BLASTP 7.6.0


Query=fugu4_192942 |jgi|Takru4|192942|gw2.177.79.1
        (491 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003biy |22|NM_024105|Q9BV10|ALG12_HUMAN|ALG12|NM_024105|...    517   2e-146
hg18||uc001phi |11|NM_002421|P03956|MMP1_HUMAN|MMP1|NM_002421|NP...     31   2.824

>hg18||uc003biy
        |22|NM_024105|Q9BV10|ALG12_HUMAN|ALG12|NM_024105|NP_077010|asparagine-l
        inked glycosylation 12

          Length = 488

 Score =  517 bits (1329), Expect = 2e-146
 Identities = 254/466 (54%), Positives = 320/466 (68%), Gaps = 9/466 (1%)

Query:  26 ICPFSKVEESFNLQATHDILYHRVNFDKYDHHDFPGVVPRSFLGXXXXXXXXXXXXXXXX 85
           |||..|||||||||||||.|||  . ..||| .|||||||.|||                
Sbjct:  27 ICPYTKVEESFNLQATHDLLYHWQDLEQYDHLEFPGVVPRTFLGPVVIAVFSSPAVYVLS 86

Query:  86 XXDAPKFYTQLTVRASLGLCVVGALWHMHGEARRQFGSTVAALFCLICASQFHLMFYSTR 145
             .  |||.|| ||  ||| |.  || .  | || ||. || .|| . | ||||||| ||
Sbjct:  87 LLEMSKFYSQLIVRGVLGLGVIFGLWTLQKEVRRHFGAMVATMFCWVTAMQFHLMFYCTR 146

Query: 146 TLPNVFALPIVLFAFTSWMAQKYGRFIGLSALVIIVFRSEXXXXXXXXXXXXXXXXXXXV 205
           ||||| |||.|| |  .|.  .. ||| |||  ||||| |                   |
Sbjct: 147 TLPNVLALPVVLLALAAWLRHEWARFIWLSAFAIIVFRVELCLFLGLLLLLALGNRKVSV 206

Query: 206 GQLLYYALPAGIASLALTVSIDTFFWRRLLWPEGQVLWYNTILNKSSNWGISFPYSTXTS 265
            . | .|.||||  | |||..|..|||.| ||||.||||||.||||||||        ||
Sbjct: 207 VRALRHAVPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWG--------TS 258

Query: 266 PFLWYFYSAVPRALGCTLLFVPVGLLDRRMSPLLLPTAGFILLYSLLPHKEMRFIIYTFP 325
           | |||||||.|| |||.|||.|.||.|||     .   ||. |||||||||.||||| ||
Sbjct: 259 PLLWYFYSALPRGLGCSLLFIPLGLVDRRTHAPTVLALGFMALYSLLPHKELRFIIYAFP 318

Query: 326 VLSLVAARGCSFILCNYQKSLIYKLGSAVVVGQLLANAAYSGVCLYVSHYNYPGGRGLQE 385
           .|.. ||||||..| ||.|| .|| || .|.| |. |||||   |||||.|||||  .| 
Sbjct: 319 MLNITAARGCSYLLNNYKKSWLYKAGSLLVIGHLVVNAAYSATALYVSHFNYPGGVAMQR 378

Query: 386 LHRLLPATADVFVHIDTYAAETGVSRFLEQNKNWRYDKREDLSPESPEMDAYSHLLMEAN 445
           ||.|.|   || .|||  ||.|||||||. |  ||||||||. |    | ||.|.|||| 
Sbjct: 379 LHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQP-GTGMLAYTHILMEAA 437

Query: 446 VTKIKLLRDTHQPLAFVEGYSNIAFNPLHFPPLSVRLERKTVLMER 491
              . | ||||. || | | . .. |    || .| |. | ||.||
Sbjct: 438 PGLLALYRDTHRVLASVVGTTGVSLNLTQLPPFNVHLQTKLVLLER 483

>hg18||uc001phi |11|NM_002421|P03956|MMP1_HUMAN|MMP1|NM_002421|NP_002412|matrix
        metalloproteinase 1 preproprotein

          Length = 469

 Score =  31 bits (69), Expect = 2.824
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 399 HIDTYAAE--TGVSRFLEQNKNWRYDK-REDLSPESPEMDAY 437
           |||   .|  || . |   || ||||. .  . |  |.| |.
Sbjct: 376 HIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAH 417

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,969,116
Number of Sequences: 45480
Number of Extensions: 193969116
Number of Successful Extensions: 11336309
Number of sequences better than 0.0: 0
BLASTP 7.6.0