BLASTP 7.6.0


Query=fugu4_290723 |jgi|Takru4|290723|estExt_Genewise2.C_11144
        (122 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001ztb |15|AK000438|Q9NX55|Q9NX55_HUMAN|SERF2|NA|NA|CDNA...    161   2e-040
hg18||uc001ztf |15|NM_016400|O75408|O75408_HUMAN|HYPK|NM_016400|...    161   2e-040
hg18||uc001ztg |15|AK022435|NA|NA|AK022435|NA|NA|Homo sapiens hu...     84   2e-017
hg18||uc001wuw |14|NM_002687|Q9H307|PININ_HUMAN|PNN|NM_002687|NP...     26   5.837
hg18||uc002iih |17|NM_144608|Q96MH2|Q96MH2_HUMAN|HEXIM2|NM_14460...     26   5.837
hg18||uc002iii |17|BC025970|Q96MH2|Q96MH2_HUMAN|HEXIM2|NM_144608...     26   5.837
hg18||uc002iij |17|BC003531|Q96MH2|Q96MH2_HUMAN|HEXIM2|NM_144608...     26   5.837
hg18||uc002uzz |2|NM_005759|Q9NYB9-2|Q9NYB9-2|ABI2|NM_005759|NP_...     26   7.623
hg18||uc002vaa |2|AF260261|Q9NYB9|ABI2_HUMAN|ABI2|NM_005759|NP_0...     26   7.623

>hg18||uc001ztb |15|AK000438|Q9NX55|Q9NX55_HUMAN|SERF2|NA|NA|CDNA FLJ20431 fis,
        clone KAT03722

          Length = 175

 Score =  161 bits (406), Expect = 2e-040
 Identities = 85/121 (70%), Positives = 93/121 (76%)

Query:   1 MAAEGDVDLDLEAEENCTGKPAEKPRKHDSGAADLERVTDYAEEKEISSSDLETAMSVIG 60
           || ||||.|.|| | .   .| ||||||||||||||||||||||||| ||.|||||||||
Sbjct:  55 MATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIG 114

Query:  61 DXXXXXXXXXXXXXXXXXXVTIKKEDVELIMSEMEISRAVAERSLREHMGNVVEALVTLT 120
           |                  |||||||.||||.||||||| ||||||||||||||||. ||
Sbjct: 115 DRRSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALT 174

Query: 121 N 121
           |
Sbjct: 175 N 175

>hg18||uc001ztf
        |15|NM_016400|O75408|O75408_HUMAN|HYPK|NM_016400|NP_057484|Huntingtin
        interacting protein K

          Length = 129

 Score =  161 bits (406), Expect = 2e-040
 Identities = 85/121 (70%), Positives = 93/121 (76%)

Query:   1 MAAEGDVDLDLEAEENCTGKPAEKPRKHDSGAADLERVTDYAEEKEISSSDLETAMSVIG 60
           || ||||.|.|| | .   .| ||||||||||||||||||||||||| ||.|||||||||
Sbjct:   9 MATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIG 68

Query:  61 DXXXXXXXXXXXXXXXXXXVTIKKEDVELIMSEMEISRAVAERSLREHMGNVVEALVTLT 120
           |                  |||||||.||||.||||||| ||||||||||||||||. ||
Sbjct:  69 DRRSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALT 128

Query: 121 N 121
           |
Sbjct: 129 N 129

>hg18||uc001ztg |15|AK022435|NA|NA|AK022435|NA|NA|Homo sapiens huntingtin
        interacting protein HYPK mRNA, partial cds

          Length = 74

 Score =  84 bits (206), Expect = 2e-017
 Identities = 41/54 (75%), Positives = 46/54 (85%)

Query:  1 MAAEGDVDLDLEAEENCTGKPAEKPRKHDSGAADLERVTDYAEEKEISSSDLET 54
          || ||||.|.|| | .   .| ||||||||||||||||||||||||| ||.|||
Sbjct:  1 MATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLET 54

>hg18||uc001wuw |14|NM_002687|Q9H307|PININ_HUMAN|PNN|NM_002687|NP_002678|pinin,
        desmosome associated protein

          Length = 717

 Score =  26 bits (56), Expect = 5.837
 Identities = 12/43 (27%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query:   4 EGDVDLDLEAEENCTGKPAEKPRKHDSGAADLERVTDYAEEKE 46
           | ... ..| .. |    .  | | .  | |.|. ..  ||||
Sbjct: 426 EPEMEFEIEPDKEC---KSLSPGKENVSALDMEKESEEKEEKE 465

>hg18||uc002iih
        |17|NM_144608|Q96MH2|Q96MH2_HUMAN|HEXIM2|NM_144608|NP_653209|hexamthyle
        ne bis-acetamide inducible 2

          Length = 286

 Score =  26 bits (56), Expect = 5.837
 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query:  3 AEGDVDLDLEAEENCTGKPAEKPRKHDSGAA--DLERVTDYAEEKEISSS 50
          ||  | |.        | |   | .|||| .     |.  ..|..... .
Sbjct: 12 AESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGA 61

>hg18||uc002iii
        |17|BC025970|Q96MH2|Q96MH2_HUMAN|HEXIM2|NM_144608|NP_653209|hexamthylen
        e bis-acetamide inducible 2

          Length = 286

 Score =  26 bits (56), Expect = 5.837
 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query:  3 AEGDVDLDLEAEENCTGKPAEKPRKHDSGAA--DLERVTDYAEEKEISSS 50
          ||  | |.        | |   | .|||| .     |.  ..|..... .
Sbjct: 12 AESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGA 61

>hg18||uc002iij
        |17|BC003531|Q96MH2|Q96MH2_HUMAN|HEXIM2|NM_144608|NP_653209|hexamthylen
        e bis-acetamide inducible 2

          Length = 286

 Score =  26 bits (56), Expect = 5.837
 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query:  3 AEGDVDLDLEAEENCTGKPAEKPRKHDSGAA--DLERVTDYAEEKEISSS 50
          ||  | |.        | |   | .|||| .     |.  ..|..... .
Sbjct: 12 AESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGA 61

>hg18||uc002uzz |2|NM_005759|Q9NYB9-2|Q9NYB9-2|ABI2|NM_005759|NP_005750|abl
        interactor 2

          Length = 475

 Score =  26 bits (55), Expect = 7.623
 Identities = 11/23 (47%), Positives = 15/23 (65%)

Query: 34 DLERVTDYAEEKEISSSDLETAM 56
          .|||| || |   | |.| . |.
Sbjct: 25 NLERVADYCENNYIQSADKQRAL 47

>hg18||uc002vaa |2|AF260261|Q9NYB9|ABI2_HUMAN|ABI2|NM_005759|NP_005750|abl
        interactor 2

          Length = 513

 Score =  26 bits (55), Expect = 7.623
 Identities = 11/23 (47%), Positives = 15/23 (65%)

Query: 34 DLERVTDYAEEKEISSSDLETAM 56
          .|||| || |   | |.| . |.
Sbjct: 25 NLERVADYCENNYIQSADKQRAL 47

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 65,424,984
Number of Sequences: 45480
Number of Extensions: 65424984
Number of Successful Extensions: 5071428
Number of sequences better than 0.0: 0
BLASTP 7.6.0