BLASTP 7.6.0


Query=fugu4_296597 |jgi|Takru4|296597|estExt_Genewise2.C_910067
        (554 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002nvf |19|AK129884|P06744|G6PI_HUMAN|GPI|NM_000175|NP_0...    915   3e-266
hg18||uc002nvg |19|NM_000175|P06744|G6PI_HUMAN|GPI|NM_000175|NP_...    915   3e-266
hg18||uc002nvi |19|AK025421|NA|NA|GPI|NA|NA|Homo sapiens sperm a...    364   3e-100
hg18||uc002nvh |19|AB209575|Q59F85|Q59F85_HUMAN|AB209575|NA|NA|G...     89   1e-017
hg18||uc003qhc |6|NM_005923|Q99683|M3K5_HUMAN|MAP3K5|NM_005923|N...     30   7.292

>hg18||uc002nvf |19|AK129884|P06744|G6PI_HUMAN|GPI|NM_000175|NP_000166|glucose
        phosphate isomerase

          Length = 558

 Score =  915 bits (2363), Expect = 3e-266
 Identities = 429/548 (78%), Positives = 490/548 (89%)

Query:   3 LTHDPNFQKLQDWYTAHALNINLRHMFEADKERFNKLSLTLKTDDGDILLDYSKNLITDD 62
           || || ||||| ||  |   .||| .|.|.|.|||  |||| |. | ||.||||||.|.|
Sbjct:   4 LTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTED 63

Query:  63 VMKMLVDLAKSRGIEAAREKMFTGEKINFTEGRAVLHVALRNRSNKPIIVDGKDVMPGVN 122
           ||.||||||||||.|||||.|| |||||.|||||||||||||||| ||.|||||||| ||
Sbjct:  64 VMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVN 123

Query: 123 NVLEKMKVFSHKVRSGEWKGYTGKAITDVVNVGIGGSDLGPLMVTEALKPYSKGGPHVWF 182
            ||.||| |  .||||.||||||| ||||.|.|||||||||||||||||||| ||| ||.
Sbjct: 124 KVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWY 183

Query: 183 VSNIDGTHIAKTLEQLNAETTLFIIASKTFTTQETITNAESAKAWFLQHAKDSAAVAKHF 242
           ||||||||||||| ||| |..|||||||||||||||||||.|| |||| ||| .||||||
Sbjct: 184 VSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHF 243

Query: 243 VALSTNGPKVKDFGIDTENMFEFWDWVGGRFSLWSAIGMAIALHIGFDNFEKLLSGAHWM 302
           ||||||  |||.|||| .||||||||||||.|||||||..||||.||||||.||||||||
Sbjct: 244 VALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWM 303

Query: 303 DNHFRTAPLDKNAPVLLALLGIWYINFFHAENHALLPYDQYMHRFAAYFQQGDMESNGKY 362
           | |||| ||.|||||||||||||||| |  | ||.||||||.||||||||||||||||||
Sbjct: 304 DQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKY 363

Query: 363 ITSQGVRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMVPADFLIPAQSQHPIRDNLHHK 422
           ||  | ||.. |||||||||||||||||||||||||.|.| ||||| |.|||||  ||||
Sbjct: 364 ITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHK 423

Query: 423 ILVANFLAQTEALMRGKTTEEARKELESGGLNGEALDKILPHKVFQGNKPTNSIIFRKLS 482
           ||.||||||||||||||.||||||||.. | . | |...||||||.||.|||||.| ||.
Sbjct: 424 ILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLT 483

Query: 483 PYTLGALTAMYEHKTFIQGLLWEINSFDQWGVELGKQLAKKIEPELKDATEVHSHDSSTN 542
           |. |||| |||||| |.||..|.|||||||||||||||||||||||  . .| |||.|||
Sbjct: 484 PFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTN 543

Query: 543 GLINFLKK 550
           |||||.|.
Sbjct: 544 GLINFIKQ 551

>hg18||uc002nvg |19|NM_000175|P06744|G6PI_HUMAN|GPI|NM_000175|NP_000166|glucose
        phosphate isomerase

          Length = 558

 Score =  915 bits (2363), Expect = 3e-266
 Identities = 429/548 (78%), Positives = 490/548 (89%)

Query:   3 LTHDPNFQKLQDWYTAHALNINLRHMFEADKERFNKLSLTLKTDDGDILLDYSKNLITDD 62
           || || ||||| ||  |   .||| .|.|.|.|||  |||| |. | ||.||||||.|.|
Sbjct:   4 LTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTED 63

Query:  63 VMKMLVDLAKSRGIEAAREKMFTGEKINFTEGRAVLHVALRNRSNKPIIVDGKDVMPGVN 122
           ||.||||||||||.|||||.|| |||||.|||||||||||||||| ||.|||||||| ||
Sbjct:  64 VMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVN 123

Query: 123 NVLEKMKVFSHKVRSGEWKGYTGKAITDVVNVGIGGSDLGPLMVTEALKPYSKGGPHVWF 182
            ||.||| |  .||||.||||||| ||||.|.|||||||||||||||||||| ||| ||.
Sbjct: 124 KVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWY 183

Query: 183 VSNIDGTHIAKTLEQLNAETTLFIIASKTFTTQETITNAESAKAWFLQHAKDSAAVAKHF 242
           ||||||||||||| ||| |..|||||||||||||||||||.|| |||| ||| .||||||
Sbjct: 184 VSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHF 243

Query: 243 VALSTNGPKVKDFGIDTENMFEFWDWVGGRFSLWSAIGMAIALHIGFDNFEKLLSGAHWM 302
           ||||||  |||.|||| .||||||||||||.|||||||..||||.||||||.||||||||
Sbjct: 244 VALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWM 303

Query: 303 DNHFRTAPLDKNAPVLLALLGIWYINFFHAENHALLPYDQYMHRFAAYFQQGDMESNGKY 362
           | |||| ||.|||||||||||||||| |  | ||.||||||.||||||||||||||||||
Sbjct: 304 DQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKY 363

Query: 363 ITSQGVRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMVPADFLIPAQSQHPIRDNLHHK 422
           ||  | ||.. |||||||||||||||||||||||||.|.| ||||| |.|||||  ||||
Sbjct: 364 ITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHK 423

Query: 423 ILVANFLAQTEALMRGKTTEEARKELESGGLNGEALDKILPHKVFQGNKPTNSIIFRKLS 482
           ||.||||||||||||||.||||||||.. | . | |...||||||.||.|||||.| ||.
Sbjct: 424 ILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLT 483

Query: 483 PYTLGALTAMYEHKTFIQGLLWEINSFDQWGVELGKQLAKKIEPELKDATEVHSHDSSTN 542
           |. |||| |||||| |.||..|.|||||||||||||||||||||||  . .| |||.|||
Sbjct: 484 PFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTN 543

Query: 543 GLINFLKK 550
           |||||.|.
Sbjct: 544 GLINFIKQ 551

>hg18||uc002nvi |19|AK025421|NA|NA|GPI|NA|NA|Homo sapiens sperm antigen-36 mRNA,
        complete cds

          Length = 221

 Score =  364 bits (932), Expect = 3e-100
 Identities = 165/214 (77%), Positives = 194/214 (90%)

Query: 337 LLPYDQYMHRFAAYFQQGDMESNGKYITSQGVRVNYHTGPIVWGEPGTNGQHAFYQLIHQ 396
           .||||||.||||||||||||||||||||  | ||.. |||||||||||||||||||||||
Sbjct:   1 MLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQ 60

Query: 397 GTRMVPADFLIPAQSQHPIRDNLHHKILVANFLAQTEALMRGKTTEEARKELESGGLNGE 456
           ||.|.| ||||| |.|||||  ||||||.||||||||||||||.||||||||.. | . |
Sbjct:  61 GTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPE 120

Query: 457 ALDKILPHKVFQGNKPTNSIIFRKLSPYTLGALTAMYEHKTFIQGLLWEINSFDQWGVEL 516
            |...||||||.||.|||||.| ||.|. |||| |||||| |.||..|.|||||||||||
Sbjct: 121 DLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVEL 180

Query: 517 GKQLAKKIEPELKDATEVHSHDSSTNGLINFLKK 550
           ||||||||||||  . .| |||.||||||||.|.
Sbjct: 181 GKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQ 214

>hg18||uc002nvh |19|AB209575|Q59F85|Q59F85_HUMAN|AB209575|NA|NA|Glucose
        phosphate isomerase variant (Fragment)

          Length = 503

 Score =  89 bits (220), Expect = 1e-017
 Identities = 42/54 (77%), Positives = 50/54 (92%)

Query:  40 SLTLKTDDGDILLDYSKNLITDDVMKMLVDLAKSRGIEAAREKMFTGEKINFTE 93
           |||| |. | ||.||||||.|.|||.||||||||||.|||||.|| |||||.||
Sbjct: 345 SLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTE 398

>hg18||uc003qhc
        |6|NM_005923|Q99683|M3K5_HUMAN|MAP3K5|NM_005923|NP_005914|mitogen-activ
        ated protein kinase kinase kinase

          Length = 1374

 Score =  30 bits (66), Expect = 7.292
 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 6/41 (14%)

Query: 226 AWFLQHAKDSAAVAKHFVALSTNGPKVKDFGIDTENMFEFW 266
           ||.|.   ..  . |||| |.|  |  |      . . .||
Sbjct: 508 AWYLKSIVETILIYKHFVKLTTEQPVAK------QELVDFW 542

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 190,549,688
Number of Sequences: 45480
Number of Extensions: 190549688
Number of Successful Extensions: 11294661
Number of sequences better than 0.0: 0
BLASTP 7.6.0