BLASTP 7.6.0


Query=fugu4_192354 |jgi|Takru4|192354|gw2.114.183.1
        (504 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003wzm |8|NM_003053|P54219|VMAT1_HUMAN|SLC18A1|NM_003053...    609   3e-174
hg18||uc001ldd |10|NM_003054|Q05940|VMAT2_HUMAN|SLC18A2|NM_00305...    541   1e-153
hg18||uc003wzl |8|CR604993|NA|NA|SLC18A1|NM_003053|NP_003044|sol...    430   3e-120
hg18||uc003wzn |8|BC006317|Q9BRE4|Q9BRE4_HUMAN|SLC18A1|NM_003053...    309   7e-084
hg18||uc003wzo |8|CR593627|Q9BRE4|Q9BRE4_HUMAN|SLC18A1|NM_003053...    309   7e-084
hg18||uc001jhw |10|NM_003055|Q16572|VACHT_HUMAN|SLC18A3|NM_00305...    290   3e-078
hg18||uc003wzn |8|BC006317|Q9BRE4|Q9BRE4_HUMAN|SLC18A1|NM_003053...    249   9e-066
hg18||uc003wzo |8|CR593627|Q9BRE4|Q9BRE4_HUMAN|SLC18A1|NM_003053...    249   9e-066
hg18||uc003qdw |6|NM_052831|Q6NT16|Q6NT16_HUMAN|C6orf192|NM_0528...     57   5e-008

>hg18||uc003wzm
        |8|NM_003053|P54219|VMAT1_HUMAN|SLC18A1|NM_003053|NP_003044|solute
        carrier family 18 (vesicular monoamine),

          Length = 525

 Score =  609 bits (1570), Expect = 3e-174
 Identities = 318/498 (63%), Positives = 372/498 (74%), Gaps = 18/498 (3%)

Query:  18 DNMLLTVVVPIIPTFLYTID--HPSPKAQNVHPTPTPRDIYTGPWSEETPHLVSLFDNTT 75
           |||| ||||||.||||| ..    .      |   .|  . .  .|     . | |.| |
Sbjct:  34 DNMLFTVVVPIVPTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFST----IFSFFNNNT 89

Query:  76 FSVE-------SWME--ASPYPKPAAWTGLPTDPNSSCLQDSLFLEEENVRVGFLFASKA 126
            .||       .||   ||  | ||  |   .   ..||| . |||||  ||| ||||||
Sbjct:  90 VAVEESVPSGIAWMNDTASTIPPPA--TEAISAHKNNCLQGTGFLEEEITRVGVLFASKA 147

Query: 127 LVQLLVNPFVGPLTNRVGYHIPMFAGFIIMFVSTIMFAFSGTYVLLFFARSLQGIGSSFS 186
           ..||||||||||||||.||||||||||.|||.||.|||||||| ||| ||.|||||||||
Sbjct: 148 VMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFS 207

Query: 187 SVAGLGMLASVYTDDEERXXXXXXXXXXXXXXXXXXXPFGSVMYEFVGKSTPFLILAFLA 246
           ||||||||||||||| ||                   ||||||||||||| |||||||||
Sbjct: 208 SVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLA 267

Query: 247 VFDGALQMCILQPSKISPGSVEGTPLLTLLKDPYILISAGCLCFANMGVAILEPTLPIWM 306
           . |||||.|||||||.|| | .||||  ||||||||..|| .||||||||||||||||||
Sbjct: 268 LLDGALQLCILQPSKVSPESAKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWM 327

Query: 307 MQTMCSSKWQLGMAFLPASVSYLIGTNLFGLLANKMGRWLCSMLGMFIVGISLLCVPFAT 366
           |||||| |||||.|||||||||||||||||.|||||||||||..|| .|| |||||| | 
Sbjct: 328 MQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLANKMGRWLCSLIGMLVVGTSLLCVPLAH 387

Query: 367 SIYXXXXXXXXXXXXXXMVDSSMMAIMGYLVDIRHASVYGSIYAIADVALCMGFAIGPST 426
           .|.              ||||||| |||.|||.|| |||||.||||||| ||||||||||
Sbjct: 388 NIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPST 447

Query: 427 GGALVQVVGFPSLMVFIGVINILYAPLCVLLRSPAVREEKMAIISQECVMHQKKNYNTQK 486
           |||.|. .||| |||  |||||.|||||  ||||  .|||.||.||.| | . . | |||
Sbjct: 448 GGAIVKAIGFPWLMVITGVINIVYAPLCYYLRSPPAKEEKLAILSQDCPM-ETRMYATQK 506

Query: 487 ENREFPLSDYSEEDETEE 504
             .|||| . |.|.   |
Sbjct: 507 PTKEFPLGEDSDEEPDHE 524

>hg18||uc001ldd
        |10|NM_003054|Q05940|VMAT2_HUMAN|SLC18A2|NM_003054|NP_003045|solute
        carrier family 18 (vesicular monoamine),

          Length = 514

 Score =  541 bits (1392), Expect = 1e-153
 Identities = 279/486 (57%), Positives = 342/486 (70%), Gaps = 9/486 (1%)

Query:  18 DNMLLTVVVPIIPTFLYTIDHPSPKAQNVHPTPTPRDIYTGPWSEETPHLVSLFDNTTFS 77
           |||||||||||||..||.| |     .|     | | ..|   |.    . | .||.|  
Sbjct:  33 DNMLLTVVVPIIPSYLYSIKH----EKNATEIQTARPVHTASISDSFQSIFSYYDNSTMV 88

Query:  78 VESWMEASPYPKPAAW---TGLPTDPNSSCLQDSLFLEEENVRVGFLFASKALVQLLVNP 134
             .        . |     |     | | |  .   |  |||.|| |||||| |||. ||
Sbjct:  89 TGNATRDLTLHQTATQHMVTNASAVP-SDCPSEDKDLLNENVQVGLLFASKATVQLITNP 147

Query: 135 FVGPLTNRVGYHIPMFAGFIIMFVSTIMFAFSGTYVLLFFARSLQGIGSSFSSVAGLGML 194
           |.| ||||.|| ||.|||| |||||||||||| .|  |  |||||||||| |||||.|||
Sbjct: 148 FIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGML 207

Query: 195 ASVYTDDEERXXXXXXXXXXXXXXXXXXXPFGSVMYEFVGKSTPFLILAFLAVFDGALQM 254
           ||||||||||                   |||||.||||||. |||.|| | . |||.|.
Sbjct: 208 ASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQL 267

Query: 255 CILQPSKISPGSVEGTPLLTLLKDPYILISAGCLCFANMGVAILEPTLPIWMMQTMCSSK 314
            .||||.. | | .|||| ||||||||||.|| .||||||.|.||| ||||||.|||| |
Sbjct: 268 FVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRK 327

Query: 315 WQLGMAFLPASVSYLIGTNLFGLLANKMGRWLCSMLGMFIVGISLLCVPFATSIYXXXXX 374
           ||||.||||||.|||||||.||.||.|||||||..||| |||.|.||.||| .||     
Sbjct: 328 WQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAP 387

Query: 375 XXXXXXXXXMVDSSMMAIMGYLVDIRHASVYGSIYAIADVALCMGFAIGPSTGGALVQVV 434
                    ||||||| |||||||.|| |||||.||||||| |||.||||| |||. . .
Sbjct: 388 NFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAI 447

Query: 435 GFPSLMVFIGVINILYAPLCVLLRSPAVREEKMAIISQECVMHQKKNYNTQKENREFPLS 494
           ||| ||  ||.|.||.||||  ||||  .||||||.       . | | ||   . .|. 
Sbjct: 448 GFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMY-TQNNIQSYPIG 506

Query: 495 DYSEED 500
           .  | .
Sbjct: 507 EDEESE 512

>hg18||uc003wzl |8|CR604993|NA|NA|SLC18A1|NM_003053|NP_003044|solute carrier
        family 18 (vesicular monoamine),

          Length = 312

 Score =  430 bits (1104), Expect = 3e-120
 Identities = 212/312 (67%), Positives = 243/312 (77%), Gaps = 1/312 (0%)

Query: 193 MLASVYTDDEERXXXXXXXXXXXXXXXXXXXPFGSVMYEFVGKSTPFLILAFLAVFDGAL 252
           ||||||||| ||                   ||||||||||||| |||||||||. ||||
Sbjct:   1 MLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLALLDGAL 60

Query: 253 QMCILQPSKISPGSVEGTPLLTLLKDPYILISAGCLCFANMGVAILEPTLPIWMMQTMCS 312
           |.|||||||.|| | .||||  ||||||||..|| .||||||||||||||||||||||||
Sbjct:  61 QLCILQPSKVSPESAKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCS 120

Query: 313 SKWQLGMAFLPASVSYLIGTNLFGLLANKMGRWLCSMLGMFIVGISLLCVPFATSIYXXX 372
            |||||.|||||||||||||||||.|||||||||||..|| .|| |||||| | .|.   
Sbjct: 121 PKWQLGLAFLPASVSYLIGTNLFGVLANKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLI 180

Query: 373 XXXXXXXXXXXMVDSSMMAIMGYLVDIRHASVYGSIYAIADVALCMGFAIGPSTGGALVQ 432
                      ||||||| |||.|||.|| |||||.||||||| |||||||||||||.|.
Sbjct: 181 GPNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVK 240

Query: 433 VVGFPSLMVFIGVINILYAPLCVLLRSPAVREEKMAIISQECVMHQKKNYNTQKENREFP 492
            .||| |||  |||||.|||||  ||||  .|||.||.||.| | . . | |||  .|||
Sbjct: 241 AIGFPWLMVITGVINIVYAPLCYYLRSPPAKEEKLAILSQDCPM-ETRMYATQKPTKEFP 299

Query: 493 LSDYSEEDETEE 504
           | . |.|.   |
Sbjct: 300 LGEDSDEEPDHE 311

>hg18||uc003wzn
        |8|BC006317|Q9BRE4|Q9BRE4_HUMAN|SLC18A1|NM_003053|NP_003044|solute
        carrier family 18 (vesicular monoamine),

          Length = 493

 Score =  309 bits (790), Expect = 7e-084
 Identities = 185/343 (53%), Positives = 224/343 (65%), Gaps = 27/343 (7%)

Query:  18 DNMLLTVVVPIIPTFLYTID--HPSPKAQNVHPTPTPRDIYTGPWSEETPHLVSLFDNTT 75
           |||| ||||||.||||| ..    .      |   .|  . .  .|     . | |.| |
Sbjct:  34 DNMLFTVVVPIVPTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFST----IFSFFNNNT 89

Query:  76 FSVE-------SWME--ASPYPKPAAWTGLPTDPNSSCLQDSLFLEEENVRVGFLFASKA 126
            .||       .||   ||  | ||  |   .   ..||| . |||||  ||| ||||||
Sbjct:  90 VAVEESVPSGIAWMNDTASTIPPPA--TEAISAHKNNCLQGTGFLEEEITRVGVLFASKA 147

Query: 127 LVQLLVNPFVGPLTNRVGYHIPMFAGFIIMFVSTIMFAFSGTYVLLFFARSLQGIGSSFS 186
           ..||||||||||||||.||||||||||.|||.||.|||||||| ||| ||.|||||||||
Sbjct: 148 VMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFS 207

Query: 187 SVAGLGMLASVYTDDEERXXXXXXXXXXXXXXXXXXXPFGSVMYEFVGKSTPFLILAFLA 246
           ||||||||||||||| ||                   ||||||||||||| |||||||||
Sbjct: 208 SVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLA 267

Query: 247 VFDGALQMCILQPSKISPGSVEGTPLLTLLKDPYILISAGCLCFANMGVAILEPT----- 301
           . |||||.|||||||.|| | .||||  ||||||||..|| | |    |. |  |     
Sbjct: 268 LLDGALQLCILQPSKVSPESAKGTPLFMLLKDPYILVAAG-LAFLPASVSYLIGTNLFGV 326

Query: 302 LPIWMMQTMCSSKWQLGMAFLPASVSYL-IGTNLFGLLANKMG 343
           |   | . .||    .||  .  |.  . .  |.|||.    |
Sbjct: 327 LANKMGRWLCS---LIGMLVVGTSLLCVPLAHNIFGLIGPNAG 366

>hg18||uc003wzo
        |8|CR593627|Q9BRE4|Q9BRE4_HUMAN|SLC18A1|NM_003053|NP_003044|solute
        carrier family 18 (vesicular monoamine),

          Length = 493

 Score =  309 bits (790), Expect = 7e-084
 Identities = 185/343 (53%), Positives = 224/343 (65%), Gaps = 27/343 (7%)

Query:  18 DNMLLTVVVPIIPTFLYTID--HPSPKAQNVHPTPTPRDIYTGPWSEETPHLVSLFDNTT 75
           |||| ||||||.||||| ..    .      |   .|  . .  .|     . | |.| |
Sbjct:  34 DNMLFTVVVPIVPTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFST----IFSFFNNNT 89

Query:  76 FSVE-------SWME--ASPYPKPAAWTGLPTDPNSSCLQDSLFLEEENVRVGFLFASKA 126
            .||       .||   ||  | ||  |   .   ..||| . |||||  ||| ||||||
Sbjct:  90 VAVEESVPSGIAWMNDTASTIPPPA--TEAISAHKNNCLQGTGFLEEEITRVGVLFASKA 147

Query: 127 LVQLLVNPFVGPLTNRVGYHIPMFAGFIIMFVSTIMFAFSGTYVLLFFARSLQGIGSSFS 186
           ..||||||||||||||.||||||||||.|||.||.|||||||| ||| ||.|||||||||
Sbjct: 148 VMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFS 207

Query: 187 SVAGLGMLASVYTDDEERXXXXXXXXXXXXXXXXXXXPFGSVMYEFVGKSTPFLILAFLA 246
           ||||||||||||||| ||                   ||||||||||||| |||||||||
Sbjct: 208 SVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLA 267

Query: 247 VFDGALQMCILQPSKISPGSVEGTPLLTLLKDPYILISAGCLCFANMGVAILEPT----- 301
           . |||||.|||||||.|| | .||||  ||||||||..|| | |    |. |  |     
Sbjct: 268 LLDGALQLCILQPSKVSPESAKGTPLFMLLKDPYILVAAG-LAFLPASVSYLIGTNLFGV 326

Query: 302 LPIWMMQTMCSSKWQLGMAFLPASVSYL-IGTNLFGLLANKMG 343
           |   | . .||    .||  .  |.  . .  |.|||.    |
Sbjct: 327 LANKMGRWLCS---LIGMLVVGTSLLCVPLAHNIFGLIGPNAG 366

>hg18||uc001jhw
        |10|NM_003055|Q16572|VACHT_HUMAN|SLC18A3|NM_003055|NP_003046|vesicular
        acetylcholine transporter

          Length = 532

 Score =  290 bits (742), Expect = 3e-078
 Identities = 155/403 (38%), Positives = 233/403 (57%), Gaps = 15/403 (3%)

Query:  72 DNTTFSVESWMEASPYPKPA---AWT----GLPTD--PNSSCLQDSLFLEEENVRVGFLF 122
           .  | . | |    | | ||   |.|      ||   |  | |.     | |.|..| ||
Sbjct:  69 EGPTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESEDVKIGVLF 128

Query: 123 ASKALVQLLVNPFVGPLTNRVGYHIPMFAGFIIMFVSTIMFAFSGTYVLLFFARSLQGIG 182
           ||||..||||||  ||  .|. | .|.  |  .|| ||..|||.  |  || ||||||.|
Sbjct: 129 ASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFAARSLQGLG 188

Query: 183 SSFSSVAGLGMLASVYTDDEERXXXXXXXXXXXXXXXXXXXPFGSVMYEFVGKSTPFLIL 242
           |.|.  .|. |.|  | .. ||                   ||| ..||| ||  |||.|
Sbjct: 189 SAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAGKRVPFLVL 248

Query: 243 AFLAVFDGALQMCILQP----SKISPGSVEGTPLLTLLKDPYILISAGCLCFANMGVAIL 298
           | ...||  | . . .|    ..       |||.  |. |||| . || |   |. .| |
Sbjct: 249 AAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTTCNIPLAFL 308

Query: 299 EPTLPIWMMQTMCSSKWQLGMAFLPASVSYLIGTNLFGLLANKMG--RWLCSMLGMFIVG 356
           |||.  ||  || .|.|..|||.||| | ...|  |   || .    .||   ||. ..|
Sbjct: 309 EPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAARYPHLQWLYGALGLAVIG 368

Query: 357 ISLLCVPFATSIYXXXXXXXXXXXXXXMVDSSMMAIMGYLVDIRHASVYGSIYAIADVAL 416
            |   ||   |                .||....  . .|||.|| |||||.|||||.. 
Sbjct: 369 ASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISY 428

Query: 417 CMGFAIGPSTGGALVQVVGFPSLMVFIGVINILYAPLCVLLRS 459
            . .|.||   | .|  .||  | . .|. |.||||. .|||.
Sbjct: 429 SVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRN 471

>hg18||uc003wzn
        |8|BC006317|Q9BRE4|Q9BRE4_HUMAN|SLC18A1|NM_003053|NP_003044|solute
        carrier family 18 (vesicular monoamine),

          Length = 493

 Score =  249 bits (634), Expect = 9e-066
 Identities = 122/187 (65%), Positives = 146/187 (78%), Gaps = 1/187 (0%)

Query: 318 GMAFLPASVSYLIGTNLFGLLANKMGRWLCSMLGMFIVGISLLCVPFATSIYXXXXXXXX 377
           |.|||||||||||||||||.|||||||||||..|| .|| |||||| | .|.        
Sbjct: 307 GLAFLPASVSYLIGTNLFGVLANKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAG 366

Query: 378 XXXXXXMVDSSMMAIMGYLVDIRHASVYGSIYAIADVALCMGFAIGPSTGGALVQVVGFP 437
                 ||||||| |||.|||.|| |||||.||||||| |||||||||||||.|. .|||
Sbjct: 367 LGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFP 426

Query: 438 SLMVFIGVINILYAPLCVLLRSPAVREEKMAIISQECVMHQKKNYNTQKENREFPLSDYS 497
            |||  |||||.|||||  ||||  .|||.||.||.| | . . | |||  .|||| . |
Sbjct: 427 WLMVITGVINIVYAPLCYYLRSPPAKEEKLAILSQDCPM-ETRMYATQKPTKEFPLGEDS 485

Query: 498 EEDETEE 504
           .|.   |
Sbjct: 486 DEEPDHE 492

>hg18||uc003wzo
        |8|CR593627|Q9BRE4|Q9BRE4_HUMAN|SLC18A1|NM_003053|NP_003044|solute
        carrier family 18 (vesicular monoamine),

          Length = 493

 Score =  249 bits (634), Expect = 9e-066
 Identities = 122/187 (65%), Positives = 146/187 (78%), Gaps = 1/187 (0%)

Query: 318 GMAFLPASVSYLIGTNLFGLLANKMGRWLCSMLGMFIVGISLLCVPFATSIYXXXXXXXX 377
           |.|||||||||||||||||.|||||||||||..|| .|| |||||| | .|.        
Sbjct: 307 GLAFLPASVSYLIGTNLFGVLANKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAG 366

Query: 378 XXXXXXMVDSSMMAIMGYLVDIRHASVYGSIYAIADVALCMGFAIGPSTGGALVQVVGFP 437
                 ||||||| |||.|||.|| |||||.||||||| |||||||||||||.|. .|||
Sbjct: 367 LGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFP 426

Query: 438 SLMVFIGVINILYAPLCVLLRSPAVREEKMAIISQECVMHQKKNYNTQKENREFPLSDYS 497
            |||  |||||.|||||  ||||  .|||.||.||.| | . . | |||  .|||| . |
Sbjct: 427 WLMVITGVINIVYAPLCYYLRSPPAKEEKLAILSQDCPM-ETRMYATQKPTKEFPLGEDS 485

Query: 498 EEDETEE 504
           .|.   |
Sbjct: 486 DEEPDHE 492

>hg18||uc003qdw
        |6|NM_052831|Q6NT16|Q6NT16_HUMAN|C6orf192|NM_052831|NP_439896|hypotheti
        cal protein LOC116843

          Length = 456

 Score =  57 bits (136), Expect = 5e-008
 Identities = 41/145 (28%), Positives = 69/145 (47%), Gaps = 10/145 (6%)

Query: 224 PFGSVMYEFVGKSTPFLILAFLAVFDGALQMCILQPSKISPGSVEGTPLLTLLKDPYI-- 281
           | |  .|.  |   ||..|  . .    | | ||   .  ||      |. | |   |  
Sbjct: 183 PVGGFLYQSFGYEVPFIVLGCVVLLMVPLNMYILPNYESDPGEHSFWKLIALPKVGLIAF 242

Query: 282 LISAGCLCFANMGVAILEPTLPIWMMQTMCSSKWQLGMAFLPASVSYLIGTNLFGLLANK 341
           .|..   ||       |.||| .....        .|. ||  ..|| | . |||||..|
Sbjct: 243 VINSLSSCF-----GFLDPTLSLFVLEKFNLPAGYVGLVFLGMALSYAISSPLFGLLSDK 297

Query: 342 ---MGRWLCSMLGMFIVGISLLCVP 363
              . .||     .   |  .|  |
Sbjct: 298 RPPLRKWLLVFGNLITAGCYMLLGP 322

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0