BLASTP 7.6.0


Query=fugu4_197684 |jgi|Takru4|197684|gw2.4468.4.1
        (70 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003mwp |6|NM_020408|Q9HD34|LYRM4_HUMAN|LYRM4|NM_020408|N...     58   2e-009

>hg18||uc003mwp |6|NM_020408|Q9HD34|LYRM4_HUMAN|LYRM4|NM_020408|NP_065141|LYR
        motif containing 4

          Length = 91

 Score =  58 bits (138), Expect = 2e-009
 Identities = 26/70 (37%), Positives = 44/70 (62%)

Query:  1 MSAPARSQVISLYKLLLTESKKFPSXXXXXXXXXXXXDAFRANRTIGDPTTVERLITEGQ 60
          |.| .|.||.|||. .| |||.| .            |||| |. . ||  .. |. . .
Sbjct:  1 MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAK 60

Query: 61 QTLALIQRQV 70
          . | .|.|||
Sbjct: 61 RDLGVIRRQV 70

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 190,549,688
Number of Sequences: 45480
Number of Extensions: 190549688
Number of Successful Extensions: 11294661
Number of sequences better than 0.0: 0
BLASTP 7.6.0