BLASTP 7.6.0


Query=fugu4_296185 |jgi|Takru4|296185|estExt_Genewise2.C_800134
        (209 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001cmi |1|NM_001012|P62241|RS8_HUMAN|RPS8|NM_001012|NP_0...    411   4e-115
hg18||uc001yug |15|CR619482|NA|NA|CR619482|NA|NA|full-length cDN...    314   6e-086
hg18||uc003jhx |5|CR613092|NA|NA|CR613092|NA|NA|full-length cDNA...    128   5e-030
hg18||uc001rfh |12|NM_020297|O60706-2|O60706-2|ABCC9|NM_020297|N...     30   1.415
hg18||uc001rfi |12|NM_005691|O60706|ABCC9_HUMAN|ABCC9|NM_005691|...     30   1.415
hg18||uc003ami |22|NM_014227|Q9NY91|SC5A4_HUMAN|SLC5A4|NM_014227...     30   2.414
hg18||uc002dxt |16|AL117408|Q9UFP2|Q9UFP2_HUMAN|DKFZp434P1750|NA...     29   4.117
hg18||uc002dxu |16|NM_015527|Q6IN54|Q6IN54_HUMAN|TBC1D10B|NM_015...     29   4.117
hg18||uc002ege |16|AF213969|Q9NPI1-2|Q9NPI1-2|BRD7|NM_013263|NP_...     28   9.172
hg18||uc002egf |16|NM_013263|Q9NPI1|BRD7_HUMAN|BRD7|NM_013263|NP...     28   9.172
hg18||uc002mqf |19|NM_003072|P51532|SMCA4_HUMAN|SMARCA4|NM_00307...     28   9.172
hg18||uc002mqh |19|AK055168|NA|NA|SMARCA4|NM_003072|NP_003063|SW...     28   9.172

>hg18||uc001cmi |1|NM_001012|P62241|RS8_HUMAN|RPS8|NM_001012|NP_001003|ribosomal
        protein S8

          Length = 208

 Score =  411 bits (1055), Expect = 4e-115
 Identities = 194/208 (93%), Positives = 203/208 (97%)

Query:   1 MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPPANTKLGPRRIHTVRVRGGNKKYRALRL 60
           |||||||||||||||||||||||||||||||| ||||.||||||||||||||||||||||
Sbjct:   1 MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGGNKKYRALRL 60

Query:  61 DVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIILVDSLPFRQWYEAHYATP 120
           |||||||||||||||||||||||||||||||||||||||||.|.|| |.|||||.||| |
Sbjct:  61 DVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALP 120

Query: 121 LGRKKGAKLTPEEEEVLNKKRSKKTQKKYDERKKTAKISTLLEEQFQQGKLLACIASRPG 180
           |||||||||||||||.|||||||| ||||||||| ||||.||||||||||||||||||||
Sbjct: 121 LGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPG 180

Query: 181 QCGRADGYILEGKELEFYLRKIKAKKGK 208
           ||||||||.|||||||||||||||.|||
Sbjct: 181 QCGRADGYVLEGKELEFYLRKIKARKGK 208

>hg18||uc001yug |15|CR619482|NA|NA|CR619482|NA|NA|full-length cDNA clone
        CS0DI014YE21 of Placenta Cot 25-normalized of Homo sapiens (human)

          Length = 183

 Score =  314 bits (803), Expect = 6e-086
 Identities = 153/183 (83%), Positives = 159/183 (86%)

Query:   1 MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPPANTKLGPRRIHTVRVRGGNKKYRALRL 60
           | || |||||  ||  |||||||||||||| | |||| |||||||||| |||||| ||||
Sbjct:   1 MDISWDNWHKCHKTRDKRKPYHKKRKYELGHPAANTKTGPRRIHTVRVWGGNKKYCALRL 60

Query:  61 DVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIILVDSLPFRQWYEAHYATP 120
           || |||||||||  || ||||||||||||||| ||||||||.|.||  .|||||.||| |
Sbjct:  61 DVRNFSWGSECCAHKTTIIDVVYNASNNELVRPKTLVKNCIVLIDSTLYRQWYESHYAPP 120

Query: 121 LGRKKGAKLTPEEEEVLNKKRSKKTQKKYDERKKTAKISTLLEEQFQQGKLLACIASRPG 180
           || ||||||||||||.|||||||| |||| |||| ||||.|| |||||||||||||||||
Sbjct: 121 LGCKKGAKLTPEEEEILNKKRSKKIQKKYHERKKNAKISSLLGEQFQQGKLLACIASRPG 180

Query: 181 QCG 183
           |||
Sbjct: 181 QCG 183

>hg18||uc003jhx |5|CR613092|NA|NA|CR613092|NA|NA|full-length cDNA clone
        CS0DI021YI22 of Placenta Cot 25-normalized of Homo sapiens (human)

          Length = 74

 Score =  128 bits (321), Expect = 5e-030
 Identities = 59/68 (86%), Positives = 62/68 (91%)

Query:  1 MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPPANTKLGPRRIHTVRVRGGNKKYRALRL 60
          |||||||||.||||||||||||||||||| || ||||.||||||||||.| |||||||||
Sbjct:  1 MGISRDNWHQRRKTGGKRKPYHKKRKYELERPAANTKIGPRRIHTVRVQGSNKKYRALRL 60

Query: 61 DVGNFSWG 68
          ||| |  |
Sbjct: 61 DVGEFLLG 68

>hg18||uc001rfh
        |12|NM_020297|O60706-2|O60706-2|ABCC9|NM_020297|NP_064693|ATP-binding
        cassette, sub-family C, member 9

          Length = 1549

 Score =  30 bits (67), Expect = 1.415
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 11/75 (14%)

Query:   6 DNWHKRRKTGGKRKPYHKKRKYELGRPPANTKLGPRRIH-------TVRVRGGNKKYRAL 58
           |.|    .||    |.   .|.   .|    .  | | |       | |.|    .  |.
Sbjct: 617 DSW----RTGESSLPFESCKKHTGVQPKTINRKQPGRYHLDSYEQSTRRLRPAETEDIAI 672

Query:  59 RLDVGNFSWGSECCT 73
           ..  | |||||   |
Sbjct: 673 KVTNGYFSWGSGLAT 687

>hg18||uc001rfi
        |12|NM_005691|O60706|ABCC9_HUMAN|ABCC9|NM_005691|NP_005682|ATP-binding
        cassette, sub-family C, member 9

          Length = 1549

 Score =  30 bits (67), Expect = 1.415
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 11/75 (14%)

Query:   6 DNWHKRRKTGGKRKPYHKKRKYELGRPPANTKLGPRRIH-------TVRVRGGNKKYRAL 58
           |.|    .||    |.   .|.   .|    .  | | |       | |.|    .  |.
Sbjct: 617 DSW----RTGESSLPFESCKKHTGVQPKTINRKQPGRYHLDSYEQSTRRLRPAETEDIAI 672

Query:  59 RLDVGNFSWGSECCT 73
           ..  | |||||   |
Sbjct: 673 KVTNGYFSWGSGLAT 687

>hg18||uc003ami
        |22|NM_014227|Q9NY91|SC5A4_HUMAN|SLC5A4|NM_014227|NP_055042|solute
        carrier family 5 (low affinity glucose

          Length = 659

 Score =  30 bits (65), Expect = 2.414
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 122 GRKKGAKLTPEEEEVLNKKRSKKTQK 147
           | .|| ||| |||| |.|| .  ...
Sbjct: 608 GLQKGPKLTKEEEEALSKKLTDTSER 633

>hg18||uc002dxt
        |16|AL117408|Q9UFP2|Q9UFP2_HUMAN|DKFZp434P1750|NA|NA|Hypothetical
        protein DKFZp434P1750

          Length = 233

 Score =  29 bits (63), Expect = 4.117
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 118 ATPLGRKKGAKLTPEEEEVLNKKRSKKTQKKYDERKKTAK 157
           .||||  |  .   .| .   |.| |. ...  ||.|  |
Sbjct: 137 STPLGSSKETRKQEKERQKQEKERQKQEKEREKERQKQEK 176

>hg18||uc002dxu
        |16|NM_015527|Q6IN54|Q6IN54_HUMAN|TBC1D10B|NM_015527|NP_056342|TBC1
        domain family, member 10B

          Length = 533

 Score =  29 bits (63), Expect = 4.117
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 118 ATPLGRKKGAKLTPEEEEVLNKKRSKKTQKKYDERKKTAK 157
           .||||  |  .   .| .   |.| |. ...  ||.|  |
Sbjct: 437 STPLGSSKETRKQEKERQKQEKERQKQEKEREKERQKQEK 476

>hg18||uc002ege
        |16|AF213969|Q9NPI1-2|Q9NPI1-2|BRD7|NM_013263|NP_037395|bromodomain
        containing 7

          Length = 652

 Score =  28 bits (60), Expect = 9.172
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 123 RKKGAKLTPEEEEVLNKKRSKKTQKKYD 150
           |||| |  | ||.   ..| |. .|| |
Sbjct:  66 RKKGEKQIPGEEKGRKRRRVKEDKKKRD 93

>hg18||uc002egf
        |16|NM_013263|Q9NPI1|BRD7_HUMAN|BRD7|NM_013263|NP_037395|bromodomain
        containing 7

          Length = 651

 Score =  28 bits (60), Expect = 9.172
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 123 RKKGAKLTPEEEEVLNKKRSKKTQKKYD 150
           |||| |  | ||.   ..| |. .|| |
Sbjct:  66 RKKGEKQIPGEEKGRKRRRVKEDKKKRD 93

>hg18||uc002mqf
        |19|NM_003072|P51532|SMCA4_HUMAN|SMARCA4|NM_003072|NP_003063|SWI/SNF-re
        lated matrix-associated

          Length = 1647

 Score =  28 bits (60), Expect = 9.172
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 8/66 (12%)

Query:  105 DSLPFRQWYEAHYATPLGRKKGAKLTPEEEEVLNKKRSKKTQKKYDERKKTAKISTLLEE 164
            |||  .|| .|         .   |   ||||  || |.| ..  |    |   ||   .
Sbjct: 1381 DSLTEKQWLKA--------IEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRD 1432

Query:  165 QFQQGK 170
            .  . |
Sbjct: 1433 KDDESK 1438

>hg18||uc002mqh |19|AK055168|NA|NA|SMARCA4|NM_003072|NP_003063|SWI/SNF-related
        matrix-associated

          Length = 737

 Score =  28 bits (60), Expect = 9.172
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 8/66 (12%)

Query: 105 DSLPFRQWYEAHYATPLGRKKGAKLTPEEEEVLNKKRSKKTQKKYDERKKTAKISTLLEE 164
           |||  .|| .|         .   |   ||||  || |.| ..  |    |   ||   .
Sbjct: 471 DSLTEKQWLKA--------IEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRD 522

Query: 165 QFQQGK 170
           .  . |
Sbjct: 523 KDDESK 528

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,304,301
Number of Sequences: 45480
Number of Extensions: 193304301
Number of Successful Extensions: 11047244
Number of sequences better than 0.0: 0
BLASTP 7.6.0