BLASTP 7.6.0


Query=fugu4_197839 |jgi|Takru4|197839|gw2.538.27.1
        (61 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003cxm |3|NM_153273|Q92551|IP6K1_HUMAN|IHPK1|NM_153273|N...    111   2e-025
hg18||uc003cxo |3|CR609527|NA|NA|IHPK1|NA|NA|Homo sapiens inosit...    111   2e-025
hg18||uc003ofb |6|NM_054111|Q5TAQ4|Q5TAQ4_HUMAN|IHPK3|NM_054111|...     96   9e-021
hg18||uc003cur |3|NM_001005911|Q9UHH9-2|Q9UHH9-2|IHPK2|NM_001005...     92   1e-019
hg18||uc003cus |3|NM_001005910|Q9UHH9-2|Q9UHH9-2|IHPK2|NM_001005...     92   1e-019
hg18||uc003cuu |3|BX537544|NA|NA|DKFZp564L0678|NA|NA|Homo sapien...     91   3e-019
hg18||uc003cup |3|NM_001005909|Q9UHH9|IP6K2_HUMAN|IHPK2|NM_00100...     89   1e-018
hg18||uc003cuq |3|NM_016291|Q9UHH9|IP6K2_HUMAN|IHPK2|NM_016291|N...     89   1e-018

>hg18||uc003cxm
        |3|NM_153273|Q92551|IP6K1_HUMAN|IHPK1|NM_153273|NP_695005|inositol
        hexaphosphate kinase 1 isoform 1

          Length = 441

 Score =  111 bits (276), Expect = 2e-025
 Identities = 53/58 (91%), Positives = 54/58 (93%), Gaps = 2/58 (3%)

Query:  4 RAG--GVPLEPFIHQVGGHTSMMRYDDHTVCKPLIIREQRFYESLPPEMKEFTPEYKG 59
          |||  || |||||||||||.||||||||||||||| ||||||||||||||||||||||
Sbjct: 18 RAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYESLPPEMKEFTPEYKG 75

>hg18||uc003cxo |3|CR609527|NA|NA|IHPK1|NA|NA|Homo sapiens inositol
        hexaphosphate kinase 1, mRNA (cDNA clone MGC:9925 IMAGE:3872311),
        complete cds

          Length = 274

 Score =  111 bits (276), Expect = 2e-025
 Identities = 53/58 (91%), Positives = 54/58 (93%), Gaps = 2/58 (3%)

Query:  4 RAG--GVPLEPFIHQVGGHTSMMRYDDHTVCKPLIIREQRFYESLPPEMKEFTPEYKG 59
          |||  || |||||||||||.||||||||||||||| ||||||||||||||||||||||
Sbjct: 18 RAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYESLPPEMKEFTPEYKG 75

>hg18||uc003ofb
        |6|NM_054111|Q5TAQ4|Q5TAQ4_HUMAN|IHPK3|NM_054111|NP_473452|inositol
        hexaphosphate kinase 3

          Length = 410

 Score =  96 bits (236), Expect = 9e-021
 Identities = 41/53 (77%), Positives = 47/53 (88%)

Query:  7 GVPLEPFIHQVGGHTSMMRYDDHTVCKPLIIREQRFYESLPPEMKEFTPEYKG 59
          || ||||.|||||| |.|.||.|||||||. ||||||||||  || |||.|||
Sbjct: 15 GVQLEPFLHQVGGHMSVMKYDEHTVCKPLVSREQRFYESLPLAMKRFTPQYKG 67

>hg18||uc003cur
        |3|NM_001005911|Q9UHH9-2|Q9UHH9-2|IHPK2|NM_001005911|NP_001005911|inosi
        tol hexaphosphate kinase 2 isoform b

          Length = 97

 Score =  92 bits (227), Expect = 1e-019
 Identities = 38/61 (62%), Positives = 53/61 (86%)

Query:  1 LRPRAGGVPLEPFIHQVGGHTSMMRYDDHTVCKPLIIREQRFYESLPPEMKEFTPEYKGQ 60
          . ||| || ||||.||||||. ..|... |.||||. || .|||.|| ||..|||.||||
Sbjct: 10 VEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGQ 69

Query: 61 S 61
          |
Sbjct: 70 S 70

>hg18||uc003cus
        |3|NM_001005910|Q9UHH9-2|Q9UHH9-2|IHPK2|NM_001005910|NP_001005910|inosi
        tol hexaphosphate kinase 2 isoform b

          Length = 97

 Score =  92 bits (227), Expect = 1e-019
 Identities = 38/61 (62%), Positives = 53/61 (86%)

Query:  1 LRPRAGGVPLEPFIHQVGGHTSMMRYDDHTVCKPLIIREQRFYESLPPEMKEFTPEYKGQ 60
          . ||| || ||||.||||||. ..|... |.||||. || .|||.|| ||..|||.||||
Sbjct: 10 VEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGQ 69

Query: 61 S 61
          |
Sbjct: 70 S 70

>hg18||uc003cuu |3|BX537544|NA|NA|DKFZp564L0678|NA|NA|Homo sapiens cDNA FLJ13983
        fis, clone Y79AA1001827, highly similar to Homo sapiens mammalian
        inositol hexakisphosphate kinase 2 (IP6K2) mRNA

          Length = 185

 Score =  91 bits (223), Expect = 3e-019
 Identities = 37/61 (60%), Positives = 53/61 (86%)

Query:   1 LRPRAGGVPLEPFIHQVGGHTSMMRYDDHTVCKPLIIREQRFYESLPPEMKEFTPEYKGQ 60
           . ||| || ||||.||||||. ..|... |.||||. || .|||.|| ||..|||.|||.
Sbjct:  65 VEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGK 124

Query:  61 S 61
           |
Sbjct: 125 S 125

>hg18||uc003cup
        |3|NM_001005909|Q9UHH9|IP6K2_HUMAN|IHPK2|NM_001005909|NP_001005909|inos
        itol hexaphosphate kinase 2 isoform a

          Length = 426

 Score =  89 bits (218), Expect = 1e-018
 Identities = 36/59 (61%), Positives = 51/59 (86%)

Query:  1 LRPRAGGVPLEPFIHQVGGHTSMMRYDDHTVCKPLIIREQRFYESLPPEMKEFTPEYKG 59
          . ||| || ||||.||||||. ..|... |.||||. || .|||.|| ||..|||.|||
Sbjct: 10 VEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKG 68

>hg18||uc003cuq
        |3|NM_016291|Q9UHH9|IP6K2_HUMAN|IHPK2|NM_016291|NP_057375|inositol
        hexaphosphate kinase 2 isoform a

          Length = 426

 Score =  89 bits (218), Expect = 1e-018
 Identities = 36/59 (61%), Positives = 51/59 (86%)

Query:  1 LRPRAGGVPLEPFIHQVGGHTSMMRYDDHTVCKPLIIREQRFYESLPPEMKEFTPEYKG 59
          . ||| || ||||.||||||. ..|... |.||||. || .|||.|| ||..|||.|||
Sbjct: 10 VEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKG 68

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,654,518
Number of Sequences: 45480
Number of Extensions: 191654518
Number of Successful Extensions: 10949811
Number of sequences better than 0.0: 0
BLASTP 7.6.0