BLASTP 7.6.0


Query=fugu4_292735 |jgi|Takru4|292735|estExt_Genewise2.C_190332
        (155 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002pds |19|NM_015649|Q8IU81|Q8IU81_HUMAN|IRF2BP1|NM_0156...    117   5e-027
hg18||uc001xsy |14|NM_024496|Q9H1B7|CN004_HUMAN|C14orf4|NM_02449...    113   9e-026
hg18||uc001hwf |1|NM_001077397|Q5T8B5|Q5T8B5_HUMAN|IRF2BP2|NM_00...    104   4e-023
hg18||uc001hwg |1|NM_182972|Q5T8B6|Q5T8B6_HUMAN|IRF2BP2|NM_18297...    104   4e-023
hg18||uc002zdk |21|NM_015056|Q14684|K0179_HUMAN|RRP1B|NM_015056|...     44   5e-005
hg18||uc001ijb |10|NM_032905|Q96I25|SPF45_HUMAN|RBM17|NM_032905|...     32   0.268
hg18||uc001ezt |1|NM_001009931|Q86YZ3|HORN_HUMAN|HRNR|NM_0010099...     30   1.330
hg18||uc001ezt |1|NM_001009931|Q86YZ3|HORN_HUMAN|HRNR|NM_0010099...     29   2.268
hg18||uc001hsn |1|NM_052843|Q5VST9-3|Q5VST9-3|OBSCN|NM_052843|NP...     28   3.868
hg18||uc001spp |12|AK122827|Q99490|CENG1_HUMAN|CENTG1|NA|NA|Cent...     28   3.868
hg18||uc001spq |12|AY128689|Q99490|CENG1_HUMAN|CENTG1|NA|NA|Cent...     28   3.868
hg18||uc002soz |2|NM_006464|Q96QL2|Q96QL2_HUMAN|TGOLN2|NM_006464...     28   3.868
hg18||uc002spb |2|BX640868|Q6MZV1|Q6MZV1_HUMAN|TGOLN2|NM_006464|...     28   3.868
hg18||uc002spc |2|BC028219|Q8N6T8|Q8N6T8_HUMAN|TGOLN2|NM_006464|...     28   3.868
hg18||uc004fad |X|BC073747|P38159|HNRPG_HUMAN|RBMX|NM_002139|NP_...     27   6.599
hg18||uc004fae |X|NM_002139|P38159|HNRPG_HUMAN|RBMX|NM_002139|NP...     27   6.599

>hg18||uc002pds
        |19|NM_015649|Q8IU81|Q8IU81_HUMAN|IRF2BP1|NM_015649|NP_056464|interfero
        n regulatory factor 2 binding protein

          Length = 584

 Score =  117 bits (293), Expect = 5e-027
 Identities = 52/76 (68%), Positives = 63/76 (82%), Gaps = 2/76 (2%)

Query:  1 MSSPSSSRRQWCYLCDLPKMPWTVVWDFSEVVCRGCVNYEGSNQIEFLIASARQLKRTHG 60
          |.|  .|||||||||||||||| .|||||| |||||||.||...|| || .||||||.| 
Sbjct:  1 MASVQASRRQWCYLCDLPKMPWAMVWDFSEAVCRGCVNFEGADRIELLIDAARQLKRSHV 60

Query: 61 IQDGNVRSPGPSPNKH 76
          . .|  |||||   ||
Sbjct: 61 LPEG--RSPGPPALKH 74

>hg18||uc001xsy
        |14|NM_024496|Q9H1B7|CN004_HUMAN|C14orf4|NM_024496|NP_078772|chromosome
        14 open reading frame 4

          Length = 796

 Score =  113 bits (282), Expect = 9e-026
 Identities = 52/70 (74%), Positives = 60/70 (85%), Gaps = 3/70 (4%)

Query:  5 SSSRRQWCYLCDLPKMPWTVVWDFSEVVCRGCVNYEGSNQIEFLIASARQLKRTHG-IQD 63
          |||||| |||||||.||| ..||||| ||||||||||...|||.| .|||||| ||  ||
Sbjct:  7 SSSRRQSCYLCDLPRMPWAMIWDFSEPVCRGCVNYEGADRIEFVIETARQLKRAHGCFQD 66

Query: 64 GNVRSPGPSP 73
          |  ||||| |
Sbjct: 67 G--RSPGPPP 74

>hg18||uc001hwf
        |1|NM_001077397|Q5T8B5|Q5T8B5_HUMAN|IRF2BP2|NM_001077397|NP_001070865|i
        nterferon regulatory factor 2 binding protein 2

          Length = 571

 Score =  104 bits (259), Expect = 4e-023
 Identities = 58/153 (37%), Positives = 85/153 (55%), Gaps = 9/153 (5%)

Query:   5 SSSRRQWCYLCDLPKMPWTVVWDFSEVVCRGCVNYEGSNQIEFLIASARQLKRTHGIQDG 64
           ..|||| |||||||.||| ..|||.| ||||||||||....||.| .|||||| ||    
Sbjct:   9 AASRRQSCYLCDLPRMPWAMIWDFTEPVCRGCVNYEGADRVEFVIETARQLKRAHGCFPE 68

Query:  65 NVRSPGPSPNKHGSSGREPVAESTRSHPERFERGGRGESTGSVRVPP----NGLHRDGQT 120
               || . .   .. . |   .     .. .. | |    . | |       |    . 
Sbjct:  69 GRSPPGAAAS---AAAKPPPLSAKDILLQQQQQLGHGGPEAAPRAPQALERYPLAAAAER 125

Query: 121 PQEVNRQSPSGSRRPMLGAAIPPSLVTQSIAGI 153
           |  .   |  || ||    | ||.     . ||
Sbjct: 126 PPRLG--SDFGSSRPAASLAQPPTPQPPPVNGI 156

>hg18||uc001hwg
        |1|NM_182972|Q5T8B6|Q5T8B6_HUMAN|IRF2BP2|NM_182972|NP_892017|interferon
        regulatory factor 2 binding protein 2

          Length = 587

 Score =  104 bits (259), Expect = 4e-023
 Identities = 58/153 (37%), Positives = 85/153 (55%), Gaps = 9/153 (5%)

Query:   5 SSSRRQWCYLCDLPKMPWTVVWDFSEVVCRGCVNYEGSNQIEFLIASARQLKRTHGIQDG 64
           ..|||| |||||||.||| ..|||.| ||||||||||....||.| .|||||| ||    
Sbjct:   9 AASRRQSCYLCDLPRMPWAMIWDFTEPVCRGCVNYEGADRVEFVIETARQLKRAHGCFPE 68

Query:  65 NVRSPGPSPNKHGSSGREPVAESTRSHPERFERGGRGESTGSVRVPP----NGLHRDGQT 120
               || . .   .. . |   .     .. .. | |    . | |       |    . 
Sbjct:  69 GRSPPGAAAS---AAAKPPPLSAKDILLQQQQQLGHGGPEAAPRAPQALERYPLAAAAER 125

Query: 121 PQEVNRQSPSGSRRPMLGAAIPPSLVTQSIAGI 153
           |  .   |  || ||    | ||.     . ||
Sbjct: 126 PPRLG--SDFGSSRPAASLAQPPTPQPPPVNGI 156

>hg18||uc002zdk
        |21|NM_015056|Q14684|K0179_HUMAN|RRP1B|NM_015056|NP_055871|ribosomal
        RNA processing 1 homolog B

          Length = 758

 Score =  44 bits (103), Expect = 5e-005
 Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 11/120 (9%)

Query:  36 CVNYEGSNQIEFLIASARQLKRTHGIQDGNVRSPGPSPNKHGSSGREPVAESTRSHPERF 95
           ||  | |     |    |. |. | .|  |    | .|.   . |||| |   ..   | 
Sbjct: 386 CVEEEDSE--SSLQKRRRKKKKKHHLQPENPGPGGAAPSLEQNRGREPEASGLKALKARV 443

Query:  96 ERGG------RGESTGSVRVPPNGLHRDGQTPQEVNRQSPSGSRRPMLGAAIPPSLVTQS 149
              |       || .||   |   .|   . |.   ..||   |  .  | .||  ..||
Sbjct: 444 AEPGAEATSSTGEESGSEHPPAVPMHNKRKRPR---KKSPRAHREMLESAVLPPEDMSQS 500

>hg18||uc001ijb |10|NM_032905|Q96I25|SPF45_HUMAN|RBM17|NM_032905|NP_116294|RNA
        binding motif protein 17

          Length = 401

 Score =  32 bits (71), Expect = 0.268
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

Query:  53 RQLKRTHGIQDGNVRSPGPSPNKHGSSGREPVAESTRSHPERFERGGRGESTGSVRV-PP 111
           |.|.|   |..   |      ..| .||     .      | .||  |  | |   . ||
Sbjct: 123 RELERQKEIEEREKR----RKDRHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPP 178

Query: 112 NGL-HRDGQTPQEVNRQSPSGSRRPMLGAAIPP 143
             |  .| . |..   .  |  |     |||||
Sbjct: 179 TSLVEKDKELPRDFPYEEDSRPRSQSSKAAIPP 211

>hg18||uc001ezt
        |1|NM_001009931|Q86YZ3|HORN_HUMAN|HRNR|NM_001009931|NP_001009931|horner
        in

          Length = 2850

 Score =  30 bits (65), Expect = 1.330
 Identities = 20/72 (27%), Positives = 29/72 (40%), Gaps = 6/72 (8%)

Query:  62 QDGNVRSPGPSPNKHGSSGREPVAESTRSHPERFERGGRGESTGSVRVPPNGLHRDGQTP 121
           | |.      |  .|||| |.  .        |   |    |.|| . | .|    |   
Sbjct: 376 QHGSTSGQASSSGQHGSSSRQSSSYGQHESASRHSSGRGQHSSGSGQSPGHGQRGSG--- 432

Query: 122 QEVNRQSPSGSR 133
              . ||||  .
Sbjct: 433 ---SGQSPSSGQ 441

>hg18||uc001ezt
        |1|NM_001009931|Q86YZ3|HORN_HUMAN|HRNR|NM_001009931|NP_001009931|horner
        in

          Length = 2850

 Score =  29 bits (63), Expect = 2.268
 Identities = 20/73 (27%), Positives = 26/73 (35%)

Query:   62 QDGNVRSPGPSPNKHGSSGREPVAESTRSHPERFERGGRGESTGSVRVPPNGLHRDGQTP 121
            | |.         .|||| |            |   |   . .|| . |  | |  |   
Sbjct: 1665 QHGSRSGQSSRGERHGSSSRSSSRYGQHGSGSRQSSGHGRQGSGSGQSPSRGRHGSGLGH 1724

Query:  122 QEVNRQSPSGSRR 134
               . |  ||| |
Sbjct: 1725 SSSHGQHGSGSGR 1737

>hg18||uc001hsn
        |1|NM_052843|Q5VST9-3|Q5VST9-3|OBSCN|NM_052843|NP_443075|obscurin,
        cytoskeletal calmodulin and

          Length = 6620

 Score =  28 bits (61), Expect = 3.868
 Identities = 21/62 (33%), Positives = 26/62 (41%), Gaps = 5/62 (8%)

Query:  61 IQDGNVRSPGPSPNKHGSSGR-----EPVAESTRSHPERFERGGRGESTGSVRVPPNGLH 115
           ..||   ||||      |.||       ||       |   ||||     ||.     ||
Sbjct: 740 LKDGRTLSPGPKYEVQASAGRRVLLVRDVARDDAGLYECVSRGGRIAYQLSVQGLARFLH 799

Query: 116 RD 117
           .|
Sbjct: 800 KD 801

>hg18||uc001spp |12|AK122827|Q99490|CENG1_HUMAN|CENTG1|NA|NA|Centaurin-gamma 1
        (ARF-GAP with GTP-binding protein-like, ankyrin repeat and pleckstrin
        homology domains 2) (AGAP-2) (Phosphatidylinositol-3-kinase enhancer)
        (PIKE) (GTP-binding and GTPase-activating protein 2) (GGAP2)

          Length = 1191

 Score =  28 bits (61), Expect = 3.868
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 1/69 (1%)

Query:  72 SPNKHGSSGREPVAES-TRSHPERFERGGRGESTGSVRVPPNGLHRDGQTPQEVNRQSPS 130
           | .  |. | || | |   . | |      |       |||      | .|      .|.
Sbjct:  79 STSSAGTGGAEPPALSPAPASPARPVSPAPGRRLSLWAVPPGPPLSGGLSPDPKPGGAPT 138

Query: 131 GSRRPMLGA 139
            ||||.| .
Sbjct: 139 SSRRPLLSS 147

>hg18||uc001spq |12|AY128689|Q99490|CENG1_HUMAN|CENTG1|NA|NA|Centaurin-gamma 1
        (ARF-GAP with GTP-binding protein-like, ankyrin repeat and pleckstrin
        homology domains 2) (AGAP-2) (Phosphatidylinositol-3-kinase enhancer)
        (PIKE) (GTP-binding and GTPase-activating protein 2) (GGAP2)

          Length = 1192

 Score =  28 bits (61), Expect = 3.868
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 1/69 (1%)

Query:  72 SPNKHGSSGREPVAES-TRSHPERFERGGRGESTGSVRVPPNGLHRDGQTPQEVNRQSPS 130
           | .  |. | || | |   . | |      |       |||      | .|      .|.
Sbjct:  79 STSSAGTGGAEPPALSPAPASPARPVSPAPGRRLSLWAVPPGPPLSGGLSPDPKPGGAPT 138

Query: 131 GSRRPMLGA 139
            ||||.| .
Sbjct: 139 SSRRPLLSS 147

>hg18||uc002soz
        |2|NM_006464|Q96QL2|Q96QL2_HUMAN|TGOLN2|NM_006464|NP_006455|trans-golgi
        network protein 2

          Length = 437

 Score =  28 bits (61), Expect = 3.868
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 4/74 (5%)

Query:  66 VRSPGPSPNKHGSSGREPVAESTRSHPERFERGGRGESTGS----VRVPPNGLHRDGQTP 121
           ...|  |  | |.  . |     ||  |   .      .||     .  ||    |||||
Sbjct: 130 LQTPKDSTGKSGAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPNKSGADGQTP 189

Query: 122 QEVNRQSPSGSRRP 135
           .. . .| .  . |
Sbjct: 190 KDGSSKSGAEDQTP 203

>hg18||uc002spb
        |2|BX640868|Q6MZV1|Q6MZV1_HUMAN|TGOLN2|NM_006464|NP_006455|trans-golgi
        network protein 2

          Length = 379

 Score =  28 bits (61), Expect = 3.868
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 4/74 (5%)

Query:  66 VRSPGPSPNKHGSSGREPVAESTRSHPERFERGGRGESTGS----VRVPPNGLHRDGQTP 121
           ...|  |  | |.  . |     ||  |   .      .||     .  ||    |||||
Sbjct: 130 LQTPKDSTGKSGAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPNKSGADGQTP 189

Query: 122 QEVNRQSPSGSRRP 135
           .. . .| .  . |
Sbjct: 190 KDGSSKSGAEDQTP 203

>hg18||uc002spc
        |2|BC028219|Q8N6T8|Q8N6T8_HUMAN|TGOLN2|NM_006464|NP_006455|trans-golgi
        network protein 2

          Length = 447

 Score =  28 bits (61), Expect = 3.868
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 4/74 (5%)

Query:  66 VRSPGPSPNKHGSSGREPVAESTRSHPERFERGGRGESTGS----VRVPPNGLHRDGQTP 121
           ...|  |  | |.  . |     ||  |   .      .||     .  ||    |||||
Sbjct: 130 LQTPKDSTGKSGAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPNKSGADGQTP 189

Query: 122 QEVNRQSPSGSRRP 135
           .. . .| .  . |
Sbjct: 190 KDGSSKSGAEDQTP 203

>hg18||uc004fad |X|BC073747|P38159|HNRPG_HUMAN|RBMX|NM_002139|NP_002130|RNA
        binding motif protein, X-linked

          Length = 296

 Score =  27 bits (59), Expect = 6.599
 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 2/55 (3%)

Query:  79 SGREPVAESTRSH-PERFERGGRGESTGSVRVPPNGLHR-DGQTPQEVNRQSPSG 131
           |||       ||  | |  ||||| | |.   |  | |  ||      |  |  |
Sbjct:  91 SGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRG 145

>hg18||uc004fae |X|NM_002139|P38159|HNRPG_HUMAN|RBMX|NM_002139|NP_002130|RNA
        binding motif protein, X-linked

          Length = 391

 Score =  27 bits (59), Expect = 6.599
 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 2/55 (3%)

Query:  79 SGREPVAESTRSH-PERFERGGRGESTGSVRVPPNGLHR-DGQTPQEVNRQSPSG 131
           |||       ||  | |  ||||| | |.   |  | |  ||      |  |  |
Sbjct:  91 SGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRG 145

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0