BLASTP 7.6.0


Query=fugu4_293212 |jgi|Takru4|293212|estExt_Genewise2.C_250266
        (219 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002mju |19|NM_004218|Q2YDT2|Q2YDT2_HUMAN|RAB11B|NM_00421...    409   2e-114
hg18||uc002apk |15|NM_004663|P62491|RB11A_HUMAN|RAB11A|NM_004663...    380   1e-105
hg18||uc001fnc |1|NM_020387|P57735|RAB25_HUMAN|RAB25|NM_020387|N...    246   2e-065
hg18||uc001waw |14|NM_032846|Q8WUD1|RAB2B_HUMAN|RAB2B|NM_032846|...    191   9e-049
hg18||uc003xud |8|NM_002865|P61019|RAB2A_HUMAN|RAB2A|NM_002865|N...    189   3e-048
hg18||uc004blc |9|NM_016322|P61106|RAB14_HUMAN|RAB14|NM_016322|N...    183   1e-046
hg18||uc001ohf |11|NM_030981|Q9H0U4|RAB1B_HUMAN|RAB1B|NM_030981|...    183   2e-046
hg18||uc002sdm |2|NM_004161|P62820|RAB1A_HUMAN|RAB1A|NM_004161|N...    180   2e-045
hg18||uc002alz |15|NM_016530|Q92930|RAB8B_HUMAN|RAB8B|NM_016530|...    179   3e-045
hg18||uc003eln |3|NM_198490|Q86YS6|RAB43_HUMAN|RAB43|NM_198490|N...    179   3e-045
hg18||uc002opd |19|NM_016154|P61018|RAB4B_HUMAN|RAB4B|NM_016154|...    178   5e-045
hg18||uc002opf |19|AF217985|P61018-2|P61018-2|RAB4B|NA|NA|Ras-re...    175   4e-044
hg18||uc001fdt |1|NM_002870|P51153|RAB13_HUMAN|RAB13|NM_002870|N...    173   2e-043
hg18||uc001hth |1|NM_004578|P20338|RAB4A_HUMAN|RAB4A|NM_004578|N...    171   6e-043
hg18||uc002ndn |19|NM_005370|P61006|RAB8A_HUMAN|RAB8A|NM_005370|...    169   2e-042
hg18||uc002rgv |2|NM_016131|P61026|RAB10_HUMAN|RAB10|NM_016131|N...    168   6e-042
hg18||uc001txm |12|NM_006861|Q15286|RAB35_HUMAN|RAB35|NM_006861|...    162   3e-040
hg18||uc004fne |X|NM_171998|Q96DA2|RB39B_HUMAN|RAB39B|NM_171998|...    160   1e-039
hg18||uc001ozu |11|NM_014488|Q15771|RAB30_HUMAN|RAB30|NM_014488|...    157   1e-038
hg18||uc002hyz |17|NM_201434|P51148|RAB5C_HUMAN|RAB5C|NM_201434|...    157   1e-038
hg18||uc002hza |17|NM_004583|P51148|RAB5C_HUMAN|RAB5C|NM_004583|...    157   1e-038
hg18||uc003cbn |3|NM_004162|P20339|RAB5A_HUMAN|RAB5A|NM_004162|N...    156   2e-038
hg18||uc002mqy |19|NM_004283|O95716|RAB3D_HUMAN|RAB3D|NM_004283|...    156   3e-038
hg18||uc001siv |12|BC032740|P61020|RAB5B_HUMAN|RAB5B|NM_002868|N...    155   4e-038
hg18||uc001siw |12|NM_002868|P61020|RAB5B_HUMAN|RAB5B|NM_002868|...    155   4e-038
hg18||uc002nie |19|NM_002866|P20336|RAB3A_HUMAN|RAB3A|NM_002866|...    154   9e-038
hg18||uc001cth |1|NM_002867|P20337|RAB3B_HUMAN|RAB3B|NM_002867|N...    152   5e-037
hg18||uc002cou |16|NM_014353|Q3L6K5|Q3L6K5_HUMAN|RAB26|NM_014353...    151   6e-037
hg18||uc001pjt |11|NM_017516|Q14964|RB39A_HUMAN|RAB39|NM_017516|...    151   1e-036
hg18||uc003jrp |5|NM_138453|Q96E17|RAB3C_HUMAN|RAB3C|NM_138453|N...    150   2e-036
hg18||uc001itv |10|NM_021252|Q9NP72|RAB18_HUMAN|RAB18|NM_021252|...    148   5e-036
hg18||uc002knp |18|NM_001025300|Q6IQ22|RAB12_HUMAN|RAB12|NM_0010...    148   9e-036
hg18||uc002jle |17|NM_175738|Q8IWA7|Q8IWA7_HUMAN|RAB37|NM_175738...    147   1e-035
hg18||uc002jld |17|AK127073|NA|NA|RAB37|NA|NA|Homo sapiens cDNA ...    145   4e-035
hg18||uc002kog |18|NM_006868|Q13636|RAB31_HUMAN|RAB31|NM_006868|...    145   4e-035
hg18||uc002xyz |20|NM_020673|Q9UL26|RB22A_HUMAN|RAB22A|NM_020673...    144   7e-035
hg18||uc002jlk |17|NM_001006638|Q96AX2|RAB37_HUMAN|RAB37|NM_0010...    143   3e-034
hg18||uc001swt |12|NM_014999|Q9UL25|RAB21_HUMAN|RAB21|NM_014999|...    139   3e-033
hg18||uc002chr |16|NM_021168|Q96S21|RB40C_HUMAN|RAB40C|NM_021168...    139   4e-033
hg18||uc002kft |17|NM_006822|Q12829|RB40B_HUMAN|RAB40B|NM_006822...    136   3e-032
hg18||uc004cvm |X|NM_004251|P51151|RAB9_HUMAN|RAB9A|NM_004251|NP...    134   8e-032
hg18||uc004ell |X|NM_016370|Q9NP90|RAB9B_HUMAN|RAB9B|NM_016370|N...    134   8e-032
hg18||uc002ndm |19|AB209767|Q59EP4|Q59EP4_HUMAN|RAB8|NA|NA|Mel t...    134   1e-031
hg18||uc001oue |11|NM_002869|P20340-2|P20340-2|RAB6A|NM_002869|N...    133   2e-031
hg18||uc001ouf |11|NM_198896|P20340|RAB6A_HUMAN|RAB6A|NM_198896|...    132   5e-031
hg18||uc003epy |3|NM_016577|Q9NRW1|RAB6B_HUMAN|RAB6B|NM_016577|N...    132   5e-031
hg18||uc004ejs |X|NM_001031834|P0C0E4|RB40L_HUMAN|LOC286526|NM_0...    131   6e-031
hg18||uc004ekk |X|NM_080879|Q8WXH6|RB40A_HUMAN|RAB40A|NM_080879|...    131   6e-031
hg18||uc004amo |9|NM_152573|Q8IZ41|Q8IZ41_HUMAN|RASEF|NM_152573|...    131   8e-031
hg18||uc002vwz |2|NM_022449|Q9H0T7|RAB17_HUMAN|RAB17|NM_022449|N...    131   1e-030
hg18||uc003ihv |4|NM_031296|Q9H082|RB33B_HUMAN|RAB33B|NM_031296|...    131   1e-030
hg18||uc003eks |3|NM_004637|P51149|RAB7_HUMAN|RAB7A|NM_004637|NP...    129   2e-030
hg18||uc004evl |X|NM_004794|Q14088|RB33A_HUMAN|RAB33A|NM_004794|...    128   5e-030
hg18||uc001xhz |14|NM_198686|P59190-2|P59190-2|RAB15|NM_198686|N...    124   1e-028
hg18||uc002jlc |17|AK054846|NA|NA|RAB37|NA|NA|Homo sapiens cDNA ...    122   4e-028
hg18||uc003pds |6|NM_183227|Q9ULC3|RAB23_HUMAN|RAB23|NM_183227|N...    121   7e-028
hg18||uc003pdt |6|NM_016277|Q9ULC3|RAB23_HUMAN|RAB23|NM_016277|N...    121   7e-028
hg18||uc001ozv |11|BX641138|Q6MZH2|Q6MZH2_HUMAN|DKFZp686J07132|N...    121   1e-027
hg18||uc004dyc |X|NM_001032726|Q5JT25|RAB41_HUMAN|RAB41|NM_00103...    121   1e-027
hg18||uc002tsr |2|NM_001077637|Q53S08|Q53S08_HUMAN|LOC150786|NM_...    116   2e-026
hg18||uc002tpx |2|NM_032144|Q53RU3|Q53RU3_HUMAN|RAB6C|NM_032144|...    115   5e-026
hg18||uc002zwv |22|NM_004914|O95755|RAB36_HUMAN|RAB36|NM_004914|...    114   1e-025
hg18||uc001hdd |1|NM_003929|O14966|RAB7L_HUMAN|RAB7L1|NM_003929|...    113   2e-025
hg18||uc001hde |1|BC002585|O14966|RAB7L_HUMAN|RAB7L1|NM_003929|N...    113   2e-025
hg18||uc001hdf |1|BX647960|O14966|RAB7L_HUMAN|RAB7L1|NM_003929|N...    113   2e-025
hg18||uc003qln |6|NM_006834|Q13637|RAB32_HUMAN|RAB32|NM_006834|N...    112   3e-025
hg18||uc002tmk |2|NM_002881|P11234|RALB_HUMAN|RALB|NM_002881|NP_...    110   2e-024
hg18||uc002tkn |2|NM_007082|Q9UBK7|RBL2A_HUMAN|RABL2A|NM_007082|...    106   3e-023
hg18||uc002tko |2|NM_013412|Q9UBK7|RBL2A_HUMAN|RABL2A|NM_013412|...    106   3e-023
hg18||uc003mfv |5|NM_130781|Q969Q5|RAB24_HUMAN|RAB24|NM_130781|N...    106   3e-023
hg18||uc003mfw |5|NM_001031677|Q969Q5|RAB24_HUMAN|RAB24|NM_00103...    106   3e-023
hg18||uc002hcf |17|CR613380|Q5BJE6|Q5BJE6_HUMAN|RAB34|NM_031934|...    105   5e-023
hg18||uc002hch |17|AK027312|Q9BZG1|RAB34_HUMAN|RAB34|NM_031934|N...    105   5e-023
hg18||uc002tkp |2|BC126129|A0AUY0|A0AUY0_HUMAN|RABL2A|NM_013412|...    105   5e-023
hg18||uc002tkr |2|CU013154|Q9UBK7-2|Q9UBK7-2|RABL2A|NM_013412|NP...    105   5e-023
hg18||uc002tks |2|CR456554|Q9UBK7-2|Q9UBK7-2|RABL2A|NM_013412|NP...    105   5e-023
hg18||uc003vvr |7|NM_001008749|NA|NA|RAB19B|NM_001008749|NP_0010...    105   5e-023
hg18||uc002hce |17|NM_031934|Q5BJE6|Q5BJE6_HUMAN|RAB34|NM_031934...    105   6e-023
hg18||uc003bnl |22|NM_007081|Q9UNT1|RBL2B_HUMAN|RABL2B|NM_007081...    104   8e-023
hg18||uc003bno |22|CR621508|Q9UNT1|RBL2B_HUMAN|RABL2B|NM_007081|...    104   8e-023
hg18||uc001fdu |1|AK128675|NA|NA|RAB13|NA|NA|Homo sapiens small ...    104   1e-022
hg18||uc002aco |15|NM_183234|P51159|RB27A_HUMAN|RAB27A|NM_183234...    104   1e-022
hg18||uc002acp |15|NM_004580|P51159|RB27A_HUMAN|RAB27A|NM_004580...    104   1e-022
hg18||uc002acq |15|NM_183236|P51159|RB27A_HUMAN|RAB27A|NM_183236...    104   1e-022
hg18||uc002acr |15|NM_183235|P51159|RB27A_HUMAN|RAB27A|NM_183235...    104   1e-022
hg18||uc003bnk |22|NM_001003789|Q9UNT1-2|Q9UNT1-2|RABL2B|NM_0010...    104   1e-022
hg18||uc003bnn |22|BC024281|Q9UNT1-2|Q9UNT1-2|RABL2B|NM_00100378...    104   1e-022
hg18||uc001pcj |11|NM_022337|P57729|RAB38_HUMAN|RAB38|NM_022337|...    103   2e-022
hg18||uc001wax |14|BC066366|Q6NZ33|Q6NZ33_HUMAN|RAB2B|NA|NA|RAB2...    102   3e-022
hg18||uc003bnm |22|BC075856|Q9UNT1|RBL2B_HUMAN|RABL2B|NM_007081|...    102   3e-022
hg18||uc003thd |7|NM_005402|P11233|RALA_HUMAN|RALA|NM_005402|NP_...    102   3e-022
hg18||uc002hcc |17|AF327350|Q96PJ7|Q96PJ7_HUMAN|RAB34|NM_031934|...    101   9e-022
hg18||uc001uir |12|NM_006325|P62826|RAN_HUMAN|RAN|NM_006325|NP_0...     97   2e-020
hg18||uc001uis |12|BC016654|P62826|RAN_HUMAN|RAN|NM_006325|NP_00...     97   2e-020
hg18||uc002lfr |18|NM_004163|O00194|RB27B_HUMAN|RAB27B|NM_004163...     96   2e-020
hg18||uc002hcd |17|DQ893756|Q9BZG1-2|Q9BZG1-2|RAB34|NM_031934|NP...     94   9e-020
hg18||uc002hcg |17|BC016841|Q9BZG1-2|Q9BZG1-2|RAB34|NM_031934|NP...     94   9e-020
hg18||uc002chq |16|AY823398|Q5PXE8|Q5PXE8_HUMAN|RAB40C|NM_021168...     94   1e-019
hg18||uc003ekt |3|BX537775|NA|NA|RAB7|NA|NA|Homo sapiens PRO2706...     93   3e-019
hg18||uc001itw |10|AY574034|Q56UN9|Q56UN9_HUMAN|RAB18|NM_021252|...     92   3e-019

>hg18||uc002mju
        |19|NM_004218|Q2YDT2|Q2YDT2_HUMAN|RAB11B|NM_004218|NP_004209|RAB11B,
        member RAS oncogene family

          Length = 218

 Score =  409 bits (1049), Expect = 2e-114
 Identities = 204/217 (94%), Positives = 210/217 (96%)

Query:   1 MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct:   1 MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI 60

Query:  61 KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIM 120
           |||||||||||||| |||||||||||||||||||||||||||||||||||||||.|||||
Sbjct:  61 KAQIWDTAGQERYRRITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM 120

Query: 121 LVGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ 180
           |||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||
Sbjct: 121 LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ 180

Query: 181 ISDRSGHDESPGNNVVDISLPPTTDSQRGGKLPCCQS 217
           |.||. |||||||||||||.||||| |.  || |||.
Sbjct: 181 IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQN 217

>hg18||uc002apk
        |15|NM_004663|P62491|RB11A_HUMAN|RAB11A|NM_004663|NP_004654|Ras-related
        protein Rab-11A

          Length = 216

 Score =  380 bits (974), Expect = 1e-105
 Identities = 194/216 (89%), Positives = 203/216 (93%), Gaps = 2/216 (0%)

Query:   1 MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct:   1 MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI 60

Query:  61 KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIM 120
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||.|||||
Sbjct:  61 KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM 120

Query: 121 LVGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ 180
           |||||||||||||||||||||||||| ||||||||||||||| ||. |||||||||||||
Sbjct: 121 LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ 180

Query: 181 ISDRSGHDESPGNNVVDISLPPTTDSQRGGKLPCCQ 216
           .|||  .| || |||| | .||||...   |. |||
Sbjct: 181 MSDRRENDMSPSNNVVPIHVPPTTENK--PKVQCCQ 214

>hg18||uc001fnc |1|NM_020387|P57735|RAB25_HUMAN|RAB25|NM_020387|NP_065120|RAB25

          Length = 213

 Score =  246 bits (626), Expect = 2e-065
 Identities = 127/185 (68%), Positives = 153/185 (82%), Gaps = 2/185 (1%)

Query:   2 GTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIK 61
           || .| |...|||||||.|||||.|||||||||||. .|..||||||.||.. .    .|
Sbjct:   4 GTEED-YNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVK 62

Query:  62 AQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIML 121
           |||||||| ||||||||||||||||||||.|. || ||  |||||||| |||.  ||.||
Sbjct:  63 AQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVML 122

Query: 122 VGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVS-QKQ 180
           |||||||   | |||.||| ||| | | |.||||||||||| ||. .| ||.  || |.|
Sbjct: 123 VGNKSDLSQAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQ 182

Query: 181 ISDRS 185
            | |.
Sbjct: 183 NSIRT 187

>hg18||uc001waw |14|NM_032846|Q8WUD1|RAB2B_HUMAN|RAB2B|NM_032846|NP_116235|RAB2B
        protein

          Length = 216

 Score =  191 bits (483), Expect = 9e-049
 Identities = 95/171 (55%), Positives = 120/171 (70%)

Query:   8 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67
           | |||| ..|||.||||| || .||   |      ||||||  | . .||| || |||||
Sbjct:   3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDT 62

Query:  68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSD 127
           |||| .|.|| .||||| |||||||| .  |. ..  ||.. | |. .|.||||.|||||
Sbjct:  63 AGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSD 122

Query: 128 LRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQ 178
           |   | |  .|  ||| .. | |.||||  . |||||| |   |||| . |
Sbjct: 123 LESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQ 173

>hg18||uc003xud |8|NM_002865|P61019|RAB2A_HUMAN|RAB2A|NM_002865|NP_002856|RAB2,
        member RAS oncogene family

          Length = 212

 Score =  189 bits (478), Expect = 3e-048
 Identities = 94/171 (54%), Positives = 121/171 (70%)

Query:   8 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67
           | |||| ..|||.||||| || .||   |      ||||||  | | .||| || |||||
Sbjct:   3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDT 62

Query:  68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSD 127
           |||| .|.|| .||||| |||||||| .  |. ..  ||.. | |...|.||||.|||||
Sbjct:  63 AGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSD 122

Query: 128 LRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQ 178
           |   | |  .|  ||| .. | |.||||  ..|||||| |   |||  . .
Sbjct: 123 LESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQE 173

>hg18||uc004blc |9|NM_016322|P61106|RAB14_HUMAN|RAB14|NM_016322|NP_057406|GTPase
        Rab14

          Length = 215

 Score =  183 bits (464), Expect = 1e-046
 Identities = 91/174 (52%), Positives = 119/174 (68%)

Query:   1 MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI 60
           | |    | |.|| ..||| ||||| || .||  .|  .   |||||| || |.| |. |
Sbjct:   1 MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKI 60

Query:  61 KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIM 120
           | ||||||||||.||.| .||||| |||.|||| .  || ..  || . |.  . | ||.
Sbjct:  61 KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVII 120

Query: 121 LVGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYR 174
           |.|||.||   | |  .||. |||.| | |.| ||    |||.||     .||.
Sbjct: 121 LIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQ 174

>hg18||uc001ohf
        |11|NM_030981|Q9H0U4|RAB1B_HUMAN|RAB1B|NM_030981|NP_112243|RAB1B,
        member RAS oncogene family

          Length = 201

 Score =  183 bits (463), Expect = 2e-046
 Identities = 91/166 (54%), Positives = 121/166 (72%)

Query:   7 EYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWD 66
           |||||||..|||||||||| || ||  . .     |||||.|  |.|..|||||| ||||
Sbjct:   4 EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWD 63

Query:  67 TAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKS 126
           ||||||.| |||.||||| | ..|||.    .| ||..||.|.  .|  |.  .||||||
Sbjct:  64 TAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKS 123

Query: 127 DLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
           ||   . |    |. ||.   . |.|||| ..||||.||  .  ||
Sbjct: 124 DLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEI 169

>hg18||uc002sdm |2|NM_004161|P62820|RAB1A_HUMAN|RAB1A|NM_004161|NP_004152|RAB1A,
        member RAS oncogene family

          Length = 205

 Score =  180 bits (455), Expect = 2e-045
 Identities = 89/172 (51%), Positives = 123/172 (71%)

Query:   1 MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI 60
           | . . |||||||..|||||||||| || ||  . .     |||||.|  |.|..|||||
Sbjct:   1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI 60

Query:  61 KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIM 120
           | ||||||||||.| |||.||||| | ..|||.    .. ||..||.|.  .|  |.  .
Sbjct:  61 KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL 120

Query: 121 LVGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
           ||||| ||   . |    |. ||.   . |.|||| ..||||..|  .  ||
Sbjct: 121 LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEI 172

>hg18||uc002alz
        |15|NM_016530|Q92930|RAB8B_HUMAN|RAB8B|NM_016530|NP_057614|RAB8B,
        member RAS oncogene family

          Length = 207

 Score =  179 bits (453), Expect = 3e-045
 Identities = 86/184 (46%), Positives = 123/184 (66%)

Query:   8 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67
           ||||||..|||||||||. || ||. . ||    ||||..|  |.|..||| || |||||
Sbjct:   5 YDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDT 64

Query:  68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSD 127
           |||||.| ||.||||||.| .|||||    ...|.. |.. . .|| ...  |..||| |
Sbjct:  65 AGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCD 124

Query: 128 LRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISDRSGH 187
           .   | |  .     |    . |.||||  | ||||||  .  .|   ...|     |  
Sbjct: 125 MNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAG 184

Query: 188 DESP 191
              |
Sbjct: 185 AGGP 188

>hg18||uc003eln |3|NM_198490|Q86YS6|RAB43_HUMAN|RAB43|NM_198490|NP_940892|RAB43
        protein

          Length = 212

 Score =  179 bits (452), Expect = 3e-045
 Identities = 87/172 (50%), Positives = 124/172 (72%), Gaps = 1/172 (0%)

Query:   2 GTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIK 61
           |  |..||.|||.||.||. |||. .. ||    |.    |||||.|  ..... || .|
Sbjct:   9 GDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVK 68

Query:  62 AQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIML 121
            ||||||||||.| || .||| | ||.| ||| |  .. .|  |....| .| .||| .|
Sbjct:  69 LQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLL 128

Query: 122 VGNKSDLRHLRAVPTDEARAFAEK-NTLSFIETSALDSTNVEEAFKNILTEI 172
           .||||||  || |   ||.. ||  . |  ||||| ||.||||||  . ||.
Sbjct: 129 IGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATEL 180

>hg18||uc002opd
        |19|NM_016154|P61018|RAB4B_HUMAN|RAB4B|NM_016154|NP_057238|ras-related
        GTP-binding protein 4b

          Length = 213

 Score =  178 bits (451), Expect = 5e-045
 Identities = 95/182 (52%), Positives = 122/182 (67%), Gaps = 1/182 (0%)

Query:   6 DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIW 65
           . ||.||| ..|| .| ||| || .|  |.|  .|  |||||| .| . | |||.| |||
Sbjct:   3 ETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIW 62

Query:  66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNK 125
           |||||||.|..| .||||| ||||||||    || ..  || . |  |  |||..| |||
Sbjct:  63 DTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNK 122

Query: 126 SDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAF-KNILTEIYRIVSQKQISDR 184
            ||   | |   ||  ||..| | |.|||||   |||||| |   | . .| | .   .|
Sbjct: 123 KDLDPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPER 182

Query: 185 SG 186
            |
Sbjct: 183 MG 184

>hg18||uc002opf |19|AF217985|P61018-2|P61018-2|RAB4B|NA|NA|Ras-related protein
        Rab-4B

          Length = 239

 Score =  175 bits (443), Expect = 4e-044
 Identities = 94/179 (52%), Positives = 120/179 (67%), Gaps = 1/179 (0%)

Query:   9 DYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTA 68
           |.||| ..|| .| ||| || .|  |.|  .|  |||||| .| . | |||.| ||||||
Sbjct:  32 DFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTA 91

Query:  69 GQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDL 128
           ||||.|..| .||||| ||||||||    || ..  || . |  |  |||..| ||| ||
Sbjct:  92 GQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDL 151

Query: 129 RHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAF-KNILTEIYRIVSQKQISDRSG 186
              | |   ||  ||..| | |.|||||   |||||| |   | . .| | .   .| |
Sbjct: 152 DPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMG 210

>hg18||uc001fdt |1|NM_002870|P51153|RAB13_HUMAN|RAB13|NM_002870|NP_002861|RAB13,
        member RAS oncogene family

          Length = 203

 Score =  173 bits (437), Expect = 2e-043
 Identities = 83/184 (45%), Positives = 124/184 (67%), Gaps = 4/184 (2%)

Query:   8 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67
           ||.|||..|||||||||. |. ||  . ||    ||||..|  |.. ..|| || |.|||
Sbjct:   5 YDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDT 64

Query:  68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSD 127
           |||||.. ||.||||||.| .|||||    ..||.. |.| ....|   .  .|.||| |
Sbjct:  65 AGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCD 124

Query: 128 LRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISDRSGH 187
           .   | |  ..|   | .. . | ||||  | ||.||| ..  .|      |    |||.
Sbjct: 125 MEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDIL----LKSGGRRSGN 180

Query: 188 DESP 191
              |
Sbjct: 181 GNKP 184

>hg18||uc001hth |1|NM_004578|P20338|RAB4A_HUMAN|RAB4A|NM_004578|NP_004569|RAB4A,
        member RAS oncogene family

          Length = 218

 Score =  171 bits (433), Expect = 6e-043
 Identities = 89/176 (50%), Positives = 115/176 (65%)

Query:   6 DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIW 65
           . ||.||| ..||..| ||| || .|   .|  .|  |||||| .. | | || .| |||
Sbjct:   8 ETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIW 67

Query:  66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNK 125
           |||||||.|..| .||||| ||||||||    ||  .  || . |  |  ||||.| |||
Sbjct:  68 DTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNK 127

Query: 126 SDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQI 181
            ||   | |   ||  ||..| | |.|||||   ||||||     .|   .   ..
Sbjct: 128 KDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGEL 183

>hg18||uc002ndn |19|NM_005370|P61006|RAB8A_HUMAN|RAB8A|NM_005370|NP_005361|mel
        transforming oncogene

          Length = 207

 Score =  169 bits (428), Expect = 2e-042
 Identities = 81/172 (47%), Positives = 117/172 (68%)

Query:   8 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67
           ||||||..|||||||||. .| ||. . ||    ||||..|  |.|..||| || |||||
Sbjct:   5 YDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDT 64

Query:  68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSD 127
           |||||.| ||.||||||.| .|||||    ...|.  |.. . .||  ..  |..||| |
Sbjct:  65 AGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCD 124

Query: 128 LRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 179
           .   | |  .     |    . |.||||  . ||| ||  .  .|   . .|
Sbjct: 125 VNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK 176

>hg18||uc002rgv
        |2|NM_016131|P61026|RAB10_HUMAN|RAB10|NM_016131|NP_057215|ras-related
        GTP-binding protein RAB10

          Length = 200

 Score =  168 bits (424), Expect = 6e-042
 Identities = 79/173 (45%), Positives = 119/173 (68%)

Query:   8 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67
           || |||..|||||||||. .| ||. . ||    ||||..|  ..... || || |||||
Sbjct:   6 YDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDT 65

Query:  68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSD 127
           |||||.  ||..|||||.| .|||||    ..||. .||. . .||. ..  ||.||| |
Sbjct:  66 AGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCD 125

Query: 128 LRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ 180
           .   | ||  .    | .. . | ||||  . |.|.||  .  .| |    |.
Sbjct: 126 MDDKRVVPKGKGGQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKE 178

>hg18||uc001txm
        |12|NM_006861|Q15286|RAB35_HUMAN|RAB35|NM_006861|NP_006852|RAB35,
        member RAS oncogene family

          Length = 201

 Score =  162 bits (409), Expect = 3e-040
 Identities = 80/166 (48%), Positives = 118/166 (71%), Gaps = 2/166 (1%)

Query:   7 EYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWD 66
           .||.|||...|||||||||.|| ||  | |.    .||||.|  |.....|. .| ||||
Sbjct:   4 DYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWD 63

Query:  67 TAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKS 126
           ||||||.| ||| ||||  | ..|||.    .. ||.||| |.  . | ..  .|||||.
Sbjct:  64 TAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCD-DVCRILVGNKN 122

Query: 127 DLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
           |    . | |..|  || .  .   |||| .. |||| | | .||.
Sbjct: 123 DDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMF-NCITEL 167

>hg18||uc004fne
        |X|NM_171998|Q96DA2|RB39B_HUMAN|RAB39B|NM_171998|NP_741995|RAB39B,
        member RAS oncogene family

          Length = 213

 Score =  160 bits (404), Expect = 1e-039
 Identities = 83/179 (46%), Positives = 119/179 (66%), Gaps = 2/179 (1%)

Query:  10 YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVD-GKTIKAQIWDTA 68
           | |....|||| |||| |. |||   |   |  |.||.| .| .... || || ||||||
Sbjct:   7 YQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTA 66

Query:  69 GQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHAD-NNIVIMLVGNKSD 127
           ||||.|.|| |||| .|| ||..||    ...||  ||.| . |     || .|||.| |
Sbjct:  67 GQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCD 126

Query: 128 LRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISDRSG 186
           |   | |   ||   |    . .||||| |. |||.|| ..  .|| .| . .|. . |
Sbjct: 127 LDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEG 185

>hg18||uc001ozu
        |11|NM_014488|Q15771|RAB30_HUMAN|RAB30|NM_014488|NP_055303|RAB30,
        member RAS oncogene family

          Length = 203

 Score =  157 bits (396), Expect = 1e-038
 Identities = 76/186 (40%), Positives = 122/186 (65%), Gaps = 3/186 (1%)

Query:   6 DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIW 65
           ..||.|||.||||..||||. |. |||.  |     .||||.|  ......|. .| |||
Sbjct:   4 EDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIW 63

Query:  66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNK 125
           |||||||.|.|| .||| |   .| |||    ..  .  ||.|.  .| | .. .|||||
Sbjct:  64 DTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNK 123

Query: 126 SDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISDRS 185
            ||   | |    |  |.|   . ..|||| .| |||. | ..     |..|. . .   
Sbjct: 124 IDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLAC---RLISEARQNTLV 180

Query: 186 GHDESP 191
            .  ||
Sbjct: 181 NNVSSP 186

>hg18||uc002hyz
        |17|NM_201434|P51148|RAB5C_HUMAN|RAB5C|NM_201434|NP_958842|RAB5C,
        member RAS oncogene family isoform a

          Length = 216

 Score =  157 bits (396), Expect = 1e-038
 Identities = 78/161 (48%), Positives = 110/161 (68%)

Query:  12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE 71
           ||.||.|.| ||||.|. || . .|.   .||||  | |... .|  |.| .||||||||
Sbjct:  22 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQE 81

Query:  72 RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHL 131
           || ..   |||||  |..||||    |.   . |.|||.  |  |||| | |||.||   
Sbjct:  82 RYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASK 141

Query: 132 RAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
           |||   ||.|.|. |.| |.||||  . || | |  |  ..
Sbjct: 142 RAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL 182

>hg18||uc002hza
        |17|NM_004583|P51148|RAB5C_HUMAN|RAB5C|NM_004583|NP_004574|RAB5C,
        member RAS oncogene family isoform b

          Length = 216

 Score =  157 bits (396), Expect = 1e-038
 Identities = 78/161 (48%), Positives = 110/161 (68%)

Query:  12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE 71
           ||.||.|.| ||||.|. || . .|.   .||||  | |... .|  |.| .||||||||
Sbjct:  22 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQE 81

Query:  72 RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHL 131
           || ..   |||||  |..||||    |.   . |.|||.  |  |||| | |||.||   
Sbjct:  82 RYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASK 141

Query: 132 RAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
           |||   ||.|.|. |.| |.||||  . || | |  |  ..
Sbjct: 142 RAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL 182

>hg18||uc003cbn |3|NM_004162|P20339|RAB5A_HUMAN|RAB5A|NM_004162|NP_004153|RAB5A,
        member RAS oncogene family

          Length = 215

 Score =  156 bits (394), Expect = 2e-038
 Identities = 77/161 (47%), Positives = 111/161 (68%)

Query:  12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE 71
           ||.||.|.| ||||.|. || . .|.   .||||  | |... .|  |.| .||||||||
Sbjct:  21 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQE 80

Query:  72 RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHL 131
           || ..   |||||  |..||||    ..   . |.|||.  |  |||| | |||.|| . 
Sbjct:  81 RYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANK 140

Query: 132 RAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
           |||   ||...|. |.| |.||||  | || | |  |  ..
Sbjct: 141 RAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL 181

>hg18||uc002mqy
        |19|NM_004283|O95716|RAB3D_HUMAN|RAB3D|NM_004283|NP_004274|RAB3D,
        member RAS oncogene family

          Length = 219

 Score =  156 bits (392), Expect = 3e-038
 Identities = 77/197 (39%), Positives = 119/197 (60%)

Query:   5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQI 64
           |  .||.||..|||.| |||.. | |.  . |     ||.|..|  ...    | || ||
Sbjct:  16 DQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQI 75

Query:  65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGN 124
           |||||||||| ||.||||||.| ||.||||   ..  |. |  ... .. .|  ..||||
Sbjct:  76 WDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGN 135

Query: 125 KSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISDR 184
           | ||   | || .. |  |.     | | || .. ||.. |. ..  |   ...      
Sbjct: 136 KCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSS 195

Query: 185 SGHDESPGNNVVDISLP 201
           |      |  | |   |
Sbjct: 196 SSGSNGKGPAVGDAPAP 212

>hg18||uc001siv |12|BC032740|P61020|RAB5B_HUMAN|RAB5B|NM_002868|NP_002859|RAB5B,
        member RAS oncogene family

          Length = 215

 Score =  155 bits (391), Expect = 4e-038
 Identities = 76/161 (47%), Positives = 111/161 (68%)

Query:  12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE 71
           ||.||.|.| ||||.|. || . .|.   .||||  | |.|. .|  |.| .||||||||
Sbjct:  21 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQE 80

Query:  72 RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHL 131
           || ..   |||||  |..||||    |.   . |.|||.  |  .||| | |||.|| . 
Sbjct:  81 RYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANK 140

Query: 132 RAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
           | |  .||.|.|. |.| |.||||  . || . |  |  ..
Sbjct: 141 RMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKL 181

>hg18||uc001siw
        |12|NM_002868|P61020|RAB5B_HUMAN|RAB5B|NM_002868|NP_002859|RAB5B,
        member RAS oncogene family

          Length = 215

 Score =  155 bits (391), Expect = 4e-038
 Identities = 76/161 (47%), Positives = 111/161 (68%)

Query:  12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE 71
           ||.||.|.| ||||.|. || . .|.   .||||  | |.|. .|  |.| .||||||||
Sbjct:  21 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQE 80

Query:  72 RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHL 131
           || ..   |||||  |..||||    |.   . |.|||.  |  .||| | |||.|| . 
Sbjct:  81 RYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANK 140

Query: 132 RAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
           | |  .||.|.|. |.| |.||||  . || . |  |  ..
Sbjct: 141 RMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKL 181

>hg18||uc002nie
        |19|NM_002866|P20336|RAB3A_HUMAN|RAB3A|NM_002866|NP_002857|RAB3A,
        member RAS oncogene family

          Length = 220

 Score =  154 bits (388), Expect = 9e-038
 Identities = 76/202 (37%), Positives = 123/202 (60%), Gaps = 1/202 (0%)

Query:   5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQI 64
           |  .||.||...||.| |||.. | |.  . |     ||.|..|  ..|  . | || ||
Sbjct:  16 DQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQI 75

Query:  65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGN 124
           |||||||||| ||.||||||.| .|.|||    ..  |. |  ... .. .|  ..||||
Sbjct:  76 WDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGN 135

Query: 125 KSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQK-QISD 183
           | |.   | | ..  |  |.     | | || |. ||.. |. ..  |   .|.    .|
Sbjct: 136 KCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTAD 195

Query: 184 RSGHDESPGNNVVDISLPPTTD 205
            .      |  . |  .||  |
Sbjct: 196 PAVTGAKQGPQLSDQQVPPHQD 217

>hg18||uc001cth |1|NM_002867|P20337|RAB3B_HUMAN|RAB3B|NM_002867|NP_002858|RAB3B,
        member RAS oncogene family

          Length = 219

 Score =  152 bits (382), Expect = 5e-037
 Identities = 73/193 (37%), Positives = 120/193 (62%)

Query:   5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQI 64
           |  .||.||...||.| |||.. | |.  . |     ||.|..|  ...    | .| ||
Sbjct:  16 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQI 75

Query:  65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGN 124
           |||||||||| ||.||||||.| .|.|||    ..  |. |  ... .. .|  ..||||
Sbjct:  76 WDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGN 135

Query: 125 KSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISDR 184
           | |.   | |||.. .  ||.    | | || .. .| .||. ..  |   .|    .| 
Sbjct: 136 KCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDP 195

Query: 185 SGHDESPGNNVVD 197
           |    |    . |
Sbjct: 196 SMLGSSKNTRLSD 208

>hg18||uc002cou
        |16|NM_014353|Q3L6K5|Q3L6K5_HUMAN|RAB26|NM_014353|NP_055168|RAB26,
        member RAS oncogene family

          Length = 256

 Score =  151 bits (381), Expect = 6e-037
 Identities = 74/168 (44%), Positives = 110/168 (65%), Gaps = 1/168 (0%)

Query:   6 DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLES-KSTIGVEFATRSIQVDGKTIKAQI 64
           | ||  |||.|.|||||||. || ||    |   .  ||.|..|  . . |||  .| |.
Sbjct:  58 DFYDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQM 117

Query:  65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGN 124
           ||||||||.|..| |||| |   ||.||.    ...|.. || |. ..| ... .||.||
Sbjct: 118 WDTAGQERFRSVTHAYYRDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGN 177

Query: 125 KSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
           | |  | | |  ..    |..  | |.||||    ||. ||  |  |.
Sbjct: 178 KVDSAHERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKEL 225

>hg18||uc001pjt
        |11|NM_017516|Q14964|RB39A_HUMAN|RAB39|NM_017516|NP_059986|rab-related
        GTP-binding protein

          Length = 217

 Score =  151 bits (379), Expect = 1e-036
 Identities = 81/183 (44%), Positives = 122/183 (66%), Gaps = 6/183 (3%)

Query:  10 YLFKVVLIGDSGVGKSNLLSRFTRNEF-NLESKS---TIGVEFATRSIQVD-GKTIKAQI 64
           | |....|||| |||| || |||.  |  | | .   |.||.| .| .... || || |.
Sbjct:   7 YQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQL 66

Query:  65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADN-NIVIMLVG 123
           ||||||||.|.|| .||| .||  ||.||    ..|.|. ||.| . .     || .|||
Sbjct:  67 WDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVG 126

Query: 124 NKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISD 183
           .| ||   | |  .||   .    . .||||| |.|||||.|  .  .|| .. . .|  
Sbjct: 127 HKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICI 186

Query: 184 RSG 186
           . |
Sbjct: 187 QDG 189

>hg18||uc003jrp |5|NM_138453|Q96E17|RAB3C_HUMAN|RAB3C|NM_138453|NP_612462|RAB3C,
        member RAS oncogene family

          Length = 227

 Score =  150 bits (377), Expect = 2e-036
 Identities = 70/179 (39%), Positives = 116/179 (64%)

Query:   5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQI 64
           |  .||.||...||.| |||.. | |.  . |     ||.|..|  ...  . | || ||
Sbjct:  24 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQI 83

Query:  65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGN 124
           |||||||||| ||.||||||.| .|.|||    ..  |. |  ... .. .|  ..||||
Sbjct:  84 WDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGN 143

Query: 125 KSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISD 183
           | |.   | . |.  .   |.    | |||| |. ||.. |. ..  |   .|.   .|
Sbjct: 144 KCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETD 202

>hg18||uc001itv
        |10|NM_021252|Q9NP72|RAB18_HUMAN|RAB18|NM_021252|NP_067075|RAB18,
        member RAS oncogene family

          Length = 206

 Score =  148 bits (373), Expect = 5e-036
 Identities = 78/169 (46%), Positives = 112/169 (66%), Gaps = 2/169 (1%)

Query:   5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQI 64
           |..     |...||.||||||.|| ||| . |. |  .||||.|  ..| |||   |  |
Sbjct:   2 DEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAI 61

Query:  65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHAD-NNIVIMLVG 123
           ||||||||.| .| .||||| | .||||. .  |.  .. || ||  .   |.|| ||||
Sbjct:  62 WDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVG 121

Query: 124 NKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
           || | .  | |  .|   || |... ||| ||     |. ||. .. .|
Sbjct: 122 NKID-KENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKI 169

>hg18||uc002knp
        |18|NM_001025300|Q6IQ22|RAB12_HUMAN|RAB12|NM_001025300|NP_001020471|RAB
        12, member RAS oncogene family

          Length = 244

 Score =  148 bits (371), Expect = 9e-036
 Identities = 71/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (0%)

Query:   9 DYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTA 68
           |.  .|..||  ||||..|. ||| . |    |||.||.|  ..... || |. ||||||
Sbjct:  40 DFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTA 99

Query:  69 GQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDL 128
           ||||. .||||||| | | .||||| |  |.... .|.| .  .|  .  ..||||| | 
Sbjct: 100 GQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDC 159

Query: 129 RHLRAVPTDEARAFAEKNT-LSFIETSALDSTNVEEAFKNILTEIYR 174
              | .   .   ||.. | . | | || |. ||.| |  .. .| .
Sbjct: 160 ETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILK 206

>hg18||uc002jle
        |17|NM_175738|Q8IWA7|Q8IWA7_HUMAN|RAB37|NM_175738|NP_783865|RAB37,
        member RAS oncogene family isoform 3

          Length = 216

 Score =  147 bits (370), Expect = 1e-035
 Identities = 71/163 (43%), Positives = 108/163 (66%), Gaps = 1/163 (0%)

Query:  11 LFKVVLIGDSGVGKSNLLSRFTRNEFNLES-KSTIGVEFATRSIQVDGKTIKAQIWDTAG 69
           | | .|.|||||||..|| .| . .|   |  .|.|. |  . . |||  .| |||||||
Sbjct:  22 LHKTILVGDSGVGKTSLLVQFDQGKFIPGSFSATVGIGFTNKVVTVDGVRVKLQIWDTAG 81

Query:  70 QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLR 129
           |||.|..| |||| |   ||.|||    ...|.  || |. ..|  ..||||.|||.|. 
Sbjct:  82 QERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADMS 141

Query: 130 HLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
             | . ...    | .  . |.||||    ||| ||  |  |.
Sbjct: 142 SERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKEL 184

>hg18||uc002jld |17|AK127073|NA|NA|RAB37|NA|NA|Homo sapiens cDNA FLJ30284 fis,
        clone BRACE2002812, moderately similar to Mus musculus GTPase Rab37
        (Rab37) mRNA

          Length = 182

 Score =  145 bits (365), Expect = 4e-035
 Identities = 69/156 (44%), Positives = 105/156 (67%), Gaps = 1/156 (0%)

Query:  11 LFKVVLIGDSGVGKSNLLSRFTRNEFNLES-KSTIGVEFATRSIQVDGKTIKAQIWDTAG 69
           | | .|.|||||||..|| .| . .|   |  .|.|. |  . . |||  .| |||||||
Sbjct:  22 LHKTILVGDSGVGKTSLLVQFDQGKFIPGSFSATVGIGFTNKVVTVDGVRVKLQIWDTAG 81

Query:  70 QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLR 129
           |||.|..| |||| |   ||.|||    ...|.  || |. ..|  ..||||.|||.|. 
Sbjct:  82 QERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADMS 141

Query: 130 HLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAF 165
             | . ...    | .  . |.||||    ||| ||
Sbjct: 142 SERVIRSEDGETLAREYGVPFLETSAKTGMNVELAF 177

>hg18||uc002kog
        |18|NM_006868|Q13636|RAB31_HUMAN|RAB31|NM_006868|NP_006859|RAB31,
        member RAS oncogene family

          Length = 195

 Score =  145 bits (365), Expect = 4e-035
 Identities = 67/160 (41%), Positives = 105/160 (65%)

Query:  13 KVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQER 72
           || |.||.|||||... || .. |.     |||  | |...    .  |  |||||||||
Sbjct:   8 KVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQER 67

Query:  73 YRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLR 132
           . ..   ||||.  |..|||| |  ..  ...|.|||..|   |||. . ||| ||  .|
Sbjct:  68 FHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIR 127

Query: 133 AVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
            ||  .|. .||      .|||| .. |.|| |. |  .|
Sbjct: 128 EVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQI 167

>hg18||uc002xyz
        |20|NM_020673|Q9UL26|RB22A_HUMAN|RAB22A|NM_020673|NP_065724|RAS-related
        protein RAB-22A

          Length = 194

 Score =  144 bits (363), Expect = 7e-035
 Identities = 70/160 (43%), Positives = 101/160 (63%)

Query:  13 KVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQER 72
           || |.||.|||||... ||  . |.     |||  | |...|   .  |  |||||||||
Sbjct:   7 KVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQER 66

Query:  73 YRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLR 132
           .||.   ||||.  |..|||| |  |.  .. |.|||| |   |||. . ||| ||  .|
Sbjct:  67 FRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVR 126

Query: 133 AVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
            |   .|. .|.     |.|||| .. |. | |  |   |
Sbjct: 127 EVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRI 166

>hg18||uc002jlk
        |17|NM_001006638|Q96AX2|RAB37_HUMAN|RAB37|NM_001006638|NP_001006639|RAB
        37, member RAS oncogene family isoform 2

          Length = 223

 Score =  143 bits (358), Expect = 3e-034
 Identities = 70/166 (42%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query:   8 YDYLFKVVLIGDSGVGKSNLLSRFTRNEF-NLESKSTIGVEFATRSIQVDGKTIKAQIWD 66
           ||   ||.|.||.||||.  | .|    | .    .|.|..|  . . |||  .| ||||
Sbjct:  26 YDLTGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNKVVTVDGVRVKLQIWD 85

Query:  67 TAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKS 126
           ||||||.|..| |||| |   ||.|||    ...|.  || |. ..|  ..||||.|||.
Sbjct:  86 TAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKA 145

Query: 127 DLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
           |.   | . ...    | .  . |.||||    ||| ||  |  |.
Sbjct: 146 DMSSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKEL 191

>hg18||uc001swt
        |12|NM_014999|Q9UL25|RAB21_HUMAN|RAB21|NM_014999|NP_055814|RAB21,
        member RAS oncogene family

          Length = 225

 Score =  139 bits (349), Expect = 3e-033
 Identities = 80/213 (37%), Positives = 118/213 (55%), Gaps = 11/213 (5%)

Query:  10 YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69
           | |||||.|.  |||..|. |.  |.|| .  .|.   | |. . . || .   ||||||
Sbjct:  18 YSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAG 77

Query:  70 QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLR 129
           |||. |.   ||| . ||.|||||    ... |. |.||||    | | . .|||| || 
Sbjct:  78 QERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLE 137

Query: 130 HLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISDRSGHDE 189
             | |   || ..||        |||  .  .|| | ..     |..   |. .|.  . 
Sbjct: 138 KERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCK---RMIETAQVDERAKGNG 194

Query: 190 S--PG---NNVVDISLPPTTDSQRGGKLPCCQS 217
           |  ||     |  |   |   .  ||   || |
Sbjct: 195 SSQPGTARRGVQIIDDEPQAQTSGGG---CCSS 224

>hg18||uc002chr |16|NM_021168|Q96S21|RB40C_HUMAN|RAB40C|NM_021168|NP_066991|RAR
        (RAS like GTPASE) like

          Length = 281

 Score =  139 bits (348), Expect = 4e-033
 Identities = 72/175 (41%), Positives = 109/175 (62%), Gaps = 5/175 (2%)

Query:   2 GTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIK 61
           |.    |||| | .|.||| |||  .|              . |... | .| .||. ..
Sbjct:   5 GSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDGRRVR 64

Query:  62 AQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIML 121
            ..|||.|| |.  |  .| ||| | ||||||    ... ..||.||. .||   .  .|
Sbjct:  65 LELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAP-GVPRIL 123

Query: 122 VGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIV 176
           |||.  |   | |||..|||.|||| ..| | | | . || |.|    ||. |||
Sbjct: 124 VGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESF----TELSRIV 174

>hg18||uc002kft
        |17|NM_006822|Q12829|RB40B_HUMAN|RAB40B|NM_006822|NP_006813|RAB40B,
        member RAS oncogene family

          Length = 278

 Score =  136 bits (341), Expect = 3e-032
 Identities = 71/184 (38%), Positives = 113/184 (61%), Gaps = 5/184 (2%)

Query:   1 MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI 60
           .|.    ||.| | .|.||| |||  .|.               |... | .| .||. .
Sbjct:   4 LGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDGRRV 63

Query:  61 KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIM 120
           | |.|||.|| |.  |  .| ||| | .||||||   ... ..||.||. .||   .  .
Sbjct:  64 KLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAP-GVPKI 122

Query: 121 LVGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ 180
           ||||.  |   | |||..|.|.||.  ..| | | | . |. |.|    ||. |||  . 
Sbjct: 123 LVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESF----TELARIVLLRH 178

Query: 181 ISDR 184
             ||
Sbjct: 179 GMDR 182

>hg18||uc004cvm |X|NM_004251|P51151|RAB9_HUMAN|RAB9A|NM_004251|NP_004242|RAB9A,
        member RAS oncogene family

          Length = 201

 Score =  134 bits (337), Expect = 8e-032
 Identities = 72/182 (39%), Positives = 111/182 (60%), Gaps = 12/182 (6%)

Query:  11 LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQ 70
           ||||.|.|| |||||.|..|.  |.|. .   ||||||  . ..|||  .  ||||||||
Sbjct:   7 LFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQ 66

Query:  71 ERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHAD----NNIVIMLVGNKS 126
           ||.|.. . .|||.   || . .    ...|.  | ||   .||     .   ...||| 
Sbjct:  67 ERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKI 126

Query: 127 DLRHLRAVPTDEARAFAEKN-TLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISDRS 185
           |.   | | |.||.|.   |    . |||| |.|||  ||.  .  .          |||
Sbjct: 127 DISE-RQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVL------ATEDRS 179

Query: 186 GH 187
            |
Sbjct: 180 DH 181

>hg18||uc004ell
        |X|NM_016370|Q9NP90|RAB9B_HUMAN|RAB9B|NM_016370|NP_057454|RAB9-like
        protein

          Length = 201

 Score =  134 bits (337), Expect = 8e-032
 Identities = 69/173 (39%), Positives = 110/173 (63%), Gaps = 6/173 (3%)

Query:  11 LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQ 70
           | ||.|.|| |||||.|..|.  |.|. ..  ||||||  | ..|||. .  ||||||||
Sbjct:   7 LLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQ 66

Query:  71 ERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHAD----NNIVIMLVGNKS 126
           ||.... . .||||   || . .    ..||.  | ||   .||     .   ...||| 
Sbjct:  67 ERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKV 126

Query: 127 DLRHLRAVPTDEARAFA-EKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQ 178
           | .  | | |.||. .  |     ..|||| | |||  ||.  . ..  .  |
Sbjct: 127 D-KEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQ 178

>hg18||uc002ndm |19|AB209767|Q59EP4|Q59EP4_HUMAN|RAB8|NA|NA|Mel transforming
        oncogene variant (Fragment)

          Length = 157

 Score =  134 bits (336), Expect = 1e-031
 Identities = 59/104 (56%), Positives = 82/104 (78%)

Query:   8 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67
           ||||||..|||||||||. .| ||. . ||    ||||..|  |.|..||| || |||||
Sbjct:   5 YDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDT 64

Query:  68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRD 111
           |||||.| ||.||||||.| .|||||    ...|.  |.. . .
Sbjct:  65 AGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEE 108

>hg18||uc001oue |11|NM_002869|P20340-2|P20340-2|RAB6A|NM_002869|NP_002860|RAB6A,
        member RAS oncogene family isoform a

          Length = 208

 Score =  133 bits (334), Expect = 2e-031
 Identities = 62/177 (35%), Positives = 113/177 (63%), Gaps = 3/177 (1%)

Query:  12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE 71
           ||.| .|.  |||..|..||  . |.   ..|||..| .... .. .||. |.|||||||
Sbjct:  14 FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQE 73

Query:  72 RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHL 131
           |.|..  .| | .  |..||||    ...   .|. ..|    ....|||||||.||   
Sbjct:  74 RFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADK 133

Query: 132 RAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISDRSGHD 188
           | |  .|    |..  . ||||||    ||.. |. .      .   .   |||  |
Sbjct: 134 RQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAA---ALPGMESTQDRSRED 187

>hg18||uc001ouf
        |11|NM_198896|P20340|RAB6A_HUMAN|RAB6A|NM_198896|NP_942599|RAB6A,
        member RAS oncogene family isoform b

          Length = 208

 Score =  132 bits (330), Expect = 5e-031
 Identities = 61/177 (34%), Positives = 113/177 (63%), Gaps = 3/177 (1%)

Query:  12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE 71
           ||.| .|.  |||..|..||  . |.   ..|||..| .... .. .|.. |.|||||||
Sbjct:  14 FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query:  72 RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHL 131
           |.|..  .| | .  |..||||    ...   .|. ..|    ....|||||||.||   
Sbjct:  74 RFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADK 133

Query: 132 RAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISDRSGHD 188
           | |  .|    |..  . ||||||    ||.. |. .      .   .   |||  |
Sbjct: 134 RQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAA---ALPGMESTQDRSRED 187

>hg18||uc003epy |3|NM_016577|Q9NRW1|RAB6B_HUMAN|RAB6B|NM_016577|NP_057661|RAB6B,
        member RAS oncogene family

          Length = 208

 Score =  132 bits (330), Expect = 5e-031
 Identities = 56/161 (34%), Positives = 110/161 (68%)

Query:  12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE 71
           ||.| .|.  |||..|..||  . |.   ..|||..| .... .. .|.. |.|||||||
Sbjct:  14 FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query:  72 RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHL 131
           |.|..  .| | .  |..||||    ...   .|. ..|    ....|||||||.||   
Sbjct:  74 RFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADK 133

Query: 132 RAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
           | .  .|    |.. .. ||||||    ||.. |. . . .
Sbjct: 134 RQITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVASAL 174

>hg18||uc004ejs
        |X|NM_001031834|P0C0E4|RB40L_HUMAN|LOC286526|NM_001031834|NP_001027004|
        Ras-like GTPase-like

          Length = 278

 Score =  131 bits (329), Expect = 6e-031
 Identities = 68/175 (38%), Positives = 108/175 (61%), Gaps = 5/175 (2%)

Query:   2 GTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIK 61
           |. |  ||.| | .|.||  |||| .|                |... | .| .||. .|
Sbjct:   5 GSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGTAESPYSHLGGIDYKTTTILLDGQRVK 64

Query:  62 AQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIML 121
            ..|||.|| |.  |  .| ||| | .||||||   ..| ..||.|.. .||   .  .|
Sbjct:  65 LKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAP-GVPKIL 123

Query: 122 VGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIV 176
           |||.  |   | || ..|.|.||.  ..| | | | . |. |.|    ||. |||
Sbjct: 124 VGNRLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESF----TELARIV 174

>hg18||uc004ekk
        |X|NM_080879|Q8WXH6|RB40A_HUMAN|RAB40A|NM_080879|NP_543155|RAB40A,
        member RAS oncogene family

          Length = 277

 Score =  131 bits (329), Expect = 6e-031
 Identities = 68/175 (38%), Positives = 108/175 (61%), Gaps = 5/175 (2%)

Query:   2 GTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIK 61
           |. |  ||.| | .|.||  |||| .|                |... | .| .||. .|
Sbjct:   5 GSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDGQRVK 64

Query:  62 AQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIML 121
            ..|||.|| |.  |  .| ||| | .||||||   ..| ..||.|.. .||   .  .|
Sbjct:  65 LKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAP-GVPKIL 123

Query: 122 VGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIV 176
           |||.  |   | || ..|.|.||.  ..| | | | . |. |.|    ||. |||
Sbjct: 124 VGNRLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESF----TELARIV 174

>hg18||uc004amo |9|NM_152573|Q8IZ41|Q8IZ41_HUMAN|RASEF|NM_152573|NP_689786|RAS
        and EF hand domain containing

          Length = 740

 Score =  131 bits (328), Expect = 8e-031
 Identities = 67/167 (40%), Positives = 102/167 (61%), Gaps = 6/167 (3%)

Query:  12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE 71
           .|.|| ||. ||||. | |  .|||     .|.||.|  ... |||.    |.|||||||
Sbjct: 542 YKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIVDGERTVLQLWDTAGQE 601

Query:  72 RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHL 131
           |.|.|  .|.| | | ||.||.    .. |.  |.  . | |   . |||||||.|.|  
Sbjct: 602 RFRSIAKSYFRKADGVLLLYDVTCEKSFLNIREWVDMIEDAAHETVPIMLVGNKADIRDT 661

Query: 132 RAVPTDEA--RAFAEKNTLS----FIETSALDSTNVEEAFKNILTEI 172
            |    .     | ||  ..    | |||| | .|. ||  ..  |.
Sbjct: 662 AATEGQKCVPGHFGEKLAMTYGALFCETSAKDGSNIVEAVLHLAREV 708

>hg18||uc002vwz |2|NM_022449|Q9H0T7|RAB17_HUMAN|RAB17|NM_022449|NP_071894|RAB17,
        member RAS oncogene family

          Length = 212

 Score =  131 bits (327), Expect = 1e-030
 Identities = 66/163 (40%), Positives = 100/163 (61%), Gaps = 2/163 (1%)

Query:  11 LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQ 70
           .||.||.|   ||||.|  |. .|.|      |.|  | |. . |   ..| .|||||||
Sbjct:  19 VFKLVLLGSGSVGKSSLALRYVKNDFK-SILPTVGCAFFTKVVDVGATSLKLEIWDTAGQ 77

Query:  71 ERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHA-DNNIVIMLVGNKSDLR 129
           |.| ..   |.|||  ||||||| .  ..   ..|||.| .      ...||||||.|| 
Sbjct:  78 EKYHSVCHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTDLS 137

Query: 130 HLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEI 172
             | |   | . ||.   | |.||||  .  | | |  .  |.
Sbjct: 138 QEREVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQEL 180

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,827,316
Number of Sequences: 45480
Number of Extensions: 191827316
Number of Successful Extensions: 11130448
Number of sequences better than 0.0: 0
BLASTP 7.6.0