BLASTP 7.6.0


Query=fugu4_296419 |jgi|Takru4|296419|estExt_Genewise2.C_870159
        (404 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003byk |3|NM_024334|Q9BTV4|Q9BTV4_HUMAN|TMEM43|NM_024334...    419   3e-117
hg18||uc003byl |3|AK074073|Q8TEP9|Q8TEP9_HUMAN|FLJ00144|NA|NA|FL...    178   2e-044
hg18||uc003zvu |9|NM_001040412|Q86XC6|Q86XC6_HUMAN|C9orf131|NM_0...     30   3.767
hg18||uc003zvv |9|NM_001040411|Q86XC6|Q86XC6_HUMAN|C9orf131|NM_0...     30   3.767
hg18||uc003zvw |9|NM_203299|Q5VYM1|Q5VYM1_HUMAN|C9orf131|NM_2032...     30   3.767
hg18||uc003zvx |9|NM_001040410|Q5VYM1|Q5VYM1_HUMAN|C9orf131|NM_0...     30   3.767
hg18||uc003efq |3|DQ063584|Q460N5-3|Q460N5-3|PARP14|NM_017554|NP...     30   4.920
hg18||uc003efr |3|NM_017554|Q460N5-3|Q460N5-3|PARP14|NM_017554|N...     30   4.920
hg18||uc003efs |3|AB033094|Q460N5-4|Q460N5-4|PARP14|NM_017554|NP...     30   4.920

>hg18||uc003byk
        |3|NM_024334|Q9BTV4|Q9BTV4_HUMAN|TMEM43|NM_024334|NP_077310|transmembra
        ne protein 43

          Length = 400

 Score =  419 bits (1077), Expect = 3e-117
 Identities = 207/401 (51%), Positives = 280/401 (69%), Gaps = 2/401 (0%)

Query:   3 SAQTFSGKNPNKHTRVSVKANPGFLERLSESAGGTFVGIILFFLSLYVLFTNEGRALQTT 62
           .|   |     .| .|   . |||||||||..|| |||.. | || |..||||||||.| 
Sbjct:   2 AANYSSTSTRREHVKVKTSSQPGFLERLSETSGGMFVGLMAFLLSFYLIFTNEGRALKTA 61

Query:  63 SSLNEGLSKVVSLGSFSNLDPQNNNHLVHLFAQLKTAQPLHDPNYKVVVQAVKLKRHVEM 122
           .|| |||| |||  |  .. |.|   |||.   |.|.. | |||| | . ||||.|||||
Sbjct:  62 TSLAEGLSLVVSPDSIHSVAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEM 121

Query: 123 YQWVEQQESKDYQXXXXXXXXXXXXXXXXWKSELINSRNFDKEIGHQNPSAMAVESVTVV 182
           ||||| .||..|                 |.||.|||.|||.||||.|||||||||    
Sbjct: 122 YQWVETEESREYTEDGQVKKETRYSYNTEWRSEIINSKNFDREIGHKNPSAMAVESFMAT 181

Query: 183 APEVRVGPFVLSKGLVEQINNFQTLSLKDFPAANLEPFLSIDDDYFYHTEHPRRPEVGDV 242
           || |..| | || ||.....||..|||      ...  .    |.|||.|.|. |||||.
Sbjct: 182 APFVQIGRFFLSSGLIDKVDNFKSLSLSKLEDPHVD--IIRRGDFFYHSENPKYPEVGDL 239

Query: 243 RVRFSFAGLSDETAHLGPPQTVSIVAMQRGEQLGPFKTKSANTLEILYLGELTAEEVFAK 302
           || ||.|||| .   |||   |...| |||.|| || ||| .|| .|. |. .||||| .
Sbjct: 240 RVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSGDTLLLLHHGDFSAEEVFHR 299

Query: 303 EHQHNSMKTWGLRAAGWVLMFLSIQLIMRIIYTLVDWVPLLRELVSVGLKLFALCVSCSL 362
           | . |||||||||||||. ||. . |. ||.|||||| |. |.||..||| || ||. ||
Sbjct: 300 ELRSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKAFAFCVATSL 359

Query: 363 SLLTIAAGWLFYRXXXXXXXXXXXXXXXXXXRTRLPAKKNE 403
           .|||.||||||||                  |||.|||| |
Sbjct: 360 TLLTVAAGWLFYRPLWALLIAGLALVPILVARTRVPAKKLE 400

>hg18||uc003byl |3|AK074073|Q8TEP9|Q8TEP9_HUMAN|FLJ00144|NA|NA|FLJ00144 protein
        (Fragment)

          Length = 205

 Score =  178 bits (449), Expect = 2e-044
 Identities = 85/176 (48%), Positives = 122/176 (69%), Gaps = 2/176 (1%)

Query: 122 MYQWVEQQESKDYQXXXXXXXXXXXXXXXXWKSELINSRNFDKEIGHQNPSAMAVESVTV 181
           |||||| .||..|                 |.||.|||.|||.||||.|||||||||   
Sbjct:   1 MYQWVETEESREYTEDGQVKKETRYSYNTEWRSEIINSKNFDREIGHKNPSAMAVESFMA 60

Query: 182 VAPEVRVGPFVLSKGLVEQINNFQTLSLKDFPAANLEPFLSIDDDYFYHTEHPRRPEVGD 241
            || |..| | || ||.....||..|||      ...  .    |.|||.|.|. |||||
Sbjct:  61 TAPFVQIGRFFLSSGLIDKVDNFKSLSLSKLEDPHVD--IIRRGDFFYHSENPKYPEVGD 118

Query: 242 VRVRFSFAGLSDETAHLGPPQTVSIVAMQRGEQLGPFKTKSANTLEILYLGELTAE 297
           .|| ||.|||| .   |||   |...| |||.|| || ||| .|| .|. |. .||
Sbjct: 119 LRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSGDTLLLLHHGDFSAE 174

>hg18||uc003zvu
        |9|NM_001040412|Q86XC6|Q86XC6_HUMAN|C9orf131|NM_001040412|NP_001035502|
        hypothetical protein LOC138724 isoform D

          Length = 1031

 Score =  30 bits (67), Expect = 3.767
 Identities = 16/36 (44%), Positives = 20/36 (55%)

Query: 232 EHPRRPEVGDVRVRFSFAGLSDETAHLGPPQTVSIV 267
           ||||.|. || |   .  |||  |    | |  |.|
Sbjct: 898 EHPRKPKAGDHRRGTARLGLSTVTGKNHPAQARSLV 933

>hg18||uc003zvv
        |9|NM_001040411|Q86XC6|Q86XC6_HUMAN|C9orf131|NM_001040411|NP_001035501|
        hypothetical protein LOC138724 isoform C

          Length = 1006

 Score =  30 bits (67), Expect = 3.767
 Identities = 16/36 (44%), Positives = 20/36 (55%)

Query: 232 EHPRRPEVGDVRVRFSFAGLSDETAHLGPPQTVSIV 267
           ||||.|. || |   .  |||  |    | |  |.|
Sbjct: 873 EHPRKPKAGDHRRGTARLGLSTVTGKNHPAQARSLV 908

>hg18||uc003zvw
        |9|NM_203299|Q5VYM1|Q5VYM1_HUMAN|C9orf131|NM_203299|NP_976044|hypotheti
        cal protein LOC138724 isoform A

          Length = 1079

 Score =  30 bits (67), Expect = 3.767
 Identities = 16/36 (44%), Positives = 20/36 (55%)

Query: 232 EHPRRPEVGDVRVRFSFAGLSDETAHLGPPQTVSIV 267
           ||||.|. || |   .  |||  |    | |  |.|
Sbjct: 946 EHPRKPKAGDHRRGTARLGLSTVTGKNHPAQARSLV 981

>hg18||uc003zvx
        |9|NM_001040410|Q5VYM1|Q5VYM1_HUMAN|C9orf131|NM_001040410|NP_001035500|
        hypothetical protein LOC138724 isoform B

          Length = 1044

 Score =  30 bits (67), Expect = 3.767
 Identities = 16/36 (44%), Positives = 20/36 (55%)

Query: 232 EHPRRPEVGDVRVRFSFAGLSDETAHLGPPQTVSIV 267
           ||||.|. || |   .  |||  |    | |  |.|
Sbjct: 911 EHPRKPKAGDHRRGTARLGLSTVTGKNHPAQARSLV 946

>hg18||uc003efq |3|DQ063584|Q460N5-3|Q460N5-3|PARP14|NM_017554|NP_060024|poly
        (ADP-ribose) polymerase family, member 14

          Length = 1638

 Score =  30 bits (66), Expect = 4.920
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 7/85 (8%)

Query:   10 KNPNKHTRVSVKANPGFLERLSESAGGTFVGIILFFLSLYVLFTN----EGRALQTTSSL 65
            ..|.|     . |   |... |  .      .|     | | . |    ||  | .  |.
Sbjct: 1175 QHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREGTQLSSQQSV 1234

Query:   66 NEGLSKVVSLGSFSNLDPQNNNHLV 90
               .||. |   ||   ||  ||||
Sbjct: 1235 ---MSKLASFLGFSKQSPQKKNHLV 1256

>hg18||uc003efr |3|NM_017554|Q460N5-3|Q460N5-3|PARP14|NM_017554|NP_060024|poly
        (ADP-ribose) polymerase family, member 14

          Length = 1518

 Score =  30 bits (66), Expect = 4.920
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 7/85 (8%)

Query:   10 KNPNKHTRVSVKANPGFLERLSESAGGTFVGIILFFLSLYVLFTN----EGRALQTTSSL 65
            ..|.|     . |   |... |  .      .|     | | . |    ||  | .  |.
Sbjct: 1055 QHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREGTQLSSQQSV 1114

Query:   66 NEGLSKVVSLGSFSNLDPQNNNHLV 90
               .||. |   ||   ||  ||||
Sbjct: 1115 ---MSKLASFLGFSKQSPQKKNHLV 1136

>hg18||uc003efs |3|AB033094|Q460N5-4|Q460N5-4|PARP14|NM_017554|NP_060024|poly
        (ADP-ribose) polymerase family, member 14

          Length = 1397

 Score =  30 bits (66), Expect = 4.920
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 7/85 (8%)

Query:   10 KNPNKHTRVSVKANPGFLERLSESAGGTFVGIILFFLSLYVLFTN----EGRALQTTSSL 65
            ..|.|     . |   |... |  .      .|     | | . |    ||  | .  |.
Sbjct: 1055 QHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREGTQLSSQQSV 1114

Query:   66 NEGLSKVVSLGSFSNLDPQNNNHLV 90
               .||. |   ||   ||  ||||
Sbjct: 1115 ---MSKLASFLGFSKQSPQKKNHLV 1136

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,304,301
Number of Sequences: 45480
Number of Extensions: 193304301
Number of Successful Extensions: 11047244
Number of sequences better than 0.0: 0
BLASTP 7.6.0