRDLLLANKVPXXXXXXXXXPCD 120
           |||||||||||||||||||||| |||||||||||| |.||.|||||||         ||.
Sbjct:  61 MRKAIRGHLENNPALEKLLPHIWGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE 120

Query: 121 VTVPGQNTGLGPEKTSFFQALGITTKISRGTIEIL 155
           |||| ||||||||||||||||||||||||||||||
Sbjct: 121 VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEIL 155

>hg18||uc001txr |12|BC070194|Q3B7A4|Q3B7A4_HUMAN|RPLP0|NA|NA|RPLP0 protein

          Length = 255

 Score =  91 bits (224), Expect = 2e-018
 Identities = 41/52 (78%), Positives = 50/52 (96%)

Query: 218 GVRNVASVCLEIGYPTLASVPHTVINGYKNVLAVTVETGYSFPLADKVKAYL 269
           ||||||||||.|||||.|||||..||||| |||..||| |.||||.||||.|
Sbjct: 156 GVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFL 207

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,304,301
Number of Sequences: 45480
Number of Extensions: 193304301
Number of Successful Extensions: 11047244
Number of sequences better than 0.0: 0
BLASTP 7.6.0