BLASTP 7.6.0


Query=fugu4_189436 |jgi|Takru4|189436|gw2.9.397.1
        (953 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002ona |19|NM_002446|Q02779|M3K10_HUMAN|MAP3K10|NM_00244...    748   8e-216
hg18||uc001xml |14|NM_033141|P80192-4|P80192-4|MAP3K9|NM_033141|...    719   5e-207
hg18||uc001xmm |14|BC111407|P80192|M3K9_HUMAN|MAP3K9|NM_033141|N...    719   5e-207
hg18||uc001hvt |1|NM_032435|Q5TCX8|M3KL4_HUMAN|KIAA1804|NM_03243...    672   9e-193
hg18||uc001oew |11|NM_002419|Q16584|M3K11_HUMAN|MAP3K11|NM_00241...    540   4e-153
hg18||uc001hvs |1|AJ311797|Q5TCX8-2|Q5TCX8-2|KIAA1804|NM_032435|...    442   1e-123
hg18||uc001xmk |14|BX648924|NA|NA|MAP3K9|NM_033141|NP_149132|mit...    343   7e-094
hg18||uc003fpi |3|NM_004721|O43283|M3K13_HUMAN|MAP3K13|NM_004721...    210   1e-053
hg18||uc001sdm |12|NM_006301|Q12852|M3K12_HUMAN|MAP3K12|NM_00630...    205   2e-052
hg18||uc001sdn |12|AK094195|Q12852|M3K12_HUMAN|MAP3K12|NM_006301...    205   2e-052
hg18||uc002uhy |2|NM_133646|Q9NYL2-2|Q9NYL2-2|ZAK|NM_133646|NP_5...    201   6e-051
hg18||uc002uhz |2|NM_016653|Q9NYL2|MLTK_HUMAN|ZAK|NM_016653|NP_0...    201   6e-051
hg18||uc002uia |2|CR598198|NA|NA|ZAK|NM_133646|NP_598407|MLK-rel...    201   6e-051
hg18||uc001hvs |1|AJ311797|Q5TCX8-2|Q5TCX8-2|KIAA1804|NM_032435|...    192   2e-048
hg18||uc002uhx |2|AF465843|Q9NYL2-3|Q9NYL2-3|ZAK|NM_133646|NP_59...    191   6e-048
hg18||uc003fph |3|BC031677|NA|NA|LZK|NA|NA|Homo sapiens mRNA for...    177   9e-044
hg18||uc001dge |1|AB208941|Q59H18|TNI3K_HUMAN|TNNI3K|NA|NA|Serin...    139   3e-032
hg18||uc001dgf |1|NM_015978|Q59H18-2|Q59H18-2|TNNI3K|NM_015978|N...    139   3e-032
hg18||uc003vij |7|NM_000245|P08581|MET_HUMAN|MET|NM_000245|NP_00...    131   6e-030
hg18||uc003cxy |3|NM_002447|Q04912|RON_HUMAN|MST1R|NM_002447|NP_...    129   2e-029
hg18||uc002ggj |17|AK225403|Q13470-2|Q13470-2|TNK1|NM_003985|NP_...    126   2e-028
hg18||uc002tue |2|NM_025052|Q56UN5|YSK4_HUMAN|YSK4|NM_025052|NP_...    118   5e-026
hg18||uc002tuf |2|NM_001018046|Q56UN5-5|Q56UN5-5|YSK4|NM_0010180...    118   5e-026
hg18||uc002ggi |17|NM_003985|Q13470|TNK1_HUMAN|TNK1|NM_003985|NP...    117   6e-026
hg18||uc001vnm |13|NM_003576|Q9Y6E0|STK24_HUMAN|STK24|NM_003576|...    109   2e-023
hg18||uc001vnn |13|NM_001032296|Q9Y6E0-2|Q9Y6E0-2|STK24|NM_00103...    109   2e-023
hg18||uc002tuh |2|AK131216|Q56UN5-3|Q56UN5-3|YSK4|NM_025052|NP_0...    108   5e-023
hg18||uc002wbm |2|X99325|O00506|STK25_HUMAN|STK25|NM_006374|NP_0...    108   5e-023
hg18||uc002wbn |2|CR614826|O00506|STK25_HUMAN|STK25|NM_006374|NP...    108   5e-023
hg18||uc002wbp |2|NM_006374|O00506|STK25_HUMAN|STK25|NM_006374|N...    108   5e-023
hg18||uc001fqg |1|NM_014215|P14616|INSRR_HUMAN|INSRR|NM_014215|N...    102   2e-021
hg18||uc004ewk |X|NM_016542|Q9P289|MST4_HUMAN|MST4|NM_016542|NP_...    102   2e-021
hg18||uc002bul |15|NM_000875|P08069|IGF1R_HUMAN|IGF1R|NM_000875|...    102   4e-021
hg18||uc002mgd |19|NM_000208|P06213|INSR_HUMAN|INSR|NM_000208|NP...    101   8e-021
hg18||uc002mge |19|NM_001079817|Q17RW0|Q17RW0_HUMAN|INSR|NM_0010...    101   8e-021
hg18||uc002jbe |17|AX775741|Q8N3I9|Q8N3I9_HUMAN|MAP3K3|NM_203351...     99   3e-020
hg18||uc002jbf |17|NM_203351|Q8N3I9|Q8N3I9_HUMAN|MAP3K3|NM_20335...     99   3e-020
hg18||uc002jbg |17|NM_002401|Q96HN9|Q96HN9_HUMAN|MAP3K3|NM_00240...     99   3e-020
hg18||uc002jbh |17|AK225784|Q8N3I9|Q8N3I9_HUMAN|MAP3K3|NM_203351...     99   3e-020
hg18||uc002jbi |17|DQ454151|Q1PBM3|Q1PBM3_HUMAN|MAP3K3|NM_002401...     99   3e-020
hg18||uc003xlp |8|NM_023110|P11362|FGFR1_HUMAN|FGFR1|NM_023110|N...     98   5e-020
hg18||uc003xlq |8|NM_015850|P11362-7|P11362-7|FGFR1|NM_015850|NP...     98   5e-020
hg18||uc003xlr |8|NM_023106|P11362-6|P11362-6|FGFR1|NM_023106|NP...     98   5e-020
hg18||uc003xls |8|NM_023105|P11362-4|P11362-4|FGFR1|NM_023105|NP...     98   5e-020
hg18||uc001xmk |14|BX648924|NA|NA|MAP3K9|NM_033141|NP_149132|mit...     97   7e-020
hg18||uc003lro |5|NM_002609|P09619|PGFRB_HUMAN|PDGFRB|NM_002609|...     97   9e-020
hg18||uc001dgd |1|BC032865|Q59H18-4|Q59H18-4|TNNI3K|NA|NA|Serine...     95   3e-019
hg18||uc002toj |2|NM_006609|Q9Y2U5|M3K2_HUMAN|MAP3K2|NM_006609|N...     95   3e-019
hg18||uc001oew |11|NM_002419|Q16584|M3K11_HUMAN|MAP3K11|NM_00241...     94   8e-019
hg18||uc003pxp |6|NM_002944|Q5TDB5|Q5TDB5_HUMAN|ROS1|NM_002944|N...     94   8e-019
hg18||uc001bfx |1|NM_020526|P29322|EPHA8_HUMAN|EPHA8|NM_020526|N...     91   7e-018
hg18||uc002wbo |2|AK092161|NA|NA|STK25|NM_006374|NP_006365|serin...     86   2e-016
hg18||uc003pnz |6|NM_145331|O43318|M3K7_HUMAN|MAP3K7|NM_145331|N...     84   1e-015
hg18||uc003poa |6|NM_145332|Q5TDM9|Q5TDM9_HUMAN|MAP3K7|NM_145332...     84   1e-015
hg18||uc003pob |6|NM_003188|O43318-2|O43318-2|MAP3K7|NM_003188|N...     84   1e-015
hg18||uc003poc |6|NM_145333|Q9NZ70|Q9NZ70_HUMAN|MAP3K7|NM_145333...     84   1e-015
hg18||uc004ewl |X|NM_001042453|Q8NC04|Q8NC04_HUMAN|MST4|NM_00104...     83   1e-015
hg18||uc003gxz |4|NM_003215|P42680|TEC_HUMAN|TEC|NM_003215|NP_00...     82   2e-015
hg18||uc001bmr |1|NM_002953|Q15418|KS6A1_HUMAN|RPS6KA1|NM_002953...     81   5e-015
hg18||uc001bms |1|NM_001006665|Q15418|KS6A1_HUMAN|RPS6KA1|NM_001...     81   5e-015
hg18||uc001cbv |1|NM_001004338|Q6ZNH1|Q6ZNH1_HUMAN|EPHA10|NM_001...     80   9e-015
hg18||uc003fwy |3|NM_002577|Q6ISC3|Q6ISC3_HUMAN|PAK2|NM_002577|N...     80   9e-015
hg18||uc004eej |X|NM_014496|Q9UK32|KS6A6_HUMAN|RPS6KA6|NM_014496...     80   1e-014
hg18||uc004czu |X|NM_004586|P51812|KS6A3_HUMAN|RPS6KA3|NM_004586...     80   1e-014
hg18||uc004czv |X|AB208933|P51812|KS6A3_HUMAN|RPS6KA3|NM_004586|...     80   1e-014
hg18||uc003qvb |6|NM_021135|Q15349|KS6A2_HUMAN|RPS6KA2|NM_021135...     79   3e-014
hg18||uc003qvc |6|NM_001006932|Q15349|KS6A2_HUMAN|RPS6KA2|NM_001...     79   3e-014
hg18||uc003qvd |6|AB209116|Q15349-2|Q15349-2|RPS6KA2|NM_021135|N...     79   3e-014
hg18||uc002lyt |19|NM_139355|P42679|MATK_HUMAN|MATK|NM_139355|NP...     78   4e-014
hg18||uc002lyu |19|NM_139354|Q9NST8|Q9NST8_HUMAN|MATK|NM_139354|...     78   4e-014
hg18||uc002lyv |19|NM_002378|Q9NST8|Q9NST8_HUMAN|MATK|NM_002378|...     78   4e-014
hg18||uc002qcq |19|NM_002739|P05129|KPCG_HUMAN|PRKCG|NM_002739|N...     78   4e-014
hg18||uc002onb |19|CR605472|NA|NA|MAP3K10|NA|NA|Homo sapiens mit...     75   4e-013
hg18||uc002wnj |20|NM_020341|Q9P286|PAK7_HUMAN|PAK7|NM_020341|NP...     75   5e-013
hg18||uc002wnk |20|NM_177990|Q9P286|PAK7_HUMAN|PAK7|NM_177990|NP...     75   5e-013
hg18||uc002wnl |20|AX776013|Q9P286|PAK7_HUMAN|PAK7|NM_177990|NP_...     75   5e-013
hg18||uc001oyh |11|NM_002576|Q13153|PAK1_HUMAN|PAK1|NM_002576|NP...     74   6e-013
hg18||uc001zkz |15|NM_020168|Q9NQU5|PAK6_HUMAN|PAK6|NM_020168|NP...     74   8e-013
hg18||uc001zlb |15|BC035596|Q9NQU5|PAK6_HUMAN|PAK6|NM_020168|NP_...     74   8e-013
hg18||uc002tug |2|AK225579|Q56UN5-6|Q56UN5-6|YSK4|NM_001018046|N...     74   8e-013
hg18||uc004eoy |X|AK128022|NA|NA|PAK3|NA|NA|Homo sapiens PAK3 mR...     74   8e-013
hg18||uc004eoz |X|NM_002578|O75914-2|O75914-2|PAK3|NM_002578|NP_...     74   8e-013
hg18||uc004epa |X|AB102659|O75914|PAK3_HUMAN|PAK3|NM_002578|NP_0...     74   8e-013
hg18||uc001oyg |11|AF071884|Q13153-2|Q13153-2|PAK1|NA|NA|Serine/...     73   1e-012
hg18||uc001oyi |11|AK055228|Q13153|PAK1_HUMAN|PAK1|NM_002576|NP_...     73   1e-012
hg18||uc002aqu |15|NM_145160|Q13163|MP2K5_HUMAN|MAP2K5|NM_145160...     72   2e-012
hg18||uc002aqw |15|CR611862|Q13163|MP2K5_HUMAN|MAP2K5|NM_145160|...     72   2e-012
hg18||uc002aqx |15|AK057521|NA|NA|MAP2K5|NM_145160|NP_660143|mit...     72   2e-012
hg18||uc003day |3|BC068497|Q16644|MAPK3_HUMAN|MAPKAPK3|NM_004635...     72   2e-012
hg18||uc003daz |3|NM_004635|Q16644|MAPK3_HUMAN|MAPKAPK3|NM_00463...     72   2e-012
hg18||uc003dba |3|U09578|Q16644|MAPK3_HUMAN|MAPKAPK3|NM_004635|N...     72   2e-012
hg18||uc002dmc |16|NM_002738|P05771-2|P05771-2|PRKCB1|NM_002738|...     71   5e-012
hg18||uc002dmd |16|NM_212535|P05771|KPCB_HUMAN|PRKCB1|NM_212535|...     71   5e-012
hg18||uc001hhd |1|NM_020439|Q96NX5|KCC1G_HUMAN|CAMK1G|NM_020439|...     67   1e-010
hg18||uc001hhe |1|AK095713|Q96NX5|KCC1G_HUMAN|CAMK1G|NM_020439|N...     67   1e-010
hg18||uc001hhf |1|AY212935|Q96NX5-2|Q96NX5-2|CAMK1G|NM_020439|NP...     67   1e-010
hg18||uc004fjr |X|NM_001025242|P51617-2|P51617-2|IRAK1|NM_001025...     66   2e-010
hg18||uc004fjs |X|NM_001569|P51617|IRAK1_HUMAN|IRAK1|NM_001569|N...     66   2e-010
hg18||uc004fjt |X|NM_001025243|Q96C06|Q96C06_HUMAN|IRAK1|NM_0010...     66   2e-010
hg18||uc004fju |X|AM393211|P51617-3|P51617-3|IRAK1|NM_001025242|...     66   2e-010

>hg18||uc002ona
        |19|NM_002446|Q02779|M3K10_HUMAN|MAP3K10|NM_002446|NP_002437|mitogen-ac
        tivated protein kinase kinase kinase

          Length = 954

 Score =  748 bits (1931), Expect = 8e-216
 Identities = 458/971 (47%), Positives = 539/971 (55%), Gaps = 54/971 (5%)

Query:   1 GVTNPNPYWTAVFDYEATADEELTLRRGDLLEVLSKDSKVSGDEGWWTGKI-QDKVGIFP 59
           | |   | |||||||||  |||||||||| ..|||.|  ||||||||||..   .||.||
Sbjct:  13 GTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGVFP 72

Query:  60 SNYVTKGDAANYKQXXXXXXXXXXXXECPLEIDFLELHLEEVIGAGGFGKVYKGMWRNEE 119
           ||||  |  |                . | || | || |||.|| |||||||. .|| ||
Sbjct:  73 SNYVAPGAPA-----------APAGLQLPQEIPFHELQLEEIIGVGGFGKVYRALWRGEE 121

Query: 120 VAVKAARQDPDEDISATAESVRQEARLFWMLQHRNIIALRGVCLREPNLCLVMEYXXXXX 179
           ||||||| ||..| . ||| | ||||||  ||| ||||||| ||  |.|||||||     
Sbjct: 122 VAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGGA 181

Query: 180 XXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGS 239
                  ..||| ||||||||.| ||.|||| | |||||||||| |||||| .|  .|  
Sbjct: 182 LSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLAD 241

Query: 240 KTLKITDFGLAREWHQTTKMSAAGTYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEV 299
             |||||||||||||.||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 242 TVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGEV 301

Query: 300 PYREIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAIE 359
           ||||||||||||||||||||||||||||||||.|||||| |.|| || | |||..|  ||
Sbjct: 302 PYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVIE 361

Query: 360 QSAMFQMPLESFHSLQEDWRLEIQQMFDELRAKEKELRSWXXXXXXXXXXXXXXXXXXXX 419
           |||.|||||||||||||||.|||| |||.|| |||||||                     
Sbjct: 362 QSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLRR 421

Query: 420 XXXXXXXXXIDIVERELNIIIHQVYQEKPSVKKRKGHFKKSRLLKLGRDSNCISLPSGFE 479
                    .|||||||.... |. |||| |.||||.||.||||||    . ||||||||
Sbjct: 422 REQELAEREMDIVERELHLLMCQLSQEKPRVRKRKGNFKRSRLLKLREGGSHISLPSGFE 481

Query: 480 HKITVQASPKVDKRKPQGSESTTPPASPGVIPRLRAIRLTPTD--GSKTWGRSAVCKKED 537
           ||||||||| .||||  ||.  .||||| .||||||||||| |  || .   |       
Sbjct: 482 HKITVQASPTLDKRK--GSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWS 539

Query: 538 LSSSKKKGRTWGPSSTHQKERVGGEDKLKSLGEGCKVWSSSAPNLGKSPKHAPMTAGFSS 597
                ||    |     .| |  |     .| .           ||.  |    .|    
Sbjct: 540 RGGPPKKEELVGGK---KKGRTWGPS--STLQKERVGGEERLKGLGEGSKQWSSSAPNLG 594

Query: 598 LNEMEECCDPE-ESPGSLQPSETSSNGAVDDSGSLWSSPSATXXXXXXXXXXXXXANYQE 656
            .       |   |   ..    . .|      | .|.||               | .. 
Sbjct: 595 KSPKHTPIAPGFASLNEMEEFAEAEDGGSSVPPSPYSTPSYLSVPLPAEPSPGARAPWEP 654

Query: 657 SARR------CSQRKKSDMLLLGCASLLASVAXXXXXXXXXXXXXXRDEQRKKKDGL-FQ 709
           .            |.. |. |||||.|| .|                .|||.  ||| | 
Sbjct: 655 TPSAPPARWGHGARRRCDLALLGCATLLGAVGLGADVAEARAADG--EEQRRWLDGLFFP 712

Query: 710 RAGRF---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPS 766
           |||||                                                     |.
Sbjct: 713 RAGRFPRGLSPPARPHGRREDVGPGLGLAPSATLVSLSSVSDCNSTRSLLRSDSDEAAPA 772

Query: 767 DPEEYPLTPMMGAKTXXXXXXXXXXXXXXXRAESFKKEPNQSLTPTHVSAAMAMNRGHRR 826
            |   |  |                       |||||.| ||||||||.|| |..|||||
Sbjct: 773 APSPPPSPP-----APTPTPSPSTNPLVDLELESFKKDPRQSLTPTHVTAACAVSRGHRR 827

Query: 827 TPSDGAIRPRA--QTLGHRRTP---LEIPRLPIPTSVFXXXXXXXXXXXXXXXTLEFXXX 881
           ||||||.  |   .  ||   |   |. |||| | ..|               || |   
Sbjct: 828 TPSDGALGQRGPPEPAGHGPGPRDLLDFPRLPDPQALF-PARRRPPEFPGRPTTLTFAPR 886

Query: 882 XXXXXXXXXXSDAWKXXXXXXXXXXXXXXXXXXPQXXXXXXXXXXXXXXXQQNLMDMDVE 941
                      | ||                  |.               |  |.|||.|
Sbjct: 887 PRPAASRPRL-DPWKLVSFGRTLTISPPSRPDTPE--------SPGPPSVQPTLLDMDME 937

Query: 942 GQSLDQTVPLC 952
           ||. | |||||
Sbjct: 938 GQNQDSTVPLC 948

>hg18||uc001xml
        |14|NM_033141|P80192-4|P80192-4|MAP3K9|NM_033141|NP_149132|mitogen-acti
        vated protein kinase kinase kinase

          Length = 1118

 Score =  719 bits (1855), Expect = 5e-207
 Identities = 363/568 (63%), Positives = 429/568 (75%), Gaps = 7/568 (1%)

Query:   1 GVTNPNPYWTAVFDYEATADEELTLRRGDLLEVLSKDSKVSGDEGWWTGKIQDKVGIFPS 60
           |   | |||||||.|||  ..||||| ||..|||||||.||||||||||..  .||||||
Sbjct:  49 GCDAPLPYWTAVFEYEAAGEDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPS 108

Query:  61 NYVTKGDAANYKQXXXXXXXXXXXXECPLEIDFLELHLEEVIGAGGFGKVYKGMWRNEEV 120
           ||||   | . .                ||||| || |||.|| |||||||.  |  .||
Sbjct: 109 NYVTPRSAFSSRCQPGGEDPSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWIGDEV 168

Query: 121 AVKAARQDPDEDISATAESVRQEARLFWMLQHRNIIALRGVCLREPNLCLVMEYXXXXXX 180
           |||||| ||||||| | |.|||||.|| ||.| ||||||||||.|||||||||.      
Sbjct: 169 AVKAARHDPDEDISQTIENVRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPL 228

Query: 181 XXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSK 240
                 |..|| .||||||||| ||.|||..| ||||||||||||||||. .|   | .|
Sbjct: 229 NRVLSGKRIPPDILVNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNK 288

Query: 241 TLKITDFGLAREWHQTTKMSAAGTYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVP 300
            |||||||||||||.||||||||||||||||||. |.||| |||||.|||||||||||||
Sbjct: 289 ILKITDFGLAREWHRTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVP 348

Query: 301 YREIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQ 360
           .| || |||||||||||| ||||||||||||.|.|.||.|.||||||||.|| ||  ||.
Sbjct: 349 FRGIDGLAVAYGVAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEE 408

Query: 361 SAMFQMPLESFHSLQEDWRLEIQQMFDELRAKEKELRSWXXXXXXXXXXXXXXXXXXXXX 420
           |  |.|| .||| ||..|. |||.|||.|||||||||.|                     
Sbjct: 409 SGFFEMPKDSFHCLQDNWKHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRR 468

Query: 421 XXXXXXXXIDIVERELNIIIHQVYQEKPSVKKRKGHFKKSRLLKLGRDSNCISLPSGFEH 480
                   |||.||||||||||. |||| |||||| |.||| ||| .| | ||||| |.|
Sbjct: 469 EQELAEREIDILERELNIIIHQLCQEKPRVKKRKGKFRKSR-LKL-KDGNRISLPSDFQH 526

Query: 481 KITVQASPKVDKRKPQGSESTTPPASPGVIPRLRAIRLTPTDGSKTWGRSAVCKK----- 535
           | |||||| .||||   .  ..||||| .|||||||.||| . |||||||.|  |     
Sbjct: 527 KFTVQASPTMDKRKSLINSRSSPPASPTIIPRLRAIQLTPGESSKTWGRSSVVPKEEGEE 586

Query: 536 EDLSSSKKKGRTWGPSSTHQKERVGGED 563
           |.  . ||||||||| .  |||   |..
Sbjct: 587 EEKRAPKKKGRTWGPGTLGQKELASGDE 614

>hg18||uc001xmm
        |14|BC111407|P80192|M3K9_HUMAN|MAP3K9|NM_033141|NP_149132|mitogen-activ
        ated protein kinase kinase kinase

          Length = 1104

 Score =  719 bits (1855), Expect = 5e-207
 Identities = 363/568 (63%), Positives = 429/568 (75%), Gaps = 7/568 (1%)

Query:   1 GVTNPNPYWTAVFDYEATADEELTLRRGDLLEVLSKDSKVSGDEGWWTGKIQDKVGIFPS 60
           |   | |||||||.|||  ..||||| ||..|||||||.||||||||||..  .||||||
Sbjct:  49 GCDAPLPYWTAVFEYEAAGEDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPS 108

Query:  61 NYVTKGDAANYKQXXXXXXXXXXXXECPLEIDFLELHLEEVIGAGGFGKVYKGMWRNEEV 120
           ||||   | . .                ||||| || |||.|| |||||||.  |  .||
Sbjct: 109 NYVTPRSAFSSRCQPGGEDPSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWIGDEV 168

Query: 121 AVKAARQDPDEDISATAESVRQEARLFWMLQHRNIIALRGVCLREPNLCLVMEYXXXXXX 180
           |||||| ||||||| | |.|||||.|| ||.| ||||||||||.|||||||||.      
Sbjct: 169 AVKAARHDPDEDISQTIENVRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPL 228

Query: 181 XXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSK 240
                 |..|| .||||||||| ||.|||..| ||||||||||||||||. .|   | .|
Sbjct: 229 NRVLSGKRIPPDILVNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNK 288

Query: 241 TLKITDFGLAREWHQTTKMSAAGTYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVP 300
            |||||||||||||.||||||||||||||||||. |.||| |||||.|||||||||||||
Sbjct: 289 ILKITDFGLAREWHRTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVP 348

Query: 301 YREIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQ 360
           .| || |||||||||||| ||||||||||||.|.|.||.|.||||||||.|| ||  ||.
Sbjct: 349 FRGIDGLAVAYGVAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEE 408

Query: 361 SAMFQMPLESFHSLQEDWRLEIQQMFDELRAKEKELRSWXXXXXXXXXXXXXXXXXXXXX 420
           |  |.|| .||| ||..|. |||.|||.|||||||||.|                     
Sbjct: 409 SGFFEMPKDSFHCLQDNWKHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRR 468

Query: 421 XXXXXXXXIDIVERELNIIIHQVYQEKPSVKKRKGHFKKSRLLKLGRDSNCISLPSGFEH 480
                   |||.||||||||||. |||| |||||| |.||| ||| .| | ||||| |.|
Sbjct: 469 EQELAEREIDILERELNIIIHQLCQEKPRVKKRKGKFRKSR-LKL-KDGNRISLPSDFQH 526

Query: 481 KITVQASPKVDKRKPQGSESTTPPASPGVIPRLRAIRLTPTDGSKTWGRSAVCKK----- 535
           | |||||| .||||   .  ..||||| .|||||||.||| . |||||||.|  |     
Sbjct: 527 KFTVQASPTMDKRKSLINSRSSPPASPTIIPRLRAIQLTPGESSKTWGRSSVVPKEEGEE 586

Query: 536 EDLSSSKKKGRTWGPSSTHQKERVGGED 563
           |.  . ||||||||| .  |||   |..
Sbjct: 587 EEKRAPKKKGRTWGPGTLGQKELASGDE 614

>hg18||uc001hvt
        |1|NM_032435|Q5TCX8|M3KL4_HUMAN|KIAA1804|NM_032435|NP_115811|mixed
        lineage kinase 4

          Length = 1036

 Score =  672 bits (1732), Expect = 9e-193
 Identities = 348/626 (55%), Positives = 441/626 (70%), Gaps = 32/626 (5%)

Query:   9 WTAVFDYEATADEELTLRRGDLLEVLSKDSKVSGDEGWWTGKIQDKVGIFPSNYVTKGDA 68
           | |..||||  ..||.|||| |.||||.|. |||||||| |..| ..||||.|||     
Sbjct:  43 WAALYDYEARGEDELSLRRGQLVEVLSQDAAVSGDEGWWAGQVQRRLGIFPANYVAPCRP 102

Query:  69 ANYKQXXXXXXXXXXXXECPLEIDFLELHLEEVIGAGGFGKVYKGMWRNEEVAVKAARQD 128
           |                  |. . |  | |.|.|||||||.||.  |. .||||||||||
Sbjct: 103 A------ASPAPPPSRPSSPVHVAFERLELKELIGAGGFGQVYRATWQGQEVAVKAARQD 156

Query: 129 PDEDISATAESVRQEARLFWMLQHRNIIALRGVCLREPNLCLVMEYXXXXXXXXXXX--- 185
           |..| .| |||||.||||| ||.| ||| ||||||..|.||||.|.              
Sbjct: 157 PEQDAAAAAESVRREARLFAMLRHPNIIELRGVCLQQPHLCLVLEFARGGALNRALAAAN 216

Query: 186 ------------XKKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLE 233
                        ...|| |||||||||| || ||| .|||||.||||||||||.|| .|
Sbjct: 217 AAPDPRAPGPRRARRIPPHVLVNWAVQIARGMLYLHEEAFVPILHRDLKSSNILLLEEIE 276

Query: 234 RLSLGSKTLKITDFGLAREWHQTTKMSAAGTYAWMAPEVIKLSLFSKSSDVWSFGVLLWE 293
              . .|||||||||||||||.||||| ||||||||||||| ||||| ||.|| ||||||
Sbjct: 277 HDDICNKTLKITDFGLAREWHRTTKMSTAGTYAWMAPEVIKSSLFSKGSDIWSCGVLLWE 336

Query: 294 LLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILR 353
           ||||||||| || ||||||||.||||||||||||||||.|..|||  .|| ||||  || 
Sbjct: 337 LLTGEVPYRGIDGLAVAYGVAVNKLTLPIPSTCPEPFAKLMKECWQQDPHIRPSFALILE 396

Query: 354 QLLAIEQSAMFQMPLESFHSLQEDWRLEIQQMFDELRAKEKELRSWXXXXXXXXXXXXXX 413
           || ||| . | .|| |||||.|.||.||||||||||| |||||||               
Sbjct: 397 QLTAIEGAVMTEMPQESFHSMQDDWKLEIQQMFDELRTKEKELRSREEELTRAALQQKSQ 456

Query: 414 XXXXXXXXXXXXXXXIDIVERELNIIIHQVYQEKPSVKKRKGHFKKSRLLKLGRDSNCIS 473
                          ||..||||||.| |. |||| |||||| ||.|| ||| .| . ||
Sbjct: 457 EELLKRREQQLAEREIDVLERELNILIFQLNQEKPKVKKRKGKFKRSR-LKL-KDGHRIS 514

Query: 474 LPSGFEHKITVQASPKVDKRKPQGSESTTPPASPGVIPRLRAIRLTPTDGSKTWGRSAVC 533
           ||| |.||||||||| .|||.   | |..||.|| ..||||||.||  . .|||||. | 
Sbjct: 515 LPSDFQHKITVQASPNLDKRRSLNSSSSSPPSSPTMMPRLRAIQLTSDESNKTWGRNTVF 574

Query: 534 KKEDLS----SSKKKGRTWGPSSTHQKERVGGEDKLKSLGEGCKVWSSSAPNLGKSPKHA 589
           ..|.      . |||| ||||.|   |.|   ..... | .|   ||.    | |. |  
Sbjct: 575 RQEEFEDVKRNFKKKGCTWGPNSIQMKDRTDCKERIRPLSDGNSPWSTI---LIKNQKTM 631

Query: 590 PMTAGFSSLNEMEECCDPEESPGSLQ 615
           |. . |  ...   | .|. ||  |.
Sbjct: 632 PLASLF--VDQPGSCEEPKLSPDGLE 655

>hg18||uc001oew
        |11|NM_002419|Q16584|M3K11_HUMAN|MAP3K11|NM_002419|NP_002410|mitogen-ac
        tivated protein kinase kinase kinase

          Length = 847

 Score =  540 bits (1390), Expect = 4e-153
 Identities = 278/476 (58%), Positives = 335/476 (70%), Gaps = 6/476 (1%)

Query:  88 PLEI-DFLELHLEEVIGAGGFGKVYKGMWRNEEVAVKAARQDPDEDISATAESVRQEARL 146
           | |.  | || |||||| |||||||.| || | ||||||||||||||| |||||||||||
Sbjct: 108 PCEVASFQELRLEEVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARL 167

Query: 147 FWMLQHRNIIALRGVCLREPNLCLVMEYXXXXXXXXXXXXKKVPPKVLVNWAVQIAAGMD 206
           | || | |||||. ||| ||||||||||            ..||| |||||||||| || 
Sbjct: 168 FAMLAHPNIIALKAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMH 227

Query: 207 YLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQTTKMSAAGTYA 266
           ||| .| ||.|||||||.|||.|.|.|   .  |||||||||||||||.||.||||||||
Sbjct: 228 YLHCEALVPVIHRDLKSNNILLLQPIESDDMEHKTLKITDFGLAREWHKTTQMSAAGTYA 287

Query: 267 WMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTC 326
           |||||||| | ||| ||||||||||||||||||||| || ||||||||.|||||||||||
Sbjct: 288 WMAPEVIKASTFSKGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTC 347

Query: 327 PEPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQSAMFQMPLESFHSLQEDWRLEIQQMF 386
           |||||||. .||. .|| || | |||.|| |.|   . .|| .||||.|| |. ||| .|
Sbjct: 348 PEPFAQLMADCWAQDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLF 407

Query: 387 DELRAKEKELRSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDIVERELNIIIHQVYQE 446
           |||||||||| |                              ... |||| ... || .|
Sbjct: 408 DELRAKEKELLSREEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRE 467

Query: 447 KPSVKKRKGHFKKSRLLKLGRDSNCISLPSGFEHKITVQASPKVDKRKPQGSESTTPPAS 506
           .| |..|.| ||.|. |.       ||.|  |.|.||||||| .|.|.   .     |  
Sbjct: 468 RPHVRRRRGTFKRSK-LRARDGGERISMPLDFKHRITVQASPGLDRRR---NVFEVGPGD 523

Query: 507 PGVIPRLRAIRLTPTDGSKTWGRSAVCKKEDLSSSKKKG-RTWGPSSTHQKERVGG 561
               || |||.| | .  . ||| .  . || |. ...    |||||    |   |
Sbjct: 524 SPTFPRFRAIQLEPAEPGQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNG 579

>hg18||uc001hvs |1|AJ311797|Q5TCX8-2|Q5TCX8-2|KIAA1804|NM_032435|NP_115811|mixed
        lineage kinase 4

          Length = 570

 Score =  442 bits (1136), Expect = 1e-123
 Identities = 222/331 (67%), Positives = 260/331 (78%), Gaps = 2/331 (0%)

Query: 187 KKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITD 246
           ...|| |||||||||| || ||| .|||||.||||||||||.|| .|   . .|||||||
Sbjct: 230 RRIPPHVLVNWAVQIARGMLYLHEEAFVPILHRDLKSSNILLLEKIEHDDICNKTLKITD 289

Query: 247 FGLAREWHQTTKMSAAGTYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDA 306
           ||||||||.||||| ||||||||||||| ||||| ||.||.||||||||||||||| || 
Sbjct: 290 FGLAREWHRTTKMSTAGTYAWMAPEVIKSSLFSKGSDIWSYGVLLWELLTGEVPYRGIDG 349

Query: 307 LAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQSAMFQM 366
           ||||||||.||||||||||||||||.|..|||  .|| ||||  || || ||| . | .|
Sbjct: 350 LAVAYGVAVNKLTLPIPSTCPEPFAKLMKECWQQDPHIRPSFALILEQLTAIEGAVMTEM 409

Query: 367 PLESFHSLQEDWRLEIQQMFDELRAKEKELRSWXXXXXXXXXXXXXXXXXXXXXXXXXXX 426
           | |||||.|.||.||||||||||| |||||||                            
Sbjct: 410 PQESFHSMQDDWKLEIQQMFDELRTKEKELRSREEELTRAALQQKSQEELLKRREQQLAE 469

Query: 427 XXIDIVERELNIIIHQVYQEKPSVKKRKGHFKKSRLLKLGRDSNCISLPSGFEHKITVQA 486
             ||..||||||.| |. |||| |||||| ||.|| ||| .| . ||||| |.|||||||
Sbjct: 470 REIDVLERELNILIFQLNQEKPKVKKRKGKFKRSR-LKL-KDGHRISLPSDFQHKITVQA 527

Query: 487 SPKVDKRKPQGSESTTPPASPGVIPRLRAIR 517
           || .|||.   | |..||.|| ..||||||.
Sbjct: 528 SPNLDKRRSLNSSSSSPPSSPTMMPRLRAIQ 558

>hg18||uc001xmk |14|BX648924|NA|NA|MAP3K9|NM_033141|NP_149132|mitogen-activated
        protein kinase kinase kinase

          Length = 837

 Score =  343 bits (879), Expect = 7e-094
 Identities = 174/272 (63%), Positives = 207/272 (76%), Gaps = 3/272 (1%)

Query: 259 MSAAGTYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKL 318
           |||||||||||||||. |.||| |||||.|||||||||||||.| || ||||||||||||
Sbjct:   1 MSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKL 60

Query: 319 TLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQSAMFQMPLESFHSLQEDW 378
            ||||||||||||.|.|.||.|.||||||||.|| ||  ||.|  |.|| .||| ||..|
Sbjct:  61 ALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEESGFFEMPKDSFHCLQDNW 120

Query: 379 RLEIQQMFDELRAKEKELRSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDIVERELNI 438
           . |||.|||.|||||||||.|                             |||.||||||
Sbjct: 121 KHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILERELNI 180

Query: 439 IIHQVYQEKPSVKKRKGHFKKSRLLKLGRDSNCISLPSGFEHKITVQASPKVDKRKPQGS 498
           ||||. |||| |||||| |.||| ||| .| | ||||| |.|| |||||| .||||   .
Sbjct: 181 IIHQLCQEKPRVKKRKGKFRKSR-LKL-KDGNRISLPSDFQHKFTVQASPTMDKRKSLIN 238

Query: 499 ESTTPPASPGVIPRLRAIRLTPTDGSKTWGRS 530
             ..||||| .|||||||.   |    .||..
Sbjct: 239 SRSSPPASPTIIPRLRAIQ-CETVSQISWGQN 269

>hg18||uc003fpi
        |3|NM_004721|O43283|M3K13_HUMAN|MAP3K13|NM_004721|NP_004712|mitogen-act
        ivated protein kinase kinase kinase

          Length = 966

 Score =  210 bits (532), Expect = 1e-053
 Identities = 105/245 (42%), Positives = 158/245 (64%), Gaps = 14/245 (5%)

Query: 150 LQHRNIIALRGVCLREPNLCLVMEY-XXXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYL 208
           |.| |||| .||| . |  |..|||             .|. |..||.|.  ||.||.||
Sbjct: 211 LKHPNIIAFKGVCTQAPCYCIIMEYCAHGQLYEVLRAGRKITPRLLVDWSTGIASGMNYL 270

Query: 209 HNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREW-HQTTKMSAAGTYAW 267
           |      |||||||| |.|.          .  .||.||| ..|   ..|||| ||| ||
Sbjct: 271 H---LHKIIHRDLKSPNVLVTH--------TDAVKISDFGTSKELSDKSTKMSFAGTVAW 319

Query: 268 MAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCP 327
           ||||||.    |.  |.|||||.||||||||.||...|. |. .||  | | ||.|||||
Sbjct: 320 MAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSTCP 379

Query: 328 EPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQSAMFQMPLESFHSLQEDWRLEIQQMFD 387
           . |  |... |   | .||||   |   | |  . .   | |..   | .|| |... |.
Sbjct: 380 DGFKILMKQTWQSKPRNRPSFRQTLMH-LDIASADVLATPQETYFKSQAEWREEVKKHFE 438

Query: 388 ELRAK 392
           .....
Sbjct: 439 KIKSE 443

>hg18||uc001sdm
        |12|NM_006301|Q12852|M3K12_HUMAN|MAP3K12|NM_006301|NP_006292|mitogen-ac
        tivated protein kinase kinase kinase

          Length = 859

 Score =  205 bits (521), Expect = 2e-052
 Identities = 106/245 (43%), Positives = 155/245 (63%), Gaps = 14/245 (5%)

Query: 150 LQHRNIIALRGVCLREPNLCLVMEY-XXXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYL 208
           |.| |||  .||| . |  |..||.             . | | .||.|.. || ||.||
Sbjct: 168 LKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYL 227

Query: 209 HNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREW-HQTTKMSAAGTYAW 267
           |      |||||||| |.||             .||.||| ..|   ..|||| ||| ||
Sbjct: 228 H---LHKIIHRDLKSPNMLITY--------DDVVKISDFGTSKELSDKSTKMSFAGTVAW 276

Query: 268 MAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCP 327
           ||||||.    |.  |.|||||.||||||||.||...|. |. .||  | | ||.||.||
Sbjct: 277 MAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCP 336

Query: 328 EPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQSAMFQMPLESFHSLQEDWRLEIQQMFD 387
           . |  || .||.  | .||||  ||   | |  . .   | |..   | .|| |..  |.
Sbjct: 337 DGFKILLRQCWNSKPRNRPSFRQILLH-LDIASADVLSTPQETYFKSQAEWREEVKLHFE 395

Query: 388 ELRAK 392
           .....
Sbjct: 396 KIKSE 400

>hg18||uc001sdn
        |12|AK094195|Q12852|M3K12_HUMAN|MAP3K12|NM_006301|NP_006292|mitogen-act
        ivated protein kinase kinase kinase

          Length = 892

 Score =  205 bits (521), Expect = 2e-052
 Identities = 106/245 (43%), Positives = 155/245 (63%), Gaps = 14/245 (5%)

Query: 150 LQHRNIIALRGVCLREPNLCLVMEY-XXXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYL 208
           |.| |||  .||| . |  |..||.             . | | .||.|.. || ||.||
Sbjct: 201 LKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYL 260

Query: 209 HNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREW-HQTTKMSAAGTYAW 267
           |      |||||||| |.||             .||.||| ..|   ..|||| ||| ||
Sbjct: 261 H---LHKIIHRDLKSPNMLITY--------DDVVKISDFGTSKELSDKSTKMSFAGTVAW 309

Query: 268 MAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCP 327
           ||||||.    |.  |.|||||.||||||||.||...|. |. .||  | | ||.||.||
Sbjct: 310 MAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCP 369

Query: 328 EPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQSAMFQMPLESFHSLQEDWRLEIQQMFD 387
           . |  || .||.  | .||||  ||   | |  . .   | |..   | .|| |..  |.
Sbjct: 370 DGFKILLRQCWNSKPRNRPSFRQILLH-LDIASADVLSTPQETYFKSQAEWREEVKLHFE 428

Query: 388 ELRAK 392
           .....
Sbjct: 429 KIKSE 433

>hg18||uc002uhy
        |2|NM_133646|Q9NYL2-2|Q9NYL2-2|ZAK|NM_133646|NP_598407|MLK-related
        kinase isoform 2

          Length = 455

 Score =  201 bits (509), Expect = 6e-051
 Identities = 115/313 (36%), Positives = 167/313 (53%), Gaps = 25/313 (7%)

Query:  89 LEIDFLELHLEEVIGAGGFGKVYKGMW--RNEEVAVKAARQDPDEDISATAESVRQEARL 146
           ..| | .|   |  | | || ||.  |  ...|||||   .            . .|| .
Sbjct:   9 VQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLK------------IEKEAEI 56

Query: 147 FWMLQHRNIIALRGVCLREPNLCLVMEYXXXXX---XXXXXXXKKVPPKVLVNWAVQIAA 203
             .| |||||   || |  ||  .| ||               ...    .. ||  .| 
Sbjct:  57 LSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAK 116

Query: 204 GMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQTTKMSAAG 263
           || ||| .| | .||||||| |..|             ||| ||| .|  . || ||  |
Sbjct: 117 GMHYLHMEAPVKVIHRDLKSRNVVI--------AADGVLKICDFGASRFHNHTTHMSLVG 168

Query: 264 TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIP 323
           |. |||||||.    |.. | .|.||.|||.|| |||.. .. | ||. |      | ||
Sbjct: 169 TFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIP 228

Query: 324 STCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQSAMFQMPLESFHSLQEDWRLEIQ 383
           |.||  ||.|| .||  .   ||||  |.  | ..           ||   . .|| ||.
Sbjct: 229 SSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIE 288

Query: 384 QMFDELRAKEKEL 396
              . |.  |..|
Sbjct: 289 ATLERLKKLERDL 301

>hg18||uc002uhz
        |2|NM_016653|Q9NYL2|MLTK_HUMAN|ZAK|NM_016653|NP_057737|MLK-related
        kinase isoform 1

          Length = 800

 Score =  201 bits (509), Expect = 6e-051
 Identities = 115/313 (36%), Positives = 167/313 (53%), Gaps = 25/313 (7%)

Query:  89 LEIDFLELHLEEVIGAGGFGKVYKGMW--RNEEVAVKAARQDPDEDISATAESVRQEARL 146
           ..| | .|   |  | | || ||.  |  ...|||||   .            . .|| .
Sbjct:   9 VQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLK------------IEKEAEI 56

Query: 147 FWMLQHRNIIALRGVCLREPNLCLVMEYXXXXX---XXXXXXXKKVPPKVLVNWAVQIAA 203
             .| |||||   || |  ||  .| ||               ...    .. ||  .| 
Sbjct:  57 LSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAK 116

Query: 204 GMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQTTKMSAAG 263
           || ||| .| | .||||||| |..|             ||| ||| .|  . || ||  |
Sbjct: 117 GMHYLHMEAPVKVIHRDLKSRNVVI--------AADGVLKICDFGASRFHNHTTHMSLVG 168

Query: 264 TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIP 323
           |. |||||||.    |.. | .|.||.|||.|| |||.. .. | ||. |      | ||
Sbjct: 169 TFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIP 228

Query: 324 STCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQSAMFQMPLESFHSLQEDWRLEIQ 383
           |.||  ||.|| .||  .   ||||  |.  | ..           ||   . .|| ||.
Sbjct: 229 SSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIE 288

Query: 384 QMFDELRAKEKEL 396
              . |.  |..|
Sbjct: 289 ATLERLKKLERDL 301

>hg18||uc002uia |2|CR598198|NA|NA|ZAK|NM_133646|NP_598407|MLK-related kinase
        isoform 2

          Length = 347

 Score =  201 bits (509), Expect = 6e-051
 Identities = 115/313 (36%), Positives = 167/313 (53%), Gaps = 25/313 (7%)

Query:  89 LEIDFLELHLEEVIGAGGFGKVYKGMW--RNEEVAVKAARQDPDEDISATAESVRQEARL 146
           ..| | .|   |  | | || ||.  |  ...|||||   .            . .|| .
Sbjct:   9 VQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLK------------IEKEAEI 56

Query: 147 FWMLQHRNIIALRGVCLREPNLCLVMEYXXXXX---XXXXXXXKKVPPKVLVNWAVQIAA 203
             .| |||||   || |  ||  .| ||               ...    .. ||  .| 
Sbjct:  57 LSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAK 116

Query: 204 GMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQTTKMSAAG 263
           || ||| .| | .||||||| |..|             ||| ||| .|  . || ||  |
Sbjct: 117 GMHYLHMEAPVKVIHRDLKSRNVVI--------AADGVLKICDFGASRFHNHTTHMSLVG 168

Query: 264 TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIP 323
           |. |||||||.    |.. | .|.||.|||.|| |||.. .. | ||. |      | ||
Sbjct: 169 TFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIP 228

Query: 324 STCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQSAMFQMPLESFHSLQEDWRLEIQ 383
           |.||  ||.|| .||  .   ||||  |.  | ..           ||   . .|| ||.
Sbjct: 229 SSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIE 288

Query: 384 QMFDELRAKEKEL 396
              . |.  |..|
Sbjct: 289 ATLERLKKLERDL 301

>hg18||uc001hvs |1|AJ311797|Q5TCX8-2|Q5TCX8-2|KIAA1804|NM_032435|NP_115811|mixed
        lineage kinase 4

          Length = 570

 Score =  192 bits (487), Expect = 2e-048
 Identities = 92/166 (55%), Positives = 123/166 (74%), Gaps = 6/166 (3%)

Query:   9 WTAVFDYEATADEELTLRRGDLLEVLSKDSKVSGDEGWWTGKIQDKVGIFPSNYVTKGDA 68
           | |..||||  ..||.|||| |.||||.|. |||||||| |..| ..||||.|||     
Sbjct:  43 WAALYDYEARGEDELSLRRGQLVEVLSQDAAVSGDEGWWAGQVQRRLGIFPANYVAPCRP 102

Query:  69 ANYKQXXXXXXXXXXXXECPLEIDFLELHLEEVIGAGGFGKVYKGMWRNEEVAVKAARQD 128
           |                  |. . |  | |.|.|||||||.||.  |. .||||||||||
Sbjct: 103 A------ASPAPPPSRPSSPVHVAFERLELKELIGAGGFGQVYRATWQGQEVAVKAARQD 156

Query: 129 PDEDISATAESVRQEARLFWMLQHRNIIALRGVCLREPNLCLVMEY 174
           |..| .| |||||.||||| ||.| ||| ||||||..|.||||.|.
Sbjct: 157 PEQDAAAAAESVRREARLFAMLRHPNIIELRGVCLQQPHLCLVLEF 202

>hg18||uc002uhx
        |2|AF465843|Q9NYL2-3|Q9NYL2-3|ZAK|NM_133646|NP_598407|MLK-related
        kinase isoform 2

          Length = 312

 Score =  191 bits (483), Expect = 6e-048
 Identities = 110/296 (37%), Positives = 157/296 (53%), Gaps = 25/296 (8%)

Query:  89 LEIDFLELHLEEVIGAGGFGKVYKGMW--RNEEVAVKAARQDPDEDISATAESVRQEARL 146
           ..| | .|   |  | | || ||.  |  ...|||||   .            . .|| .
Sbjct:   9 VQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLK------------IEKEAEI 56

Query: 147 FWMLQHRNIIALRGVCLREPNLCLVMEYXXXXX---XXXXXXXKKVPPKVLVNWAVQIAA 203
             .| |||||   || |  ||  .| ||               ...    .. ||  .| 
Sbjct:  57 LSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAK 116

Query: 204 GMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQTTKMSAAG 263
           || ||| .| | .||||||| |..|             ||| ||| .|  . || ||  |
Sbjct: 117 GMHYLHMEAPVKVIHRDLKSRNVVI--------AADGVLKICDFGASRFHNHTTHMSLVG 168

Query: 264 TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIP 323
           |. |||||||.    |.. | .|.||.|||.|| |||.. .. | ||. |      | ||
Sbjct: 169 TFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIP 228

Query: 324 STCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQSAMFQMPLESFHSLQEDWR 379
           |.||  ||.|| .||  .   ||||  |.  | ..           ||   . .||
Sbjct: 229 SSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWR 284

>hg18||uc003fph |3|BC031677|NA|NA|LZK|NA|NA|Homo sapiens mRNA for leucine zipper
        bearing kinase, complete cds

          Length = 207

 Score =  177 bits (447), Expect = 9e-044
 Identities = 89/202 (44%), Positives = 129/202 (63%), Gaps = 13/202 (6%)

Query: 187 KKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITD 246
           .|. |..||.|.  ||.||.|||      |||||||| |.|.          .  .||.|
Sbjct:  17 RKITPRLLVDWSTGIASGMNYLH---LHKIIHRDLKSPNVLVTH--------TDAVKISD 65

Query: 247 FGLAREW-HQTTKMSAAGTYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREID 305
           || ..|   ..|||| ||| ||||||||.    |.  |.|||||.||||||||.||...|
Sbjct:  66 FGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVD 125

Query: 306 ALAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAIEQSAMFQ 365
           . |. .||  | | ||.|||||. |  |... |   | .||||   |   | |  . .  
Sbjct: 126 SSAIIWGVGSNSLHLPVPSTCPDGFKILMKQTWQSKPRNRPSFRQTLMH-LDIASADVLA 184

Query: 366 MPLESFHSLQEDWRLEIQQMFD 387
            | |..   |  |    | . .
Sbjct: 185 TPQETYFKSQVSWETSYQVLLN 206

>hg18||uc001dge
        |1|AB208941|Q59H18|TNI3K_HUMAN|TNNI3K|NA|NA|Serine/threonine-protein
        kinase TNNI3K (EC 2.7.11.1) (TNNI3- interacting kinase) (Cardiac
        ankyrin repeat kinase)

          Length = 936

 Score =  139 bits (348), Expect = 3e-032
 Identities = 88/270 (32%), Positives = 138/270 (51%), Gaps = 21/270 (7%)

Query:  95 ELHLEEVIGAGGFGKVYKGMWRNEEVAVKAARQDPDEDISATAESVRQEARLFWMLQHRN 154
           |.   |.||.| |||||||  ||. ||.|  | .      .  .   .|  .   | |  
Sbjct: 563 EIEFHEIIGSGSFGKVYKGRCRNKIVAIKRYRAN-TYCSKSDVDMFCREVSILCQLNHPC 621

Query: 155 IIALRGVCLREPN-LCLVMEYXXXXXXXXXXXXKK----VPPKVLVNWAVQIAAGMDYLH 209
           .|   | || .|.   .| .|            .|    .  |...  || .| ||.|||
Sbjct: 622 VIQFVGACLNDPSQFAIVTQYISGGSLFSLLHEQKRILDLQSKLII--AVDVAKGMEYLH 679

Query: 210 NQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAR---EWHQTTKMSAAGTYA 266
           |    ||||||| | |||. |    .        . ||| .|      .       |   
Sbjct: 680 NLT-QPIIHRDLNSHNILLYEDGHAV--------VADFGESRFLQSLDEDNMTKQPGNLR 730

Query: 267 WMAPEVI-KLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPST 325
           ||||||  . . ..  .||.|. . |||.||||.|.  .   | |  .| . .  ||  .
Sbjct: 731 WMAPEVFTQCTRYTIKADVFSYALCLWEILTGEIPFAHLKPAAAAADMAYHHIRPPIGYS 790

Query: 326 CPEPFAQLLEECWSPNPHSRPSFTSILRQL 355
            |.| . ||   |.  |  || |. .. .|
Sbjct: 791 IPKPISSLLIRGWNACPEGRPEFSEVVMKL 820

>hg18||uc001dgf |1|NM_015978|Q59H18-2|Q59H18-2|TNNI3K|NM_015978|NP_057062|TNNI3
        interacting kinase

          Length = 835

 Score =  139 bits (348), Expect = 3e-032
 Identities = 88/270 (32%), Positives = 138/270 (51%), Gaps = 21/270 (7%)

Query:  95 ELHLEEVIGAGGFGKVYKGMWRNEEVAVKAARQDPDEDISATAESVRQEARLFWMLQHRN 154
           |.   |.||.| |||||||  ||. ||.|  | .      .  .   .|  .   | |  
Sbjct: 462 EIEFHEIIGSGSFGKVYKGRCRNKIVAIKRYRAN-TYCSKSDVDMFCREVSILCQLNHPC 520

Query: 155 IIALRGVCLREPN-LCLVMEYXXXXXXXXXXXXKK----VPPKVLVNWAVQIAAGMDYLH 209
           .|   | || .|.   .| .|            .|    .  |...  || .| ||.|||
Sbjct: 521 VIQFVGACLNDPSQFAIVTQYISGGSLFSLLHEQKRILDLQSKLII--AVDVAKGMEYLH 578

Query: 210 NQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAR---EWHQTTKMSAAGTYA 266
           |    ||||||| | |||. |    .        . ||| .|      .       |   
Sbjct: 579 NLT-QPIIHRDLNSHNILLYEDGHAV--------VADFGESRFLQSLDEDNMTKQPGNLR 629

Query: 267 WMAPEVI-KLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPST 325
           ||||||  . . ..  .||.|. . |||.||||.|.  .   | |  .| . .  ||  .
Sbjct: 630 WMAPEVFTQCTRYTIKADVFSYALCLWEILTGEIPFAHLKPAAAAADMAYHHIRPPIGYS 689

Query: 326 CPEPFAQLLEECWSPNPHSRPSFTSILRQL 355
            |.| . ||   |.  |  || |. .. .|
Sbjct: 690 IPKPISSLLIRGWNACPEGRPEFSEVVMKL 719

>hg18||uc003vij |7|NM_000245|P08581|MET_HUMAN|MET|NM_000245|NP_000236|met
        proto-oncogene precursor

          Length = 1390

 Score =  131 bits (328), Expect = 6e-030
 Identities = 90/280 (32%), Positives = 137/280 (48%), Gaps = 30/280 (10%)

Query:   94 LELHLEEVIGAGGFGKVYKGMWRNEE-----VAVKAARQDPDEDISATAESVRQEARLFW 148
            | .|  |||| | || || |   . .      |||.  .  |            |  .  
Sbjct: 1076 LIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITD---IGEVSQFLTEGIIMK 1132

Query:  149 MLQHRNIIALRGVCLR-EPNLCLVMEYXXXXXXXXXXXXKKVPPKV--LVNWAVQIAAGM 205
               | |...| |.||| | .  .|. |            .   | |  |. . .|.| ||
Sbjct: 1133 DFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGM 1192

Query:  206 DYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQT------TKM 259
             || .. ||   |||| . | .. |          |.|. ||||||. .         | 
Sbjct: 1193 KYLASKKFV---HRDLAARNCMLDEKF--------TVKVADFGLARDMYDKEYYSVHNKT 1241

Query:  260 SAAGTYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPYREIDALAVAYGVAMNKL 318
             |     ||| | ..   |.  |||||||||||||.| |  || ...   .   .   . 
Sbjct: 1242 GAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRR 1301

Query:  319 TLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAI 358
             |  |  ||.|  ... .|| |    ||||. .. .. ||
Sbjct: 1302 LLQ-PEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAI 1340

>hg18||uc003cxy
        |3|NM_002447|Q04912|RON_HUMAN|MST1R|NM_002447|NP_002438|macrophage
        stimulating 1 receptor

          Length = 1400

 Score =  129 bits (324), Expect = 2e-029
 Identities = 90/274 (32%), Positives = 138/274 (50%), Gaps = 30/274 (10%)

Query:   97 HLEEVIGAGGFGKVYKGMWRNE-----EVAVKAARQDPDEDISATAESVRQEARLFWMLQ 151
            | . ||| | || || | . ..     . |.|.  .  .       |.  .|  |   | 
Sbjct: 1083 HSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITE---MQQVEAFLREGLLMRGLN 1139

Query:  152 HRNIIALRGVCLRE---PNLCLVMEYXXXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYL 208
            | |..|| |. |     |.. |                .    | |... .|.| ||.||
Sbjct: 1140 HPNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARGMEYL 1199

Query:  209 HNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLARE------WHQTTKMSAA 262
              | ||   |||| . | .. |        | |.|. ||||||.      .       | 
Sbjct: 1200 AEQKFV---HRDLAARNCMLDE--------SFTVKVADFGLARDILDREYYSVQQHRHAR 1248

Query:  263 GTYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPYREIDALAVAYGVAMNKLTLP 321
                ||| | ..   |.  ||||||||||||||| |  ||| ||   . . .|  .  ||
Sbjct: 1249 LPVKWMALESLQTYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGR-RLP 1307

Query:  322 IPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQL 355
             |  ||.   |....||  .|  ||.|  .. ..
Sbjct: 1308 QPEYCPDSLYQVMQQCWEADPAVRPTFRVLVGEV 1341

>hg18||uc002ggj |17|AK225403|Q13470-2|Q13470-2|TNK1|NM_003985|NP_003976|tyrosine
        kinase, non-receptor, 1

          Length = 661

 Score =  126 bits (314), Expect = 2e-028
 Identities = 82/267 (30%), Positives = 129/267 (48%), Gaps = 28/267 (10%)

Query: 100 EVIGAGGFGKVYKGMW-----RNEEVAVKAARQDPDEDISATAESVRQEARLFWMLQHRN 154
           |..|.| || |..|.|     ..  ||||. |  |.  .        .|  .   |.| .
Sbjct: 120 ELLGSGCFGVVHRGLWTLPSGKSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPH 179

Query: 155 IIALRGVCLREPNLCLVMEYXXXXXXXXXXXXKKVPPKVLVN----WAVQIAAGMDYLHN 210
           .. | |. | .| | .|||                 | .||     .  |.|  | ||  
Sbjct: 180 VLRLHGLVLGQP-LQMVMELAPLGSLHARLTAPAPTPPLLVALLCLFLRQLAGAMAYLGA 238

Query: 211 QAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQTTKMSAAG-----TY 265
           .    ..|||| . |.|.  |        .|.|. |||| |           |      |
Sbjct: 239 RG---LVHRDLATRNLLLASP--------RTIKVADFGLVRPLGGARGRYVMGGPRPIPY 287

Query: 266 AWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPYREIDALAVAYGVAMNKLTLPIPS 324
           || ||| ..   || .|||| ||| |||. . || |.  .    .   .  ..  || | 
Sbjct: 288 AWCAPESLRHGAFSSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLE-DRARLPRPP 346

Query: 325 TCPEPFAQLLEECWSPNPHSRPSFTSI 351
            |      |   ||.|.|  ||||. .
Sbjct: 347 LCSRALYSLALRCWAPHPADRPSFSHL 373

>hg18||uc002tue |2|NM_025052|Q56UN5|YSK4_HUMAN|YSK4|NM_025052|NP_079328|Yeast
        Sps1/Ste20-related kinase 4 isoform 1

          Length = 1328

 Score =  118 bits (294), Expect = 5e-026
 Identities = 76/261 (29%), Positives = 129/261 (49%), Gaps = 12/261 (4%)

Query:  100 EVIGAGGFGKVYKGMW-RNEEVAVKAARQDPDEDISATAE--SVRQEARLFWMLQHRNII 156
            |..| | .| || |.  . . .|||    |    ..|  |   ...|  |   |.| ||.
Sbjct: 1065 EILGKGAYGTVYCGLTSQGQLIAVKQVALDTSNKLAAEKEYRKLQEEVDLLKALKHVNIV 1124

Query:  157 ALRGVCLREPNLCLVMEYX-XXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQAFVP 215
            |  | ||.|  . . ||.               .|  |   .  ||  |. |||      
Sbjct: 1125 AYLGTCLQENTVSIFMEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENC--- 1181

Query:  216 IIHRDLKSSNILILEP--LERLSLGSKTLKITDFGLAREWHQTTKMSAAGTYAWMAPEVI 273
            ..|||.| .|....    .. .  |    ..   ||    |     |  ||  |||||||
Sbjct: 1182 VVHRDIKGNNVMLMPTGIIKLIDFGC-ARRLAWAGL-NGTHSDMLKSMHGTPYWMAPEVI 1239

Query:  274 KLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNK-LTLPIPSTCPEPFAQ 332
              | . . ||.|| |  ..|. ||. |   .| .|  . .  .. |  |.|    |  | 
Sbjct: 1240 NESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAAD 1299

Query:  333 LLEECWSPNPHSRPSFTSILR 353
             .  | . . | |||   .|.
Sbjct: 1300 FVRMCLTRDQHERPSALQLLK 1320

>hg18||uc002tuf
        |2|NM_001018046|Q56UN5-5|Q56UN5-5|YSK4|NM_001018046|NP_001018056|Yeast
        Sps1/Ste20-related kinase 4 isoform 2

          Length = 510

 Score =  118 bits (294), Expect = 5e-026
 Identities = 76/261 (29%), Positives = 129/261 (49%), Gaps = 12/261 (4%)

Query: 100 EVIGAGGFGKVYKGMW-RNEEVAVKAARQDPDEDISATAE--SVRQEARLFWMLQHRNII 156
           |..| | .| || |.  . . .|||    |    ..|  |   ...|  |   |.| ||.
Sbjct: 247 EILGKGAYGTVYCGLTSQGQLIAVKQVALDTSNKLAAEKEYRKLQEEVDLLKALKHVNIV 306

Query: 157 ALRGVCLREPNLCLVMEYX-XXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQAFVP 215
           |  | ||.|  . . ||.               .|  |   .  ||  |. |||      
Sbjct: 307 AYLGTCLQENTVSIFMEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENC--- 363

Query: 216 IIHRDLKSSNILILEP--LERLSLGSKTLKITDFGLAREWHQTTKMSAAGTYAWMAPEVI 273
           ..|||.| .|....    .. .  |    ..   ||    |     |  ||  |||||||
Sbjct: 364 VVHRDIKGNNVMLMPTGIIKLIDFGC-ARRLAWAGL-NGTHSDMLKSMHGTPYWMAPEVI 421

Query: 274 KLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNK-LTLPIPSTCPEPFAQ 332
             | . . ||.|| |  ..|. ||. |   .| .|  . .  .. |  |.|    |  | 
Sbjct: 422 NESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAAD 481

Query: 333 LLEECWSPNPHSRPSFTSILR 353
            .  | . . | |||   .|.
Sbjct: 482 FVRMCLTRDQHERPSALQLLK 502

>hg18||uc002ggi
        |17|NM_003985|Q13470|TNK1_HUMAN|TNK1|NM_003985|NP_003976|tyrosine
        kinase, non-receptor, 1

          Length = 666

 Score =  117 bits (293), Expect = 6e-026
 Identities = 79/267 (29%), Positives = 126/267 (47%), Gaps = 28/267 (10%)

Query: 100 EVIGAGGFGKVYKGMW-----RNEEVAVKAARQDPDEDISATAESVRQEARLFWMLQHRN 154
           |..|.| || |..|.|     ..  ||||. |  |.  .        .|  .   |.| .
Sbjct: 120 ELLGSGCFGVVHRGLWTLPSGKSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPH 179

Query: 155 IIALRGVCLREPNLCLVMEYXXXXXXXXXXXXKKVPPKVLVN----WAVQIAAGMDYLHN 210
           .. | |. | .| | .|||                 | .||     .  |.|  | ||  
Sbjct: 180 VLRLHGLVLGQP-LQMVMELAPLGSLHARLTAPAPTPPLLVALLCLFLRQLAGAMAYLGA 238

Query: 211 QAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQTTKMSAAG-----TY 265
           .    ..|||| . |. .  |        .|.|. |||| |           |      |
Sbjct: 239 RG---LVHRDLATRNLQLASP--------RTIKVADFGLVRPLGGARGRYVMGGPRPIPY 287

Query: 266 AWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPYREIDALAVAYGVAMNKLTLPIPS 324
            | ||| ..   || .|||| ||| |||. . || |.  .    .   .  ..  || | 
Sbjct: 288 TWCAPESLRHGAFSSASDVWMFGVTLWEMFSGGEEPWPGVPPYLILQRLE-DRARLPRPP 346

Query: 325 TCPEPFAQLLEECWSPNPHSRPSFTSI 351
                   |   ||.|.|  ||||. .
Sbjct: 347 PSSRALYSLALRCWAPHPADRPSFSHL 373

>hg18||uc001vnm
        |13|NM_003576|Q9Y6E0|STK24_HUMAN|STK24|NM_003576|NP_003567|serine/threo
        nine kinase 24 (STE20 homolog,

          Length = 443

 Score =  109 bits (271), Expect = 2e-023
 Identities = 74/258 (28%), Positives = 122/258 (47%), Gaps = 19/258 (7%)

Query: 100 EVIGAGGFGKVYKGMWRNEE--VAVKAARQDPDEDISATAESVRQEARLFWMLQHRNIIA 157
           | || | ||.|.||.    .  ||.|    .  ||     | ..||  .        .  
Sbjct:  40 EKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAED---EIEDIQQEITVLSQCDSPYVTK 96

Query: 158 LRGVCLREPNLCLVMEYXXXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQAFVPII 217
             |  |..  | ..|||              .    .     .|  |.||||..     |
Sbjct:  97 YYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSE---KKI 153

Query: 218 HRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQT--TKMSAAGTYAWMAPEVIKL 275
           |||.|..|.|. |  |        .|. |||.| .   |   . .  ||  |||||||| 
Sbjct: 154 HRDIKAANVLLSEHGE--------VKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQ 205

Query: 276 SLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLE 335
           | .   .|.|| |.   ||  || |. |.  . | . .  |     .     .|  . .|
Sbjct: 206 SAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNN-PPTLEGNYSKPLKEFVE 264

Query: 336 ECWSPNPHSRPSFTSILR 353
            | .  |  ||.   .|.
Sbjct: 265 ACLNKEPSFRPTAKELLK 282

>hg18||uc001vnn
        |13|NM_001032296|Q9Y6E0-2|Q9Y6E0-2|STK24|NM_001032296|NP_001027467|seri
        ne/threonine kinase 24 (STE20 homolog,

          Length = 431

 Score =  109 bits (271), Expect = 2e-023
 Identities = 74/258 (28%), Positives = 122/258 (47%), Gaps = 19/258 (7%)

Query: 100 EVIGAGGFGKVYKGMWRNEE--VAVKAARQDPDEDISATAESVRQEARLFWMLQHRNIIA 157
           | || | ||.|.||.    .  ||.|    .  ||     | ..||  .        .  
Sbjct:  28 EKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAED---EIEDIQQEITVLSQCDSPYVTK 84

Query: 158 LRGVCLREPNLCLVMEYXXXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQAFVPII 217
             |  |..  | ..|||              .    .     .|  |.||||..     |
Sbjct:  85 YYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSE---KKI 141

Query: 218 HRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQT--TKMSAAGTYAWMAPEVIKL 275
           |||.|..|.|. |  |        .|. |||.| .   |   . .  ||  |||||||| 
Sbjct: 142 HRDIKAANVLLSEHGE--------VKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQ 193

Query: 276 SLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLE 335
           | .   .|.|| |.   ||  || |. |.  . | . .  |     .     .|  . .|
Sbjct: 194 SAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNN-PPTLEGNYSKPLKEFVE 252

Query: 336 ECWSPNPHSRPSFTSILR 353
            | .  |  ||.   .|.
Sbjct: 253 ACLNKEPSFRPTAKELLK 270

>hg18||uc002tuh |2|AK131216|Q56UN5-3|Q56UN5-3|YSK4|NM_025052|NP_079328|Yeast
        Sps1/Ste20-related kinase 4 isoform 1

          Length = 1035

 Score =  108 bits (268), Expect = 5e-023
 Identities = 71/245 (28%), Positives = 120/245 (48%), Gaps = 12/245 (4%)

Query:  100 EVIGAGGFGKVYKGMW-RNEEVAVKAARQDPDEDISATAE--SVRQEARLFWMLQHRNII 156
            |..| | .| || |.  . . .|||    |    ..|  |   ...|  |   |.| ||.
Sbjct:  793 EILGKGAYGTVYCGLTSQGQLIAVKQVALDTSNKLAAEKEYRKLQEEVDLLKALKHVNIV 852

Query:  157 ALRGVCLREPNLCLVMEYX-XXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQAFVP 215
            |  | ||.|  . . ||.               .|  |   .  ||  |. |||      
Sbjct:  853 AYLGTCLQENTVSIFMEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENC--- 909

Query:  216 IIHRDLKSSNILILEP--LERLSLGSKTLKITDFGLAREWHQTTKMSAAGTYAWMAPEVI 273
            ..|||.| .|....    .. .  |    ..   ||    |     |  ||  |||||||
Sbjct:  910 VVHRDIKGNNVMLMPTGIIKLIDFGC-ARRLAWAGL-NGTHSDMLKSMHGTPYWMAPEVI 967

Query:  274 KLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNK-LTLPIPSTCPEPFAQ 332
              | . . ||.|| |  ..|. ||. |   .| .|  . .  .. |  |.|    |  | 
Sbjct:  968 NESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAAD 1027

Query:  333 LLEEC 337
             .  |
Sbjct: 1028 FVRMC 1032

>hg18||uc002wbm
        |2|X99325|O00506|STK25_HUMAN|STK25|NM_006374|NP_006365|serine/threonine
        kinase 25

          Length = 426

 Score =  108 bits (268), Expect = 5e-023
 Identities = 75/256 (29%), Positives = 120/256 (46%), Gaps = 19/256 (7%)

Query: 102 IGAGGFGKVYKGM--WRNEEVAVKAARQDPDEDISATAESVRQEARLFWMLQHRNIIALR 159
           || | ||.||||.     | ||.|    .  ||     | ..||  .        |    
Sbjct:  26 IGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAED---EIEDIQQEITVLSQCDSPYITRYF 82

Query: 160 GVCLREPNLCLVMEYXXXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHR 219
           |  |.   | ..|||              .    .     .|  |.||||..     |||
Sbjct:  83 GSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSER---KIHR 139

Query: 220 DLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQT--TKMSAAGTYAWMAPEVIKLSL 277
           |.|..|.|. |           .|. |||.| .   |   . .  ||  |||||||| | 
Sbjct: 140 DIKAANVLLSE--------QGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSA 191

Query: 278 FSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEEC 337
           .   .|.|| |.   ||  || |  ..  . | . .  |     .     .|| . .| |
Sbjct: 192 YDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNS-PPTLEGQHSKPFKEFVEAC 250

Query: 338 WSPNPHSRPSFTSILR 353
            . .|  ||.   .|.
Sbjct: 251 LNKDPRFRPTAKELLK 266

>hg18||uc002wbn
        |2|CR614826|O00506|STK25_HUMAN|STK25|NM_006374|NP_006365|serine/threoni
        ne kinase 25

          Length = 426

 Score =  108 bits (268), Expect = 5e-023
 Identities = 75/256 (29%), Positives = 120/256 (46%), Gaps = 19/256 (7%)

Query: 102 IGAGGFGKVYKGM--WRNEEVAVKAARQDPDEDISATAESVRQEARLFWMLQHRNIIALR 159
           || | ||.||||.     | ||.|    .  ||     | ..||  .        |    
Sbjct:  26 IGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAED---EIEDIQQEITVLSQCDSPYITRYF 82

Query: 160 GVCLREPNLCLVMEYXXXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHR 219
           |  |.   | ..|||              .    .     .|  |.||||..     |||
Sbjct:  83 GSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSER---KIHR 139

Query: 220 DLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQT--TKMSAAGTYAWMAPEVIKLSL 277
           |.|..|.|. |           .|. |||.| .   |   . .  ||  |||||||| | 
Sbjct: 140 DIKAANVLLSE--------QGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSA 191

Query: 278 FSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEEC 337
           .   .|.|| |.   ||  || |  ..  . | . .  |     .     .|| . .| |
Sbjct: 192 YDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNS-PPTLEGQHSKPFKEFVEAC 250

Query: 338 WSPNPHSRPSFTSILR 353
            . .|  ||.   .|.
Sbjct: 251 LNKDPRFRPTAKELLK 266

>hg18||uc002wbp
        |2|NM_006374|O00506|STK25_HUMAN|STK25|NM_006374|NP_006365|serine/threon
        ine kinase 25

          Length = 426

 Score =  108 bits (268), Expect = 5e-023
 Identities = 75/256 (29%), Positives = 120/256 (46%), Gaps = 19/256 (7%)

Query: 102 IGAGGFGKVYKGM--WRNEEVAVKAARQDPDEDISATAESVRQEARLFWMLQHRNIIALR 159
           || | ||.||||.     | ||.|    .  ||     | ..||  .        |    
Sbjct:  26 IGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAED---EIEDIQQEITVLSQCDSPYITRYF 82

Query: 160 GVCLREPNLCLVMEYXXXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHR 219
           |  |.   | ..|||              .    .     .|  |.||||..     |||
Sbjct:  83 GSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSER---KIHR 139

Query: 220 DLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQT--TKMSAAGTYAWMAPEVIKLSL 277
           |.|..|.|. |           .|. |||.| .   |   . .  ||  |||||||| | 
Sbjct: 140 DIKAANVLLSE--------QGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSA 191

Query: 278 FSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEEC 337
           .   .|.|| |.   ||  || |  ..  . | . .  |     .     .|| . .| |
Sbjct: 192 YDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNS-PPTLEGQHSKPFKEFVEAC 250

Query: 338 WSPNPHSRPSFTSILR 353
            . .|  ||.   .|.
Sbjct: 251 LNKDPRFRPTAKELLK 266

>hg18||uc001fqg
        |1|NM_014215|P14616|INSRR_HUMAN|INSRR|NM_014215|NP_055030|insulin
        receptor-related receptor precursor

          Length = 1297

 Score =  102 bits (254), Expect = 2e-021
 Identities = 64/164 (39%), Positives = 87/164 (53%), Gaps = 17/164 (10%)

Query:  194 LVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREW 253
            ..  | .|| || ||    ||   |||| . | .. .          |.|| |||. |. 
Sbjct: 1092 MIQMAGEIADGMAYLAANKFV---HRDLAARNCMVSQDF--------TVKIGDFGMTRDV 1140

Query:  254 HQTTKMSAAG----TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPYREIDALA 308
            ..|      |       ||||| .|  .|.  ||||||||.|||..|  | ||. .    
Sbjct: 1141 YETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQ 1200

Query:  309 VAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSIL 352
            |   | |.   |     ||    .|.  || |||  ||||| ||
Sbjct: 1201 VLKFV-MDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHIL 1243

>hg18||uc004ewk
        |X|NM_016542|Q9P289|MST4_HUMAN|MST4|NM_016542|NP_057626|serine/threonin
        e protein kinase MST4 isoform 1

          Length = 416

 Score =  102 bits (254), Expect = 2e-021
 Identities = 71/266 (26%), Positives = 122/266 (45%), Gaps = 19/266 (7%)

Query: 100 EVIGAGGFGKVYKGMWRNEE--VAVKAARQDPDEDISATAESVRQEARLFWMLQHRNIIA 157
           | || | ||.|.||.    .  ||.|    .  ||     | ..||  .        .  
Sbjct:  28 ERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAED---EIEDIQQEITVLSQCDSSYVTK 84

Query: 158 LRGVCLREPNLCLVMEYXXXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQAFVPII 217
             |  |.   | ..|||                   .     .|  |.||||..     |
Sbjct:  85 YYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSE---KKI 141

Query: 218 HRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQT--TKMSAAGTYAWMAPEVIKL 275
           |||.|..|.|. |           .|. |||.| .   |   . .  ||  |||||||. 
Sbjct: 142 HRDIKAANVLLSE--------QGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQ 193

Query: 276 SLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLE 335
           | .   .|.|| |.   ||  || |  ..  . | . .  |     .     . | . ..
Sbjct: 194 SAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNN-PPTLVGDFTKSFKEFID 252

Query: 336 ECWSPNPHSRPSFTSILRQLLAIEQS 361
            | . .|  ||.   .|.    .. |
Sbjct: 253 ACLNKDPSFRPTAKELLKHKFIVKNS 278

>hg18||uc002bul
        |15|NM_000875|P08069|IGF1R_HUMAN|IGF1R|NM_000875|NP_000866|insulin-like
        growth factor 1 receptor precursor

          Length = 1367

 Score =  102 bits (252), Expect = 4e-021
 Identities = 64/173 (36%), Positives = 90/173 (52%), Gaps = 19/173 (10%)

Query:  190 PPKV--LVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDF 247
            || .  ..  | .|| || ||.   ||   |||| . | .. |          |.|| ||
Sbjct: 1106 PPSLSKMIQMAGEIADGMAYLNANKFV---HRDLAARNCMVAEDF--------TVKIGDF 1154

Query:  248 GLAREWHQTTKMSAAG----TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPYR 302
            |. |. ..|      |       ||.|| .|  .|.  ||||||||.|||. |  | ||.
Sbjct: 1155 GMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQ 1214

Query:  303 EIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQL 355
             .    |   |    | |  |  ||.   .|.  ||  ||  ||||  |.  .
Sbjct: 1215 GLSNEQVLRFVMEGGL-LDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSI 1266

>hg18||uc002mgd |19|NM_000208|P06213|INSR_HUMAN|INSR|NM_000208|NP_000199|insulin
        receptor isoform Long precursor

          Length = 1382

 Score =  101 bits (249), Expect = 8e-021
 Identities = 64/173 (36%), Positives = 91/173 (52%), Gaps = 19/173 (10%)

Query:  190 PPKV--LVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDF 247
            || .  ..  | .|| || ||. . ||   |||| . | ..            |.|| ||
Sbjct: 1130 PPTLQEMIQMAAEIADGMAYLNAKKFV---HRDLAARNCMVAHDF--------TVKIGDF 1178

Query:  248 GLAREWHQTTKMSAAG----TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPYR 302
            |. |. ..|      |       ||||| .|  .|. |||.|||||.|||. .  | ||.
Sbjct: 1179 GMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQ 1238

Query:  303 EIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQL 355
             .    |   | |.   |  |  |||    |.  ||  ||  ||.|  |.  |
Sbjct: 1239 GLSNEQVLKFV-MDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLL 1290

>hg18||uc002mge
        |19|NM_001079817|Q17RW0|Q17RW0_HUMAN|INSR|NM_001079817|NP_001073285|ins
        ulin receptor isoform Short precursor

          Length = 1370

 Score =  101 bits (249), Expect = 8e-021
 Identities = 64/173 (36%), Positives = 91/173 (52%), Gaps = 19/173 (10%)

Query:  190 PPKV--LVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDF 247
            || .  ..  | .|| || ||. . ||   |||| . | ..            |.|| ||
Sbjct: 1118 PPTLQEMIQMAAEIADGMAYLNAKKFV---HRDLAARNCMVAHDF--------TVKIGDF 1166

Query:  248 GLAREWHQTTKMSAAG----TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPYR 302
            |. |. ..|      |       ||||| .|  .|. |||.|||||.|||. .  | ||.
Sbjct: 1167 GMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQ 1226

Query:  303 EIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQL 355
             .    |   | |.   |  |  |||    |.  ||  ||  ||.|  |.  |
Sbjct: 1227 GLSNEQVLKFV-MDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLL 1278

>hg18||uc002jbe
        |17|AX775741|Q8N3I9|Q8N3I9_HUMAN|MAP3K3|NM_203351|NP_976226|mitogen-act
        ivated protein kinase kinase kinase 3

          Length = 657

 Score =  99 bits (244), Expect = 3e-020
 Identities = 82/265 (30%), Positives = 121/265 (45%), Gaps = 25/265 (9%)

Query: 100 EVIGAGGFGKVY--KGMWRNEEVAVKAARQDPDE-DISATAESVRQEARLFWMLQHRNII 156
           ...| | ||.||    .    |.| |  . |||  . |    ..  | .|   |||  |.
Sbjct: 397 KLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIV 456

Query: 157 ALRGVCLR---EPNLCLVMEYX-XXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQA 212
              | |||   |  | . |||               .   |   .  ||  || |||.  
Sbjct: 457 QYYG-CLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNM 515

Query: 213 FVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQ-----TTKMSAAGTYAW 267
              |.|||.| .|||      | | |.  .|. ||| ..         |   |  ||  |
Sbjct: 516 ---IVHRDIKGANIL------RDSAGN--VKLGDFGASKRLQTICMSGTGMRSVTGTPYW 564

Query: 268 MAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCP 327
           |.||||    . . .|||| |  . |.|| . |. | .|.|  . .|       .||   
Sbjct: 565 MSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHIS 624

Query: 328 EPFAQLLEECWSPNPHSRPSFTSIL 352
           |     |   .      |||   .|
Sbjct: 625 EHGRDFLRRIF-VEARQRPSAEELL 648

>hg18||uc002jbf
        |17|NM_203351|Q8N3I9|Q8N3I9_HUMAN|MAP3K3|NM_203351|NP_976226|mitogen-ac
        tivated protein kinase kinase kinase 3

          Length = 657

 Score =  99 bits (244), Expect = 3e-020
 Identities = 82/265 (30%), Positives = 121/265 (45%), Gaps = 25/265 (9%)

Query: 100 EVIGAGGFGKVY--KGMWRNEEVAVKAARQDPDE-DISATAESVRQEARLFWMLQHRNII 156
           ...| | ||.||    .    |.| |  . |||  . |    ..  | .|   |||  |.
Sbjct: 397 KLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIV 456

Query: 157 ALRGVCLR---EPNLCLVMEYX-XXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQA 212
              | |||   |  | . |||               .   |   .  ||  || |||.  
Sbjct: 457 QYYG-CLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNM 515

Query: 213 FVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQ-----TTKMSAAGTYAW 267
              |.|||.| .|||      | | |.  .|. ||| ..         |   |  ||  |
Sbjct: 516 ---IVHRDIKGANIL------RDSAGN--VKLGDFGASKRLQTICMSGTGMRSVTGTPYW 564

Query: 268 MAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCP 327
           |.||||    . . .|||| |  . |.|| . |. | .|.|  . .|       .||   
Sbjct: 565 MSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHIS 624

Query: 328 EPFAQLLEECWSPNPHSRPSFTSIL 352
           |     |   .      |||   .|
Sbjct: 625 EHGRDFLRRIF-VEARQRPSAEELL 648

>hg18||uc002jbg
        |17|NM_002401|Q96HN9|Q96HN9_HUMAN|MAP3K3|NM_002401|NP_002392|mitogen-ac
        tivated protein kinase kinase kinase 3

          Length = 626

 Score =  99 bits (244), Expect = 3e-020
 Identities = 82/265 (30%), Positives = 121/265 (45%), Gaps = 25/265 (9%)

Query: 100 EVIGAGGFGKVY--KGMWRNEEVAVKAARQDPDE-DISATAESVRQEARLFWMLQHRNII 156
           ...| | ||.||    .    |.| |  . |||  . |    ..  | .|   |||  |.
Sbjct: 366 KLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIV 425

Query: 157 ALRGVCLR---EPNLCLVMEYX-XXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQA 212
              | |||   |  | . |||               .   |   .  ||  || |||.  
Sbjct: 426 QYYG-CLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNM 484

Query: 213 FVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQ-----TTKMSAAGTYAW 267
              |.|||.| .|||      | | |.  .|. ||| ..         |   |  ||  |
Sbjct: 485 ---IVHRDIKGANIL------RDSAGN--VKLGDFGASKRLQTICMSGTGMRSVTGTPYW 533

Query: 268 MAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCP 327
           |.||||    . . .|||| |  . |.|| . |. | .|.|  . .|       .||   
Sbjct: 534 MSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHIS 593

Query: 328 EPFAQLLEECWSPNPHSRPSFTSIL 352
           |     |   .      |||   .|
Sbjct: 594 EHGRDFLRRIF-VEARQRPSAEELL 617

>hg18||uc002jbh
        |17|AK225784|Q8N3I9|Q8N3I9_HUMAN|MAP3K3|NM_203351|NP_976226|mitogen-act
        ivated protein kinase kinase kinase 3

          Length = 653

 Score =  99 bits (244), Expect = 3e-020
 Identities = 82/265 (30%), Positives = 121/265 (45%), Gaps = 25/265 (9%)

Query: 100 EVIGAGGFGKVY--KGMWRNEEVAVKAARQDPDE-DISATAESVRQEARLFWMLQHRNII 156
           ...| | ||.||    .    |.| |  . |||  . |    ..  | .|   |||  |.
Sbjct: 393 KLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIV 452

Query: 157 ALRGVCLR---EPNLCLVMEYX-XXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQA 212
              | |||   |  | . |||               .   |   .  ||  || |||.  
Sbjct: 453 QYYG-CLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNM 511

Query: 213 FVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQ-----TTKMSAAGTYAW 267
              |.|||.| .|||      | | |.  .|. ||| ..         |   |  ||  |
Sbjct: 512 ---IVHRDIKGANIL------RDSAGN--VKLGDFGASKRLQTICMSGTGMRSVTGTPYW 560

Query: 268 MAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCP 327
           |.||||    . . .|||| |  . |.|| . |. | .|.|  . .|       .||   
Sbjct: 561 MSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHIS 620

Query: 328 EPFAQLLEECWSPNPHSRPSFTSIL 352
           |     |   .      |||   .|
Sbjct: 621 EHGRDFLRRIF-VEARQRPSAEELL 644

>hg18||uc002jbi
        |17|DQ454151|Q1PBM3|Q1PBM3_HUMAN|MAP3K3|NM_002401|NP_002392|mitogen-act
        ivated protein kinase kinase kinase 3

          Length = 612

 Score =  99 bits (244), Expect = 3e-020
 Identities = 82/265 (30%), Positives = 121/265 (45%), Gaps = 25/265 (9%)

Query: 100 EVIGAGGFGKVY--KGMWRNEEVAVKAARQDPDE-DISATAESVRQEARLFWMLQHRNII 156
           ...| | ||.||    .    |.| |  . |||  . |    ..  | .|   |||  |.
Sbjct: 352 KLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIV 411

Query: 157 ALRGVCLR---EPNLCLVMEYX-XXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHNQA 212
              | |||   |  | . |||               .   |   .  ||  || |||.  
Sbjct: 412 QYYG-CLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNM 470

Query: 213 FVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQ-----TTKMSAAGTYAW 267
              |.|||.| .|||      | | |.  .|. ||| ..         |   |  ||  |
Sbjct: 471 ---IVHRDIKGANIL------RDSAGN--VKLGDFGASKRLQTICMSGTGMRSVTGTPYW 519

Query: 268 MAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCP 327
           |.||||    . . .|||| |  . |.|| . |. | .|.|  . .|       .||   
Sbjct: 520 MSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHIS 579

Query: 328 EPFAQLLEECWSPNPHSRPSFTSIL 352
           |     |   .      |||   .|
Sbjct: 580 EHGRDFLRRIF-VEARQRPSAEELL 603

>hg18||uc003xlp
        |8|NM_023110|P11362|FGFR1_HUMAN|FGFR1|NM_023110|NP_075598|fibroblast
        growth factor receptor 1 isoform 1

          Length = 822

 Score =  98 bits (242), Expect = 5e-020
 Identities = 67/204 (32%), Positives = 99/204 (48%), Gaps = 23/204 (11%)

Query: 187 KKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITD 246
           ...  | ||. | |.| ||.||   |    ||||| . |.|. |           .|| |
Sbjct: 593 EQLSSKDLVSCAYQVARGMEYL---ASKKCIHRDLAARNVLVTE--------DNVMKIAD 641

Query: 247 FGLAREWHQTT--KMSAAG--TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPY 301
           |||||. |     | .  |     ||||| .   ...  ||||||||||||. | |  ||
Sbjct: 642 FGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPY 701

Query: 302 REIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAI--- 358
             .  .   . .      .  || |      .. .||   |  ||.|  ..  |  |   
Sbjct: 702 PGV-PVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVAL 760

Query: 359 ---EQSAMFQMPLESFHSLQEDWR 379
              ..     |||. .     | |
Sbjct: 761 TSNQEYLDLSMPLDQYSPSFPDTR 784

>hg18||uc003xlq
        |8|NM_015850|P11362-7|P11362-7|FGFR1|NM_015850|NP_056934|fibroblast
        growth factor receptor 1 isoform 2

          Length = 820

 Score =  98 bits (242), Expect = 5e-020
 Identities = 67/204 (32%), Positives = 99/204 (48%), Gaps = 23/204 (11%)

Query: 187 KKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITD 246
           ...  | ||. | |.| ||.||   |    ||||| . |.|. |           .|| |
Sbjct: 591 EQLSSKDLVSCAYQVARGMEYL---ASKKCIHRDLAARNVLVTE--------DNVMKIAD 639

Query: 247 FGLAREWHQTT--KMSAAG--TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPY 301
           |||||. |     | .  |     ||||| .   ...  ||||||||||||. | |  ||
Sbjct: 640 FGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPY 699

Query: 302 REIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAI--- 358
             .  .   . .      .  || |      .. .||   |  ||.|  ..  |  |   
Sbjct: 700 PGV-PVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVAL 758

Query: 359 ---EQSAMFQMPLESFHSLQEDWR 379
              ..     |||. .     | |
Sbjct: 759 TSNQEYLDLSMPLDQYSPSFPDTR 782

>hg18||uc003xlr
        |8|NM_023106|P11362-6|P11362-6|FGFR1|NM_023106|NP_075594|fibroblast
        growth factor receptor 1 isoform 4

          Length = 731

 Score =  98 bits (242), Expect = 5e-020
 Identities = 67/204 (32%), Positives = 99/204 (48%), Gaps = 23/204 (11%)

Query: 187 KKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITD 246
           ...  | ||. | |.| ||.||   |    ||||| . |.|. |           .|| |
Sbjct: 502 EQLSSKDLVSCAYQVARGMEYL---ASKKCIHRDLAARNVLVTE--------DNVMKIAD 550

Query: 247 FGLAREWHQTT--KMSAAG--TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPY 301
           |||||. |     | .  |     ||||| .   ...  ||||||||||||. | |  ||
Sbjct: 551 FGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPY 610

Query: 302 REIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAI--- 358
             .  .   . .      .  || |      .. .||   |  ||.|  ..  |  |   
Sbjct: 611 PGV-PVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVAL 669

Query: 359 ---EQSAMFQMPLESFHSLQEDWR 379
              ..     |||. .     | |
Sbjct: 670 TSNQEYLDLSMPLDQYSPSFPDTR 693

>hg18||uc003xls
        |8|NM_023105|P11362-4|P11362-4|FGFR1|NM_023105|NP_075593|fibroblast
        growth factor receptor 1 isoform 3

          Length = 733

 Score =  98 bits (242), Expect = 5e-020
 Identities = 67/204 (32%), Positives = 99/204 (48%), Gaps = 23/204 (11%)

Query: 187 KKVPPKVLVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITD 246
           ...  | ||. | |.| ||.||   |    ||||| . |.|. |           .|| |
Sbjct: 504 EQLSSKDLVSCAYQVARGMEYL---ASKKCIHRDLAARNVLVTE--------DNVMKIAD 552

Query: 247 FGLAREWHQTT--KMSAAG--TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPY 301
           |||||. |     | .  |     ||||| .   ...  ||||||||||||. | |  ||
Sbjct: 553 FGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPY 612

Query: 302 REIDALAVAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQLLAI--- 358
             .  .   . .      .  || |      .. .||   |  ||.|  ..  |  |   
Sbjct: 613 PGV-PVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVAL 671

Query: 359 ---EQSAMFQMPLESFHSLQEDWR 379
              ..     |||. .     | |
Sbjct: 672 TSNQEYLDLSMPLDQYSPSFPDTR 695

>hg18||uc001xmk |14|BX648924|NA|NA|MAP3K9|NM_033141|NP_149132|mitogen-activated
        protein kinase kinase kinase

          Length = 837

 Score =  97 bits (241), Expect = 7e-020
 Identities = 57/124 (45%), Positives = 70/124 (56%), Gaps = 6/124 (4%)

Query: 518 LTPTDGSKTWGRSAVCKK-----EDLSSSKKKGRTWGPSSTHQKERVGGEDKLKSLGEGC 572
           ||| . |||||||.|  |     |.  . ||||||||| .  |||   |.. |||| .| 
Sbjct: 306 LTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWGPGTLGQKELASGDEGLKSLVDGY 365

Query: 573 KVWSSSAPNLGKSPKHAPMTAGFSSLNEMEECCDPEESPGSLQPSETSSNGAVDDSGSLW 632
           | |||||||| | |. .|   ||.|| ||         |  ..  |  | |       | 
Sbjct: 366 KQWSSSAPNLVKGPRSSPALPGFTSLMEMALLAASWVVPIDIEEDE-DSEGPGSGESRLQ 424

Query: 633 SSPS 636
            |||
Sbjct: 425 HSPS 428

>hg18||uc003lro
        |5|NM_002609|P09619|PGFRB_HUMAN|PDGFRB|NM_002609|NP_002600|platelet-der
        ived growth factor receptor beta

          Length = 1106

 Score =  97 bits (240), Expect = 9e-020
 Identities = 63/186 (33%), Positives = 94/186 (50%), Gaps = 19/186 (10%)

Query: 194 LVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREW 253
           || .. |.| ||..|   |    .|||| . |.|| |         | .|| ||||||. 
Sbjct: 803 LVGFSYQVANGMEFL---ASKNCVHRDLAARNVLICE--------GKLVKICDFGLARDI 851

Query: 254 HQTTKMSAAGT----YAWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPYREIDALA 308
            . .   . |.      ||||| |  ||..  |||||||.||||. | |  || |.    
Sbjct: 852 MRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNE 911

Query: 309 VAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTS---ILRQLLAIEQSAMFQ 365
             |        .  |.   .   .....||      || |.    .| .||       .|
Sbjct: 912 QFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQ 971

Query: 366 MPLESF 371
              | |
Sbjct: 972 QVDEEF 977

>hg18||uc001dgd
        |1|BC032865|Q59H18-4|Q59H18-4|TNNI3K|NA|NA|Serine/threonine-protein
        kinase TNNI3K (EC 2.7.11.1) (TNNI3- interacting kinase) (Cardiac
        ankyrin repeat kinase)

          Length = 843

 Score =  95 bits (235), Expect = 3e-019
 Identities = 63/181 (34%), Positives = 94/181 (51%), Gaps = 18/181 (9%)

Query: 198 AVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAR---EWH 254
           || .| ||.||||    ||||||| | |||. |    .        . ||| .|      
Sbjct: 668 AVDVAKGMEYLHNLT-QPIIHRDLNSHNILLYEDGHAV--------VADFGESRFLQSLD 718

Query: 255 QTTKMSAAGTYAWMAPEVI-KLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGV 313
           .       |   ||||||  . . ..  .||.|. . |||.||||.|.  .   | |  .
Sbjct: 719 EDNMTKQPGNLRWMAPEVFTQCTRYTIKADVFSYALCLWEILTGEIPFAHLKPAAAAADM 778

Query: 314 AMNKLTLPIPSTCPEPFAQLLEECWS--PNPHSRPS---FTSILRQLLAIEQSAMFQMPL 368
           | . .  ||  . |.| . ||   |.  |   ||||    .|.  . |  .    | | .
Sbjct: 779 AYHHIRPPIGYSIPKPISSLLIRGWNACPEAKSRPSHYPVSSVYTETLKKKNEDRFGMWI 838

Query: 369 E 369
           |
Sbjct: 839 E 839

>hg18||uc002toj
        |2|NM_006609|Q9Y2U5|M3K2_HUMAN|MAP3K2|NM_006609|NP_006600|mitogen-activ
        ated protein kinase kinase kinase

          Length = 619

 Score =  95 bits (235), Expect = 3e-019
 Identities = 79/270 (29%), Positives = 124/270 (45%), Gaps = 25/270 (9%)

Query:  98 LEEVIGAGGFGKVY--KGMWRNEEVAVKAARQDPDE-DISATAESVRQEARLFWMLQHRN 154
           | ...| | ||.||    .    |.|||  . |||  . |    ..  | .|   | |  
Sbjct: 358 LGKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHER 417

Query: 155 IIALRGVCLREP---NLCLVMEYX-XXXXXXXXXXXKKVPPKVLVNWAVQIAAGMDYLHN 210
           |.   | |||.|    | . |||               .   |   .  ||  |. |||.
Sbjct: 418 IVQYYG-CLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHS 476

Query: 211 QAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREWHQ-----TTKMSAAGTY 265
                |.|||.| .|||      | | |.  .|. ||| ..         |   |  || 
Sbjct: 477 NM---IVHRDIKGANIL------RDSTGN--VKLGDFGASKRLQTICLSGTGMKSVTGTP 525

Query: 266 AWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPST 325
            ||.||||    . . .|.||    . |.|| . |. | .|.|  . .|       .|  
Sbjct: 526 YWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPH 585

Query: 326 CPEPFAQLLEECWSPNPHSRPSFTSILRQL 355
             .     |.  .      |||   .|| .
Sbjct: 586 VSDYTRDFLKRIF-VEAKLRPSADELLRHM 614

>hg18||uc001oew
        |11|NM_002419|Q16584|M3K11_HUMAN|MAP3K11|NM_002419|NP_002410|mitogen-ac
        tivated protein kinase kinase kinase

          Length = 847

 Score =  94 bits (232), Expect = 8e-019
 Identities = 38/61 (62%), Positives = 51/61 (83%)

Query:   6 NPYWTAVFDYEATADEELTLRRGDLLEVLSKDSKVSGDEGWWTGKIQDKVGIFPSNYVTK 65
           || |||.|||| .  .|| ||.|| .||||.|. .||||||| |..  .|||||||||..
Sbjct:  43 NPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSR 102

Query:  66 G 66
           |
Sbjct: 103 G 103

>hg18||uc003pxp
        |6|NM_002944|Q5TDB5|Q5TDB5_HUMAN|ROS1|NM_002944|NP_002935|proto-oncogen
        e c-ros-1 protein precursor

          Length = 2347

 Score =  94 bits (232), Expect = 8e-019
 Identities = 62/167 (37%), Positives = 83/167 (49%), Gaps = 12/167 (7%)

Query:  194 LVNWAVQIAAGMDYLHNQAFVPIIHRDLKSSNILILEPLERLSLGSKTLKITDFGLAREW 253
            ||.  | |. |  ||    |   ||||| . | |.     .     . .|| ||||||. 
Sbjct: 2056 LVDLCVDISKGCVYLERMHF---IHRDLAARNCLV---SVKDYTSPRIVKIGDFGLARDI 2109

Query:  254 HQTTKMSAAG----TYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLT-GEVPYREIDALA 308
            ..       |       ||||| .   .|.  |||||||.|.||.|| |  ||     | 
Sbjct: 2110 YKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLD 2169

Query:  309 VAYGVAMNKLTLPIPSTCPEPFAQLLEECWSPNPHSRPSFTSILRQL 355
            |   |       | |  ||.    |. .||.  |  ||.|  |  ||
Sbjct: 2170 VLNYVQTGGRLEP-PRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQL 2215

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 189,995,008
Number of Sequences: 45480
Number of Extensions: 189995008
Number of Successful Extensions: 11053239
Number of sequences better than 0.0: 0
BLASTP 7.6.0