BLASTP 7.6.0


Query=fugu4_193049 |jgi|Takru4|193049|gw2.27.444.1
        (398 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003hou |4|NM_139076|Q6UWZ7|Q6UWZ7_HUMAN|CCDC98|NM_139076...    143   7e-034
hg18||uc003hov |4|AK023676|Q9H8I1|Q9H8I1_HUMAN|CCDC98|NA|NA|CDNA...     94   3e-019
hg18||uc003hot |4|AK021582|Q9H8I1|Q9H8I1_HUMAN|CCDC98|NM_139076|...     50   3e-006
hg18||uc003zyr |9|NM_001039792|Q6UXD1|Q6UXD1_HUMAN|LOC646962|NM_...     30   6.297

>hg18||uc003hou
        |4|NM_139076|Q6UWZ7|Q6UWZ7_HUMAN|CCDC98|NM_139076|NP_620775|coiled-coil
        domain containing 98

          Length = 409

 Score =  143 bits (358), Expect = 7e-034
 Identities = 68/169 (40%), Positives = 111/169 (65%), Gaps = 1/169 (0%)

Query:  74 DVQKHLPCHELNNFYNAVSDVNMDVIMKLLADNKQESIIGWYRQRRNTEQQMTFREKLVH 133
           |.||..||..| .|||.  .||   . |.|. | .....|||. ||...| |||||.|.|
Sbjct:  60 DIQKYIPCYQLFSFYNSSGEVNEQALKKILS-NVKKNVVGWYKFRRHSDQIMTFRERLLH 118

Query: 134 EKLKSALSNPHLIFLLLTPSSVSPTGSTHRMEYAAFISRSRRFTXXXXXXXXXXXXEQLS 193
           . |.   ||  |.||||||| .. . ||||.|.. .  .   |             ||| 
Sbjct: 119 KNLQEHFSNQDLVFLLLTPSIITESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLG 178

Query: 194 YWKVSAPCSAAGYNLTMKKHGPKFFCSNGLLKEVSEVNKMNDSLQSELQ 242
           |  ||  | . |..  .. |  |||  .| |||| ..|.|  ||| ||.
Sbjct: 179 YKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLKEVHKINEMYASLQEELK 227

>hg18||uc003hov |4|AK023676|Q9H8I1|Q9H8I1_HUMAN|CCDC98|NA|NA|CDNA FLJ13614 fis,
        clone PLACE1010857 (CCDC98 protein)

          Length = 300

 Score =  94 bits (232), Expect = 3e-019
 Identities = 48/118 (40%), Positives = 71/118 (60%)

Query: 125 MTFREKLVHEKLKSALSNPHLIFLLLTPSSVSPTGSTHRMEYAAFISRSRRFTXXXXXXX 184
           |||||.|.|. |.   ||  |.||||||| .. . ||||.|.. .  .   |        
Sbjct:   1 MTFRERLLHKNLQEHFSNQDLVFLLLTPSIITESCSTHRLEHSLYKPQKGLFHRVPLVVA 60

Query: 185 XXXXXEQLSYWKVSAPCSAAGYNLTMKKHGPKFFCSNGLLKEVSEVNKMNDSLQSELQ 242
                ||| |  ||  | . |..  .. |  |||  .| |||| ..|.|  ||| ||.
Sbjct:  61 NLGMSEQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLKEVHKINEMYASLQEELK 118

>hg18||uc003hot
        |4|AK021582|Q9H8I1|Q9H8I1_HUMAN|CCDC98|NM_139076|NP_620775|coiled-coil
        domain containing 98

          Length = 237

 Score =  50 bits (119), Expect = 3e-006
 Identities = 24/53 (45%), Positives = 34/53 (64%)

Query: 190 EQLSYWKVSAPCSAAGYNLTMKKHGPKFFCSNGLLKEVSEVNKMNDSLQSELQ 242
           ||| |  ||  | . |..  .. |  |||  .| |||| ..|.|  ||| ||.
Sbjct:   3 EQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLKEVHKINEMYASLQEELK 55

>hg18||uc003zyr
        |9|NM_001039792|Q6UXD1|Q6UXD1_HUMAN|LOC646962|NM_001039792|NP_001034881
        |hypothetical protein LOC646962

          Length = 115

 Score =  30 bits (65), Expect = 6.297
 Identities = 14/30 (46%), Gaps = 6/30 (20%)

Query:  29 HEHPRMEDPDSHTPHVLHHHCQLRRPQXGH 58
           | |||      |||| ||||    |    |
Sbjct:  90 HHHPR------HTPHHLHHHHHPHRHHPRH 113

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,333,540
Number of Sequences: 45480
Number of Extensions: 194333540
Number of Successful Extensions: 10864763
Number of sequences better than 0.0: 0
BLASTP 7.6.0