BLASTP 7.6.0


Query=fugu4_294506 |jgi|Takru4|294506|estExt_Genewise2.C_470206
        (525 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002xrd |20|AF470686|Q9HCD5|NCOA5_HUMAN|NCOA5|NM_020967|N...    292   7e-079
hg18||uc002xre |20|NM_020967|Q9HCD5|NCOA5_HUMAN|NCOA5|NM_020967|...    292   7e-079
hg18||uc002xrc |20|BC056872|NA|NA|KIAA1637|NA|NA|Homo sapiens mR...    239   1e-062
hg18||uc002xrd |20|AF470686|Q9HCD5|NCOA5_HUMAN|NCOA5|NM_020967|N...     61   3e-009
hg18||uc002xre |20|NM_020967|Q9HCD5|NCOA5_HUMAN|NCOA5|NM_020967|...     61   3e-009
hg18||uc002xrd |20|AF470686|Q9HCD5|NCOA5_HUMAN|NCOA5|NM_020967|N...     50   5e-006
hg18||uc002xre |20|NM_020967|Q9HCD5|NCOA5_HUMAN|NCOA5|NM_020967|...     50   5e-006
hg18||uc001vas |13|NM_015070|Q5T200-2|Q5T200-2|ZC3H13|NM_015070|...     46   9e-005
hg18||uc001vat |13|AK056422|Q5T200-2|Q5T200-2|ZC3H13|NM_015070|N...     46   9e-005
hg18||uc002lyh |19|NM_001080543|Q8WUQ7|CS029_HUMAN|C19orf29|NM_0...     33   0.617
hg18||uc003qgw |6|NM_001077441|Q9NYF8-4|Q9NYF8-4|BCLAF1|NM_00107...     33   0.617
hg18||uc003qgx |6|NM_014739|Q9NYF8|BCLF1_HUMAN|BCLAF1|NM_014739|...     33   0.617
hg18||uc003vux |7|NM_016019|Q9Y383|LC7L2_HUMAN|LUC7L2|NM_016019|...     33   0.617
hg18||uc003vuy |7|BC042625|Q9Y383-2|Q9Y383-2|LUC7L2|NA|NA|Putati...     33   0.617
hg18||uc003vva |7|AK092044|Q9Y383-2|Q9Y383-2|LUC7L2|NM_016019|NP...     33   0.617
hg18||uc001whg |14|NM_001077351|Q86U06|RBM23_HUMAN|RBM23|NM_0010...     33   1.052
hg18||uc001whk |14|AK125593|Q86U06-3|Q86U06-3|RBM23|NM_001077351...     33   1.052
hg18||uc002oxb |19|BC034980|Q4G0Z0|Q4G0Z0_HUMAN|BC034980|NA|NA|H...     33   1.052
hg18||uc002oxb |19|BC034980|Q4G0Z0|Q4G0Z0_HUMAN|BC034980|NA|NA|H...     32   1.374
hg18||uc002oxb |19|BC034980|Q4G0Z0|Q4G0Z0_HUMAN|BC034980|NA|NA|H...     32   1.794
hg18||uc002oxb |19|BC034980|Q4G0Z0|Q4G0Z0_HUMAN|BC034980|NA|NA|H...     31   3.060
hg18||uc003qgw |6|NM_001077441|Q9NYF8-4|Q9NYF8-4|BCLAF1|NM_00107...     31   3.060
hg18||uc003qgx |6|NM_014739|Q9NYF8|BCLF1_HUMAN|BCLAF1|NM_014739|...     31   3.060
hg18||uc002bso |15|AF006514|O14647-2|O14647-2|CHD2|NM_001271|NP_...     30   5.219
hg18||uc001vqj |13|NM_018011|Q6IQ34|Q6IQ34_HUMAN|FLJ10154|NM_018...     30   6.817
hg18||uc001vqk |13|AK001016|Q9NWB6|Q9NWB6_HUMAN|RP11-297I6.1|NA|...     30   6.817
hg18||uc003kzw |5|NM_014829|Q7L014|DDX46_HUMAN|DDX46|NM_014829|N...     30   6.817
hg18||uc004cjo |9|NM_001080482|NA|NA|LOC389813|NM_001080482|NP_0...     30   6.817
hg18||uc002idu |17|NM_004941|Q14562|DHX8_HUMAN|DHX8|NM_004941|NP...     30   8.903

>hg18||uc002xrd
        |20|AF470686|Q9HCD5|NCOA5_HUMAN|NCOA5|NM_020967|NP_066018|nuclear
        receptor coactivator 5

          Length = 579

 Score =  292 bits (747), Expect = 7e-079
 Identities = 201/483 (41%), Positives = 254/483 (52%), Gaps = 52/483 (10%)

Query:  27 DAKEPRPRSRSPAYGRDGREPRDSHEGRD-----------SGRESRLGRHSRDPEYRYRS 75
           | ..||   |   . || |. |||   ||             |.||  |  ||| |    
Sbjct:  53 DIRDPRD-LRDHRHSRDLRDHRDSRSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMY---- 107

Query:  76 SESRDKDLRSDPRDIGYSRD-EYDRYYRGGADEYYRRKDEPYRDPYREPWNG-------X 127
              | .|.| | ||  | |.  |||| |   |.| ||||. | | ||. ..|        
Sbjct: 108 --DRYRDMR-DSRDPMYRREGSYDRYLR--MDDYCRRKDDSYFDRYRDSFDGRGPPGPES 162

Query: 128 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTDRPVDCSVIVVNKAQKEYAETVGRKVRD 187
                                         | .||||||||||||  |.|||.|||||||
Sbjct: 163 QSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRD 222

Query: 188 LGMVVDLIFLNTEVSLTQALEDVGRARTPFAIIITQQHQVHRSCTVNILFGTPQEHRNMP 247
           ||||||||||||||||.|||||| |  .||||.||||||.||||||||.|||||||||||
Sbjct: 223 LGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMP 282

Query: 248 MQDAMMLVAHNYDTYKVXXXXXXXXXXXXXXXXMADDVLLREPD--------RESHPISV 299
             |||.||| ||. ||                 |||. .|.| .        |  || ..
Sbjct: 283 QADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAI 342

Query: 300 LTTITLLSENRFVTPEELDTLSAYLKDKRTRLLRSTADPLAAGHADIPPTA-AGLPAPSH 358
            . | ||..||..| || | .  ||.... ||.||. | |    .  |  | .|    . 
Sbjct: 343 QSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQ 402

Query: 359 SSHLPMQSSHLGLSATSSAPANPNHQQELQAKILSLFNSXXXXXXXXXXXXTTQQSQPYS 418
            |  |.||  .  ||| .  | |  ||||||||||||||             .  . |  
Sbjct: 403 PSSQPLQSGQVLPSATPTPSAPPTSQQELQAKILSLFNS-------GTVTANSSSASPSV 455

Query: 419 NLGPPLSQNAPRQAMPGPQAASQGFGPSAGRMPVAQGHRA------PITPSNINFESPSV 472
             |   .||    |   ||  ||  |     . . ||  |      |  ||   |  || 
Sbjct: 456 AAGNTPNQNFSTAANSQPQQRSQASGNQPPSI-LGQGGSAQNMGPRPGAPSQGLFGQPSS 514

Query: 473 QKA 475
           . |
Sbjct: 515 RLA 517

>hg18||uc002xre
        |20|NM_020967|Q9HCD5|NCOA5_HUMAN|NCOA5|NM_020967|NP_066018|nuclear
        receptor coactivator 5

          Length = 579

 Score =  292 bits (747), Expect = 7e-079
 Identities = 201/483 (41%), Positives = 254/483 (52%), Gaps = 52/483 (10%)

Query:  27 DAKEPRPRSRSPAYGRDGREPRDSHEGRD-----------SGRESRLGRHSRDPEYRYRS 75
           | ..||   |   . || |. |||   ||             |.||  |  ||| |    
Sbjct:  53 DIRDPRD-LRDHRHSRDLRDHRDSRSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMY---- 107

Query:  76 SESRDKDLRSDPRDIGYSRD-EYDRYYRGGADEYYRRKDEPYRDPYREPWNG-------X 127
              | .|.| | ||  | |.  |||| |   |.| ||||. | | ||. ..|        
Sbjct: 108 --DRYRDMR-DSRDPMYRREGSYDRYLR--MDDYCRRKDDSYFDRYRDSFDGRGPPGPES 162

Query: 128 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTDRPVDCSVIVVNKAQKEYAETVGRKVRD 187
                                         | .||||||||||||  |.|||.|||||||
Sbjct: 163 QSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRD 222

Query: 188 LGMVVDLIFLNTEVSLTQALEDVGRARTPFAIIITQQHQVHRSCTVNILFGTPQEHRNMP 247
           ||||||||||||||||.|||||| |  .||||.||||||.||||||||.|||||||||||
Sbjct: 223 LGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMP 282

Query: 248 MQDAMMLVAHNYDTYKVXXXXXXXXXXXXXXXXMADDVLLREPD--------RESHPISV 299
             |||.||| ||. ||                 |||. .|.| .        |  || ..
Sbjct: 283 QADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAI 342

Query: 300 LTTITLLSENRFVTPEELDTLSAYLKDKRTRLLRSTADPLAAGHADIPPTA-AGLPAPSH 358
            . | ||..||..| || | .  ||.... ||.||. | |    .  |  | .|    . 
Sbjct: 343 QSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQ 402

Query: 359 SSHLPMQSSHLGLSATSSAPANPNHQQELQAKILSLFNSXXXXXXXXXXXXTTQQSQPYS 418
            |  |.||  .  ||| .  | |  ||||||||||||||             .  . |  
Sbjct: 403 PSSQPLQSGQVLPSATPTPSAPPTSQQELQAKILSLFNS-------GTVTANSSSASPSV 455

Query: 419 NLGPPLSQNAPRQAMPGPQAASQGFGPSAGRMPVAQGHRA------PITPSNINFESPSV 472
             |   .||    |   ||  ||  |     . . ||  |      |  ||   |  || 
Sbjct: 456 AAGNTPNQNFSTAANSQPQQRSQASGNQPPSI-LGQGGSAQNMGPRPGAPSQGLFGQPSS 514

Query: 473 QKA 475
           . |
Sbjct: 515 RLA 517

>hg18||uc002xrc |20|BC056872|NA|NA|KIAA1637|NA|NA|Homo sapiens mRNA for KIAA1637
        protein, partial cds

          Length = 294

 Score =  239 bits (608), Expect = 1e-062
 Identities = 136/290 (46%), Positives = 171/290 (58%), Gaps = 23/290 (7%)

Query:  86 DPRDIGYSRD-EYDRYYRGGADEYYRRKDEPYRDPYREPWNG-------XXXXXXXXXXX 137
           | ||  | |.  |||| |   |.| ||||. | | ||. ..|                  
Sbjct:   3 DSRDPMYRREGSYDRYLR--MDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKR 60

Query: 138 XXXXXXXXXXXXXXXXXXXXDTDRPVDCSVIVVNKAQKEYAETVGRKVRDLGMVVDLIFL 197
                               | .||||||||||||  |.|||.|||||||||||||||||
Sbjct:  61 EERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFL 120

Query: 198 NTEVSLTQALEDVGRARTPFAIIITQQHQVHRSCTVNILFGTPQEHRNMPMQDAMMLVAH 257
           ||||||.|||||| |  .||||.||||||.||||||||.|||||||||||  |||.||| 
Sbjct: 121 NTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVAR 180

Query: 258 NYDTYKVXXXXXXXXXXXXXXXXMADDVLLREPD--------RESHPISVLTTITLLSEN 309
           ||. ||                 |||. .|.| .        |  || .. . | ||..|
Sbjct: 181 NYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADN 240

Query: 310 RFVTPEELDTLSAYLKDKRTRLLRSTADPL-----AAGHADIPPTAAGLP 354
           |..| || | .  ||.... ||.||. | |         |  |   .| |
Sbjct: 241 RYLTAEETDKIINYLRERKERLMRSSTDSLPGELRGRAEARFPANHSGRP 290

>hg18||uc002xrd
        |20|AF470686|Q9HCD5|NCOA5_HUMAN|NCOA5|NM_020967|NP_066018|nuclear
        receptor coactivator 5

          Length = 579

 Score =  61 bits (147), Expect = 3e-009
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 5/85 (5%)

Query: 412 QQSQPYSNLGPP-LSQNAPRQAM-PGPQAASQG-FGPSAGRMPVAQG--HRAPITPSNIN 466
           |.||   |  |  | |    | | | | | ||| ||  . |.  |     . |.. . ||
Sbjct: 475 QRSQASGNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQRPVSSTGIN 534

Query: 467 FESPSVQKALDTLLQSGPSLTPLVN 491
           |..||||||||||.||||.|. ||.
Sbjct: 535 FDNPSVQKALDTLIQSGPALSHLVS 559

>hg18||uc002xre
        |20|NM_020967|Q9HCD5|NCOA5_HUMAN|NCOA5|NM_020967|NP_066018|nuclear
        receptor coactivator 5

          Length = 579

 Score =  61 bits (147), Expect = 3e-009
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 5/85 (5%)

Query: 412 QQSQPYSNLGPP-LSQNAPRQAM-PGPQAASQG-FGPSAGRMPVAQG--HRAPITPSNIN 466
           |.||   |  |  | |    | | | | | ||| ||  . |.  |     . |.. . ||
Sbjct: 475 QRSQASGNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQRPVSSTGIN 534

Query: 467 FESPSVQKALDTLLQSGPSLTPLVN 491
           |..||||||||||.||||.|. ||.
Sbjct: 535 FDNPSVQKALDTLIQSGPALSHLVS 559

>hg18||uc002xrd
        |20|AF470686|Q9HCD5|NCOA5_HUMAN|NCOA5|NM_020967|NP_066018|nuclear
        receptor coactivator 5

          Length = 579

 Score =  50 bits (119), Expect = 5e-006
 Identities = 44/108 (40%), Positives = 52/108 (48%), Gaps = 23/108 (21%)

Query:  26 GDAKEPRPRSRSPAYGRDGREPRDSHEGRDS--------GRESRLGRHSRDPEYRYRSSE 77
           ||... | | |||  |   |||||   |||.         |. |  |||||      |  
Sbjct:  19 GDSRDSR-RDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDLRDHRHSRDLRDHRDSRS 77

Query:  78 SRD----KDLRSDPRDIGYSRD-------EYDRY--YRGGADEYYRRK 112
            ||    .||| | ||.  |||        ||||   |   |  |||.
Sbjct:  78 VRDVRDVRDLR-DFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPMYRRE 124

>hg18||uc002xre
        |20|NM_020967|Q9HCD5|NCOA5_HUMAN|NCOA5|NM_020967|NP_066018|nuclear
        receptor coactivator 5

          Length = 579

 Score =  50 bits (119), Expect = 5e-006
 Identities = 44/108 (40%), Positives = 52/108 (48%), Gaps = 23/108 (21%)

Query:  26 GDAKEPRPRSRSPAYGRDGREPRDSHEGRDS--------GRESRLGRHSRDPEYRYRSSE 77
           ||... | | |||  |   |||||   |||.         |. |  |||||      |  
Sbjct:  19 GDSRDSR-RDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDLRDHRHSRDLRDHRDSRS 77

Query:  78 SRD----KDLRSDPRDIGYSRD-------EYDRY--YRGGADEYYRRK 112
            ||    .||| | ||.  |||        ||||   |   |  |||.
Sbjct:  78 VRDVRDVRDLR-DFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPMYRRE 124

>hg18||uc001vas |13|NM_015070|Q5T200-2|Q5T200-2|ZC3H13|NM_015070|NP_055885|zinc
        finger CCCH-type containing 13

          Length = 1564

 Score =  46 bits (108), Expect = 9e-005
 Identities = 34/101 (33%), Positives = 49/101 (48%), Gaps = 8/101 (7%)

Query:  27 DAKEPRPRSRSPAYGRDGREPRDSHEGRD--SGRESRLGRHSRDPEYRYRSSE----SRD 80
           |..| |   .  .  || |. |.  .|||    |..|  |  ||      | |    |||
Sbjct: 429 DSREEREYEQDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDMRDSREMRDYSRD 488

Query:  81 KDLRSDPRDIGYSRDEYDRYYRGGADEYYRRKDEPYRDPYR 121
                ||||   .|| .|   | | | .  ||.. | .  |
Sbjct: 489 TKESRDPRDSRSTRDAHDYRDREGRDTH--RKEDTYPEESR 527

>hg18||uc001vat |13|AK056422|Q5T200-2|Q5T200-2|ZC3H13|NM_015070|NP_055885|zinc
        finger CCCH-type containing 13

          Length = 1265

 Score =  46 bits (108), Expect = 9e-005
 Identities = 34/101 (33%), Positives = 49/101 (48%), Gaps = 8/101 (7%)

Query:  27 DAKEPRPRSRSPAYGRDGREPRDSHEGRD--SGRESRLGRHSRDPEYRYRSSE----SRD 80
           |..| |   .  .  || |. |.  .|||    |..|  |  ||      | |    |||
Sbjct: 429 DSREEREYEQDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDMRDSREMRDYSRD 488

Query:  81 KDLRSDPRDIGYSRDEYDRYYRGGADEYYRRKDEPYRDPYR 121
                ||||   .|| .|   | | | .  ||.. | .  |
Sbjct: 489 TKESRDPRDSRSTRDAHDYRDREGRDTH--RKEDTYPEESR 527

>hg18||uc002lyh
        |19|NM_001080543|Q8WUQ7|CS029_HUMAN|C19orf29|NM_001080543|NP_001074012|
        chromosome 19 open reading frame 29

          Length = 758

 Score =  33 bits (75), Expect = 0.617
 Identities = 25/62 (40%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 34 RSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYRSSESRDKDLRSDPRDIGYS 93
          |||| ..||  |  |.  |||   |     | |   | |.. |  |    || ||   .|
Sbjct: 26 RSRSRSHGRRNRRRRED-EGRRRRRRRSRERRSDSEEERWQRSGMRS---RSPPRPKWHS 81

Query: 94 RD 95
          ||
Sbjct: 82 RD 83

>hg18||uc003qgw
        |6|NM_001077441|Q9NYF8-4|Q9NYF8-4|BCLAF1|NM_001077441|NP_001070909|BCL2
        -associated transcription factor 1 isoform

          Length = 747

 Score =  33 bits (75), Expect = 0.617
 Identities = 27/88 (30%), Positives = 37/88 (42%), Gaps = 2/88 (2%)

Query:  34 RSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYRSSESRDKDLRSDPRDIGYS 93
           |||| .. |  |    |     |   ||   .|||    ||..    .      |  || 
Sbjct:  22 RSRSRSHSRKKRYSSRSRSRTYSRSRSRDRMYSRDYRRDYRNNRGMRRPYGYRGRGRGYY 81

Query:  94 RDEYDRYYRGGADEYYRRKDEPYRDPYR 121
           .    ||.|||    . |.    | | |
Sbjct:  82 QGGGGRYHRGGYRPVWNRRHS--RSPRR 107

>hg18||uc003qgx
        |6|NM_014739|Q9NYF8|BCLF1_HUMAN|BCLAF1|NM_014739|NP_055554|BCL2-associa
        ted transcription factor 1 isoform

          Length = 920

 Score =  33 bits (75), Expect = 0.617
 Identities = 27/88 (30%), Positives = 37/88 (42%), Gaps = 2/88 (2%)

Query:  34 RSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYRSSESRDKDLRSDPRDIGYS 93
           |||| .. |  |    |     |   ||   .|||    ||..    .      |  || 
Sbjct:  22 RSRSRSHSRKKRYSSRSRSRTYSRSRSRDRMYSRDYRRDYRNNRGMRRPYGYRGRGRGYY 81

Query:  94 RDEYDRYYRGGADEYYRRKDEPYRDPYR 121
           .    ||.|||    . |.    | | |
Sbjct:  82 QGGGGRYHRGGYRPVWNRRHS--RSPRR 107

>hg18||uc003vux
        |7|NM_016019|Q9Y383|LC7L2_HUMAN|LUC7L2|NM_016019|NP_057103|LUC7-like 2

          Length = 392

 Score =  33 bits (75), Expect = 0.617
 Identities = 27/74 (36%), Positives = 32/74 (43%), Gaps = 8/74 (10%)

Query:  29 KEPRPRSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYRSSESRDKDLRS--- 85
           |  | |||| .  |     |  |  ||  || |  | |    .| .   | |.|  |   
Sbjct: 299 KRHRHRSRSSSRSRSRSHQRSRHSSRDRSRE-RSKRRSSKERFRDQDLASCDRDRSSRDR 357

Query:  86 DPRDIGYSRDEYDR 99
            |||    ||  |.
Sbjct: 358 SPRD----RDRKDK 367

>hg18||uc003vuy |7|BC042625|Q9Y383-2|Q9Y383-2|LUC7L2|NA|NA|Putative RNA-binding
        protein Luc7-like 2

          Length = 391

 Score =  33 bits (75), Expect = 0.617
 Identities = 27/74 (36%), Positives = 32/74 (43%), Gaps = 8/74 (10%)

Query:  29 KEPRPRSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYRSSESRDKDLRS--- 85
           |  | |||| .  |     |  |  ||  || |  | |    .| .   | |.|  |   
Sbjct: 298 KRHRHRSRSSSRSRSRSHQRSRHSSRDRSRE-RSKRRSSKERFRDQDLASCDRDRSSRDR 356

Query:  86 DPRDIGYSRDEYDR 99
            |||    ||  |.
Sbjct: 357 SPRD----RDRKDK 366

>hg18||uc003vva
        |7|AK092044|Q9Y383-2|Q9Y383-2|LUC7L2|NM_016019|NP_057103|LUC7-like 2

          Length = 339

 Score =  33 bits (75), Expect = 0.617
 Identities = 27/74 (36%), Positives = 32/74 (43%), Gaps = 8/74 (10%)

Query:  29 KEPRPRSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYRSSESRDKDLRS--- 85
           |  | |||| .  |     |  |  ||  || |  | |    .| .   | |.|  |   
Sbjct: 246 KRHRHRSRSSSRSRSRSHQRSRHSSRDRSRE-RSKRRSSKERFRDQDLASCDRDRSSRDR 304

Query:  86 DPRDIGYSRDEYDR 99
            |||    ||  |.
Sbjct: 305 SPRD----RDRKDK 314

>hg18||uc001whg
        |14|NM_001077351|Q86U06|RBM23_HUMAN|RBM23|NM_001077351|NP_001070819|RNA
        binding motif protein 23 isoform 1

          Length = 439

 Score =  33 bits (73), Expect = 1.052
 Identities = 29/94 (30%), Positives = 38/94 (40%), Gaps = 6/94 (6%)

Query:  32 RPRSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYRS------SESRDKDLRS 85
           . ||||    || .  |     |   | ||     |   .| ||      |||| .| | 
Sbjct:  61 KKRSRSHNKSRDRKRSRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRR 120

Query:  86 DPRDIGYSRDEYDRYYRGGADEYYRRKDEPYRDP 119
           . |    |      |  | .   . |.  | |.|
Sbjct: 121 EDRVHYRSPPLATGYRYGHSKSPHFREKSPVREP 154

>hg18||uc001whk
        |14|AK125593|Q86U06-3|Q86U06-3|RBM23|NM_001077351|NP_001070819|RNA
        binding motif protein 23 isoform 1

          Length = 319

 Score =  33 bits (73), Expect = 1.052
 Identities = 29/94 (30%), Positives = 38/94 (40%), Gaps = 6/94 (6%)

Query:  32 RPRSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYRS------SESRDKDLRS 85
           . ||||    || .  |     |   | ||     |   .| ||      |||| .| | 
Sbjct:  61 KKRSRSHNKSRDRKRSRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRR 120

Query:  86 DPRDIGYSRDEYDRYYRGGADEYYRRKDEPYRDP 119
           . |    |      |  | .   . |.  | |.|
Sbjct: 121 EDRVHYRSPPLATGYRYGHSKSPHFREKSPVREP 154

>hg18||uc002oxb |19|BC034980|Q4G0Z0|Q4G0Z0_HUMAN|BC034980|NA|NA|Hypothetical
        protein (Fragment)

          Length = 715

 Score =  33 bits (73), Expect = 1.052
 Identities = 28/85 (32%), Positives = 37/85 (43%), Gaps = 6/85 (7%)

Query:  34 RSRSPAYGRDGREPRDSHEGRDSGR-----ESRLGRHSRDPEYRYRSSESRDKDLRSDPR 88
           |||||.  |  |. | | . ||  |     . |  | || |      |.||      . |
Sbjct: 499 RSRSPSKERQCRQSRSSSKERDHRRSRSPSKERQRRQSRSPNKERDRSQSRSPSEEREHR 558

Query:  89 DIGYSRDEYD-RYYRGGADEYYRRK 112
                  | | | .|  . |  ||.
Sbjct: 559 QSRSPSKERDRRRWRSPSKERERRQ 583

>hg18||uc002oxb |19|BC034980|Q4G0Z0|Q4G0Z0_HUMAN|BC034980|NA|NA|Hypothetical
        protein (Fragment)

          Length = 715

 Score =  32 bits (72), Expect = 1.374
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 7/91 (7%)

Query:  32 RPRSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYRSSESRDKDLRSDPRDIG 91
           | |||||   ||    |  .. ||    ||    |.. ..    | |...| |   |   
Sbjct: 449 RSRSRSPNKARDHSRSRSPNKARD---RSRSRSPSKERDHSQLGSPSKERDHR---RSRS 502

Query:  92 YSRDEYDRYYRGGADEY-YRRKDEPYRDPYR 121
            |..   |  |  . |  .||   | ..  |
Sbjct: 503 PSKERQCRQSRSSSKERDHRRSRSPSKERQR 533

>hg18||uc002oxb |19|BC034980|Q4G0Z0|Q4G0Z0_HUMAN|BC034980|NA|NA|Hypothetical
        protein (Fragment)

          Length = 715

 Score =  32 bits (71), Expect = 1.794
 Identities = 24/64 (37%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query:  32 RPRSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYRSSESRDKD-LRSDPRDI 90
           | .||||.  |. |. |   . ||  |  |     |.      ||| ||    ||  .  
Sbjct: 545 RSQSRSPSEEREHRQSRSPSKERDR-RRWRSPSKERERRQSRSSSEERDHSRSRSPNKQS 603

Query:  91 GYSR 94
           ||||
Sbjct: 604 GYSR 607

>hg18||uc002oxb |19|BC034980|Q4G0Z0|Q4G0Z0_HUMAN|BC034980|NA|NA|Hypothetical
        protein (Fragment)

          Length = 715

 Score =  31 bits (69), Expect = 3.060
 Identities = 23/72 (31%), Positives = 28/72 (38%), Gaps = 5/72 (6%)

Query:  32 RPRSRSPAYGRDGREPRDSHEGRDSGR-----ESRLGRHSRDPEYRYRSSESRDKDLRSD 86
           | |||||   ||    |  .. ||  |     ..|    || |      | ||      |
Sbjct: 425 RSRSRSPNKARDCSRSRSPYKARDRSRSRSPNKARDHSRSRSPNKARDRSRSRSPSKERD 484

Query:  87 PRDIGYSRDEYD 98
              .|    | |
Sbjct: 485 HSQLGSPSKERD 496

>hg18||uc003qgw
        |6|NM_001077441|Q9NYF8-4|Q9NYF8-4|BCLAF1|NM_001077441|NP_001070909|BCL2
        -associated transcription factor 1 isoform

          Length = 747

 Score =  31 bits (69), Expect = 3.060
 Identities = 28/65 (43%), Positives = 29/65 (44%), Gaps = 10/65 (15%)

Query:  44 GREPRDSHEGRDSGR-----ESRLGRHSRDPEYRYRSSESRDKDL-RSDPRDIGYSRDEY 97
           ||    ||  |   |      ||   |||   |   || || .   ||  ||  |||| |
Sbjct:   2 GRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRY---SSRSRSRTYSRSRSRDRMYSRD-Y 57

Query:  98 DRYYR 102
            | ||
Sbjct:  58 RRDYR 62

>hg18||uc003qgx
        |6|NM_014739|Q9NYF8|BCLF1_HUMAN|BCLAF1|NM_014739|NP_055554|BCL2-associa
        ted transcription factor 1 isoform

          Length = 920

 Score =  31 bits (69), Expect = 3.060
 Identities = 28/65 (43%), Positives = 29/65 (44%), Gaps = 10/65 (15%)

Query:  44 GREPRDSHEGRDSGR-----ESRLGRHSRDPEYRYRSSESRDKDL-RSDPRDIGYSRDEY 97
           ||    ||  |   |      ||   |||   |   || || .   ||  ||  |||| |
Sbjct:   2 GRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRY---SSRSRSRTYSRSRSRDRMYSRD-Y 57

Query:  98 DRYYR 102
            | ||
Sbjct:  58 RRDYR 62

>hg18||uc002bso
        |15|AF006514|O14647-2|O14647-2|CHD2|NM_001271|NP_001262|chromodomain
        helicase DNA binding protein 2

          Length = 1739

 Score =  30 bits (67), Expect = 5.219
 Identities = 23/72 (31%), Positives = 31/72 (43%), Gaps = 4/72 (5%)

Query:   35 SRSPAYGRDGREPRDSHEGRDS--GRESRLGRHSRDPEYRYRS-SESRDKDLRSDPRDIG 91
            . .| .| |     . |  .|   |    .  | |   ||  . |  |  |  |  ||  
Sbjct: 1652 NNNPPWGSDRHHQYEQHWYKDHHYGDRRHMDAH-RSGSYRPNNMSRKRPYDQYSSDRDHR 1710

Query:   92 YSRDEYDRYYRG 103
              || |||| .|
Sbjct: 1711 GHRDYYDRYAKG 1722

>hg18||uc001vqj
        |13|NM_018011|Q6IQ34|Q6IQ34_HUMAN|FLJ10154|NM_018011|NP_060481|hypothet
        ical protein LOC55082

          Length = 273

 Score =  30 bits (66), Expect = 6.817
 Identities = 27/90 (30%), Positives = 38/90 (42%), Gaps = 6/90 (6%)

Query:  28 AKEPRPRSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYR-SSESRDKDLRSD 86
           .|  . |||| .  ||    |   . |.| |  |    ||        |   ||..  | 
Sbjct:  18 SKHNKKRSRSRSRSRDKERVRKRSKSRESKRNRRRESRSRSRSTNTAVSRRERDRERASS 77

Query:  87 PRDIGYSRDEYDRYY--RGGADEYYRRKDE 114
           | |     | . |    |   ||  .|..|
Sbjct:  78 PPD---RIDIFGRTVSKRSSLDEKQKREEE 104

>hg18||uc001vqk |13|AK001016|Q9NWB6|Q9NWB6_HUMAN|RP11-297I6.1|NA|NA|CDNA
        FLJ10154 fis, clone HEMBA1003418 (OTTHUMP00000018683) (FLJ10154
        protein)

          Length = 273

 Score =  30 bits (66), Expect = 6.817
 Identities = 27/90 (30%), Positives = 38/90 (42%), Gaps = 6/90 (6%)

Query:  28 AKEPRPRSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYR-SSESRDKDLRSD 86
           .|  . |||| .  ||    |   . |.| |  |    ||        |   ||..  | 
Sbjct:  18 SKHNKKRSRSRSRSRDKERVRKRSKSRESKRNRRRESRSRSRSTNTAVSRRERDRERASS 77

Query:  87 PRDIGYSRDEYDRYY--RGGADEYYRRKDE 114
           | |     | . |    |   ||  .|..|
Sbjct:  78 PPD---RIDIFGRTVSKRSSLDEKQKREEE 104

>hg18||uc003kzw |5|NM_014829|Q7L014|DDX46_HUMAN|DDX46|NM_014829|NP_055644|DEAD
        (Asp-Glu-Ala-Asp) box polypeptide 46

          Length = 1031

 Score =  30 bits (66), Expect = 6.817
 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 1/49 (2%)

Query:  32 RPRSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYRSSESRD 80
           | | |  .  || |  |    || | | |  |  |.  | | || |  |
Sbjct:  78 RSRERRRSRSRDRRRSRSRSRGRRS-RSSSPGNKSKKTENRSRSKEKTD 125

>hg18||uc004cjo
        |9|NM_001080482|NA|NA|LOC389813|NM_001080482|NP_001073951|similar to
        CG15216-PA

          Length = 943

 Score =  30 bits (66), Expect = 6.817
 Identities = 14/43 (32%), Positives = 20/43 (46%)

Query: 339 LAAGHADIPPTAAGLPAPSHSSHLPMQSSHLGLSATSSAPANP 381
           .| |    ||    ||||.  || |       ..  . .|| |
Sbjct: 785 VAVGPGTAPPGTPALPAPAPRSHGPTVRKFAKVALAAGSPARP 827

>hg18||uc002idu |17|NM_004941|Q14562|DHX8_HUMAN|DHX8|NM_004941|NP_004932|DEAH
        (Asp-Glu-Ala-His) box polypeptide 8

          Length = 1220

 Score =  30 bits (65), Expect = 8.903
 Identities = 28/100 (28%), Positives = 38/100 (38%), Gaps = 3/100 (3%)

Query:  27 DAKEPRPRSRSPAYGRDGREPRDSHEGRDSGRESRLGRHSRDPEYRYRSSESRDKDLRSD 86
           |  . . ||||    ||    |. .  ||  |  |    ||         .|| .  || 
Sbjct: 169 DRTKKKKRSRSRDRNRDRDRDRERNRDRDHKRRHRSRSRSRSRTRERNKVKSRYRS-RSR 227

Query:  87 PRDIGYSRDEYDRYYRGGADEYYRRKDEPYRDPYREPWNG 126
            .     | . |.|     | .  |     | |  ||  |
Sbjct: 228 SQSPPKDRKDRDKYGERNLDRW--RDKHVDRPPPEEPTIG 265

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,827,316
Number of Sequences: 45480
Number of Extensions: 191827316
Number of Successful Extensions: 11130448
Number of sequences better than 0.0: 0
BLASTP 7.6.0