BLASTP 7.6.0


Query=fugu4_189355 |jgi|Takru4|189355|gw2.2.688.1
        (1230 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc004aib |9|NM_206944|Q9HCF6-4|Q9HCF6-4|TRPM3|NM_206944|NP...   1485   0.0
hg18||uc004ahy |9|NM_206947|Q9HCF6-7|Q9HCF6-7|TRPM3|NM_206947|NP...   1181   0.0
hg18||uc001zfm |15|NM_002420|Q7Z4N5|Q7Z4N5_HUMAN|TRPM1|NM_002420...   1085   0.0
hg18||uc004aic |9|AJ505026|Q9HCF6-10|Q9HCF6-10|TRPM3|NM_00100747...   1050   1e-306
hg18||uc004aid |9|NM_001007471|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_001007...   1050   1e-306
hg18||uc004aia |9|NM_020952|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_020952|NP...    952   5e-277
hg18||uc004ahu |9|AF536750|Q9HCF6-6|Q9HCF6-6|TRPM3|NM_024971|NP_...    923   4e-268
hg18||uc004ahz |9|NM_206945|Q9HCF6-5|Q9HCF6-5|TRPM3|NM_206945|NP...    847   2e-245
hg18||uc004ahw |9|NM_206946|Q9HCF6|TRPM3_HUMAN|TRPM3|NM_206946|N...    648   1e-185
hg18||uc001zfm |15|NM_002420|Q7Z4N5|Q7Z4N5_HUMAN|TRPM1|NM_002420...    632   8e-181
hg18||uc004ahx |9|NM_024971|Q9HCF6-3|Q9HCF6-3|TRPM3|NM_024971|NP...    629   1e-179
hg18||uc001zys |15|NM_017672|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|...    621   3e-177
hg18||uc001zyt |15|AY032950|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|N...    621   3e-177
hg18||uc004ahv |9|AB099665|Q9HCF6-8|Q9HCF6-8|TRPM3|NM_206944|NP_...    580   4e-165
hg18||uc004ahw |9|NM_206946|Q9HCF6|TRPM3_HUMAN|TRPM3|NM_206946|N...    580   4e-165
hg18||uc004ahx |9|NM_024971|Q9HCF6-3|Q9HCF6-3|TRPM3|NM_024971|NP...    580   4e-165
hg18||uc004ahz |9|NM_206945|Q9HCF6-5|Q9HCF6-5|TRPM3|NM_206945|NP...    580   4e-165
hg18||uc004aia |9|NM_020952|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_020952|NP...    580   4e-165
hg18||uc004aic |9|AJ505026|Q9HCF6-10|Q9HCF6-10|TRPM3|NM_00100747...    580   4e-165
hg18||uc004aid |9|NM_001007471|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_001007...    580   4e-165
hg18||uc004ajk |9|AY333284|Q9BX84-3|Q9BX84-3|TRPM6|NM_017662|NP_...    574   4e-163
hg18||uc004ajl |9|NM_017662|Q9BX84|TRPM6_HUMAN|TRPM6|NM_017662|N...    574   4e-163
hg18||uc004ahv |9|AB099665|Q9HCF6-8|Q9HCF6-8|TRPM3|NM_206944|NP_...    549   2e-155
hg18||uc001zys |15|NM_017672|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|...    536   8e-152
hg18||uc001zyt |15|AY032950|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|N...    536   8e-152
hg18||uc004aie |9|BC094699|Q504Y1|Q504Y1_HUMAN|TRPM3|NA|NA|TRPM3...    463   1e-129
hg18||uc004aig |9|NM_206948|Q5T8N8|Q5T8N8_HUMAN|TRPM3|NM_206948|...    406   9e-113
hg18||uc004aii |9|AL136545|Q5T2G1|Q5T2G1_HUMAN|TRPM3|NA|NA|Trans...    404   4e-112
hg18||uc001lwm |11|NM_014555|Q9NZQ8|Q9NZQ8_HUMAN|TRPM5|NM_014555...    370   7e-102
hg18||uc001zyu |15|BC051024|NA|NA|TRPM7|NM_017672|NP_060142|tran...    362   3e-099
hg18||uc004ahu |9|AF536750|Q9HCF6-6|Q9HCF6-6|TRPM3|NM_024971|NP_...    340   1e-092
hg18||uc002zet |21|AB166745|O94759|TRPM2_HUMAN|TRPM2|NM_003307|N...    334   8e-091
hg18||uc002zeu |21|AB001535|O94759|TRPM2_HUMAN|TRPM2|NM_003307|N...    334   8e-091
hg18||uc002zev |21|NM_001001188|O94759-3|O94759-3|TRPM2|NM_00100...    334   8e-091
hg18||uc002zew |21|NM_003307|O94759|TRPM2_HUMAN|TRPM2|NM_003307|...    334   8e-091
hg18||uc004ahx |9|NM_024971|Q9HCF6-3|Q9HCF6-3|TRPM3|NM_024971|NP...    332   3e-090
hg18||uc004ahw |9|NM_206946|Q9HCF6|TRPM3_HUMAN|TRPM3|NM_206946|N...    309   2e-083
hg18||uc004ahy |9|NM_206947|Q9HCF6-7|Q9HCF6-7|TRPM3|NM_206947|NP...    309   2e-083
hg18||uc004aif |9|NM_001007470|Q5T8N2|Q5T8N2_HUMAN|TRPM3|NM_0010...    309   2e-083
hg18||uc004ajn |9|AK057748|Q96LV9|Q96LV9_HUMAN|TRPM6|NA|NA|CDNA ...    284   5e-076
hg18||uc004ahu |9|AF536750|Q9HCF6-6|Q9HCF6-6|TRPM3|NM_024971|NP_...    247   1e-064
hg18||uc004ahv |9|AB099665|Q9HCF6-8|Q9HCF6-8|TRPM3|NM_206944|NP_...    247   1e-064
hg18||uc002pmw |19|NM_017636|Q8TD43|TRPM4_HUMAN|TRPM4|NM_017636|...    242   3e-063
hg18||uc004ajk |9|AY333284|Q9BX84-3|Q9BX84-3|TRPM6|NM_017662|NP_...    238   4e-062
hg18||uc004ajl |9|NM_017662|Q9BX84|TRPM6_HUMAN|TRPM6|NM_017662|N...    238   4e-062
hg18||uc004ajk |9|AY333284|Q9BX84-3|Q9BX84-3|TRPM6|NM_017662|NP_...    203   1e-051
hg18||uc004ajl |9|NM_017662|Q9BX84|TRPM6_HUMAN|TRPM6|NM_017662|N...    203   1e-051
hg18||uc004ajm |9|CR618713|NA|NA|CHAK2|NA|NA|Homo sapiens channe...    174   6e-043
hg18||uc004ajm |9|CR618713|NA|NA|CHAK2|NA|NA|Homo sapiens channe...    171   5e-042
hg18||uc001zyu |15|BC051024|NA|NA|TRPM7|NM_017672|NP_060142|tran...    144   1e-033
hg18||uc004ajk |9|AY333284|Q9BX84-3|Q9BX84-3|TRPM6|NM_017662|NP_...    131   7e-030
hg18||uc004ajl |9|NM_017662|Q9BX84|TRPM6_HUMAN|TRPM6|NM_017662|N...    131   7e-030
hg18||uc002vvh |2|NM_024080|Q3YFM7|Q3YFM7_HUMAN|TRPM8|NM_024080|...    119   4e-026
hg18||uc004ajj |9|AK225207|NA|NA|TRPM6|NM_017662|NP_060132|trans...    113   2e-024
hg18||uc002zet |21|AB166745|O94759|TRPM2_HUMAN|TRPM2|NM_003307|N...    107   2e-022
hg18||uc002zeu |21|AB001535|O94759|TRPM2_HUMAN|TRPM2|NM_003307|N...    107   2e-022
hg18||uc002zew |21|NM_003307|O94759|TRPM2_HUMAN|TRPM2|NM_003307|...    107   2e-022
hg18||uc002zex |21|AB166746|Q5KTC1|Q5KTC1_HUMAN|TRPM2|NM_003307|...    107   2e-022
hg18||uc002zey |21|AJ417076|NA|NA|TRPM2|NM_003307|NP_003298|tran...    107   2e-022
hg18||uc004aif |9|NM_001007470|Q5T8N2|Q5T8N2_HUMAN|TRPM3|NM_0010...    102   3e-021
hg18||uc004ahv |9|AB099665|Q9HCF6-8|Q9HCF6-8|TRPM3|NM_206944|NP_...    102   5e-021
hg18||uc001zfn |15|BC005892|Q6PE48|Q6PE48_HUMAN|TRPM1|NA|NA|TRPM...     87   1e-016
hg18||uc002zex |21|AB166746|Q5KTC1|Q5KTC1_HUMAN|TRPM2|NM_003307|...     87   2e-016
hg18||uc002zey |21|AJ417076|NA|NA|TRPM2|NM_003307|NP_003298|tran...     87   2e-016
hg18||uc002vvh |2|NM_024080|Q3YFM7|Q3YFM7_HUMAN|TRPM8|NM_024080|...     80   2e-014

>hg18||uc004aib
        |9|NM_206944|Q9HCF6-4|Q9HCF6-4|TRPM3|NM_206944|NP_996827|transient
        receptor potential cation channel,

          Length = 1544

 Score =  1485 bits (3843), Expect = 0.0
 Identities = 752/1157 (64%), Positives = 879/1157 (75%), Gaps = 33/1157 (2%)

Query:   92 MYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVT 151
            ||.|||.||||| ||||| |.|||||| ||||||||||||.|||||||||||||||||.|
Sbjct:    1 MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT 60

Query:  152 TGAWIFTGGVNTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQ 211
            |||||||||||||||||||||||||.||||||.| ||||||||.||.|||||.|| | ||
Sbjct:   61 TGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQ 120

Query:  212 SMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTRLGQGVPLV 271
            .|.||.||| |||| |||||| |||| ||||.|||||| |||||||||||||.|||||.|
Sbjct:  121 TMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVV 180

Query:  272 CLIVEGGPNVISIALESLRDEPPIPVVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQL 331
             |||||||||||| || ||| ||.||||||||||||||..| ||.||.|||.|. .|.||
Sbjct:  181 ALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQL 240

Query:  332 LVTIQKTFNYSKSQSQQILLMVMECMKKRELITVFRMGSEGQQDIEMAILTALLKGTNXX 391
            |||||||| |...|.| . ...||||||.|||||||||||| |||..||||||||| |  
Sbjct:  241 LVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANAS 300

Query:  392 XXXXXXXXXXWNRVDIARNHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIH 451
                      ||||||||. ||.||   || ||||||.||||||||||||||.||||..|
Sbjct:  301 APDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMH 360

Query:  452 HFLTIPRLEELYNTKLGPANTLNAVVRDVKKGNLPPDYQITLIDIGLVLECFMGGAYRSN 511
             |||| ||||||||. ||.|||  .|||||||||||||.|.|||||||.|  |||||| |
Sbjct:  361 RFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCN 420

Query:  512 YTRKAFRNLYNNLYGLKRPKALKLLGMEDDXXXXXXXXXXXXXXXXXXXXXXXXXXXCRF 571
            |||| || ||.||.| ||           |                             |
Sbjct:  421 YTRKRFRTLYHNLFGPKR-----------DDIPLRRGRKTTKKREEEVDIDLDDPEINHF 469

Query:  572 KFPFHELMLWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDISQD 631
             |||||||.||||||||||||| || |||||||||||||| |||||| ||...||||||.
Sbjct:  470 PFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQE 529

Query:  632 LENNSKEFGQLAYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAHTC 691
            | .||..||||| |||||||| |||.||||||||| ||||.|||.|||||| ||||||||
Sbjct:  530 LNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTC 589

Query:  692 SQMLLTDMWMGRLRIGKNPSLKVXXXXXXXXXXXXXXXXXXXDSSF--HAPXXXXXXXXX 749
            ||||||||||||||. ||  |||                   |  .   |          
Sbjct:  590 SQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEA 649

Query:  750 XDDTKSSKDP-------------NPDATSRRGDEEEGSANVRKIPIGKRFFEFYDAPFTK 796
             .  | .|.              |   .||. ||||  .  | ||.|.. .|||.||  |
Sbjct:  650 EEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVK 709

Query:  797 FWFNTISYLGYLMLYNYIILVKMERWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLK 856
            ||| |..|.|||||.|||.||||||||| ||||||||| ||| ||.|.  ||||||||| 
Sbjct:  710 FWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMRE--ILMSEPGKLL 767

Query:  857 QKISVWLEEYWNITDLAAICTFLLGLMLRLQQEPYMGYGRVIYCIDIIFWYIRVLDIFGV 916
            ||. |||.||||.||| ||  | .|..|||| .|.   ||||||..||.||||.||||||
Sbjct:  768 QKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGV 827

Query:  917 NKYLGPYVXXXXXXXXXXXYFVVIMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYW 976
            ||||||||           |||.||||||||||||||||| |.|||.|.||.||||||||
Sbjct:  828 NKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYW 887

Query:  977 MIYGEVFADSIDPPCGEHLYDEDGK--RLPPCIPGAWLTPAIMACYXXXXXXXXXXXXXX 1034
            ||||||||| ||||||..   ||||  .||||  |||. |||||||              
Sbjct:  888 MIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIA 947

Query: 1035 VFNNTFFEVKSISNQVWKFQRYQLIMTFHDRXXXXXXXXXXXXXXXXCNRMFRRCAKKKQ 1094
            |||||||||||||||||||||||||||||.|                   .   |  .| 
Sbjct:  948 VFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLC--CRWRKH 1005

Query: 1095 DGELDEKDRGLKLRLNPEELKILYEFEEQCVEEYFREKXXXXXXXXXXRIKVTSERVENM 1154
            . . ||.| |||| .  .||| ...|||||.|||||||          ||.|||||||||
Sbjct: 1006 ESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENM 1065

Query: 1155 FMRLEEVNERENTMKASLQTVDLRLAQLEEIHGRMAVALEKLAGVDRLELTRTYSRNSSV 1214
             ||||||||||..|||||||||.||||||.. |||| |||.| |..| |  .  || || 
Sbjct: 1066 SMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSD 1125

Query: 1215 C-DPSSLHRQGSINSAD 1230
            | | . . || | || .
Sbjct: 1126 CTDAAYIVRQSSFNSQE 1142

>hg18||uc004ahy
        |9|NM_206947|Q9HCF6-7|Q9HCF6-7|TRPM3|NM_206947|NP_996830|transient
        receptor potential cation channel,

          Length = 1569

 Score =  1181 bits (3054), Expect = 0.0
 Identities = 607/993 (61%), Positives = 721/993 (72%), Gaps = 33/993 (3%)

Query:  256 SLQKINTRLGQGVPLVCLIVEGGPNVISIALESLRDEPPIPVVVCDGSGRASDIISFAHK 315
            | |  .  .|||||.| |||||||||||| || ||| ||.||||||||||||||..| ||
Sbjct:  190 SCQLDSVGIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHK 249

Query:  316 FSEDGGLVNDDVREQLLVTIQKTFNYSKSQSQQILLMVMECMKKRELITVFRMGSEGQQD 375
            .||.|||.|. .|.|||||||||| |...|.| . ...||||||.|||||||||||| ||
Sbjct:  250 YSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQD 309

Query:  376 IEMAILTALLKGTNXXXXXXXXXXXXWNRVDIARNHIFVYGHNLPVNSLEQAMMDALVLD 435
            |..||||||||| |            ||||||||. ||.||   || ||||||.||||||
Sbjct:  310 IDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLD 369

Query:  436 RVDFVKLLLENGVNIHHFLTIPRLEELYNTKLGPANTLNAVVRDVKKGNLPPDYQITLID 495
            ||||||||.||||..| |||| ||||||||. ||.|||  .|||||||||||||.|.|||
Sbjct:  370 RVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLID 429

Query:  496 IGLVLECFMGGAYRSNYTRKAFRNLYNNLYGLKRPKALKLLGMEDDXXXXXXXXXXXXXX 555
            ||||.|  |||||| ||||| || ||.||.| ||           |              
Sbjct:  430 IGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKR-----------DDIPLRRGRKTTKKR 478

Query:  556 XXXXXXXXXXXXXCRFKFPFHELMLWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAM 615
                           | |||||||.||||||||||||| || |||||||||||||| |||
Sbjct:  479 EEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAM 538

Query:  616 AHECSESELVDDISQDLENNSKEFGQLAYELLDQSYKHDEQVAMKLLTYELVNWSNSTCL 675
            ||| ||...||||||.| .||..||||| |||||||| |||.||||||||| ||||.|||
Sbjct:  539 AHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCL 598

Query:  676 KLAVAAKQRDFIAHTCSQMLLTDMWMGRLRIGKNPSLKVXXXXXXXXXXXXXXXXXXXDS 735
            .|||||| ||||||||||||||||||||||. ||  |||                   | 
Sbjct:  599 QLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDM 658

Query:  736 SF--HAPXXXXXXXXXXDDTKSSKDP-------------NPDATSRRGDEEEGSANVRKI 780
             .   |           .  | .|.              |   .||. ||||  .  | |
Sbjct:  659 PYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLI 718

Query:  781 PIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNYIILVKMERWPSMQEWIVISYILTLGTE 840
            |.|.. .|||.||  |||| |..|.|||||.|||.||||||||| ||||||||| ||| |
Sbjct:  719 PLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIE 778

Query:  841 KVRQARILMSEPGKLKQKISVWLEEYWNITDLAAICTFLLGLMLRLQQEPYMGYGRVIYC 900
            |.|.  ||||||||| ||. |||.||||.||| ||  | .|..|||| .|.   ||||||
Sbjct:  779 KMRE--ILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYC 836

Query:  901 IDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVVIMLVVLMSFGVARQAILHPDE 960
            ..||.||||.||||||||||||||           |||.||||||||||||||||| |.|
Sbjct:  837 VNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNE 896

Query:  961 EPTWRLARNIFYMPYWMIYGEVFADSIDPPCGEHLYDEDGK--RLPPCIPGAWLTPAIMA 1018
            ||.|.||.||||||||||||||||| ||||||..   ||||  .||||  |||. |||||
Sbjct:  897 EPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMA 956

Query: 1019 CYXXXXXXXXXXXXXXVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRXXXXXXXXXXXXX 1078
            ||              |||||||||||||||||||||||||||||.|             
Sbjct:  957 CYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHM 1016

Query: 1079 XXXCNRMFRRCAKKKQDGELDEKDRGLKLRLNPEELKILYEFEEQCVEEYFREKXXXXXX 1138
                  .   |  .| . . ||.| |||| .  .||| ...|||||.|||||||      
Sbjct: 1017 TMIFQHLC--CRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNS 1074

Query: 1139 XXXXRIKVTSERVENMFMRLEEVNERENTMKASLQTVDLRLAQLEEIHGRMAVALEKLAG 1198
                ||.||||||||| ||||||||||..|||||||||.||||||.. |||| |||.| |
Sbjct: 1075 SNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTG 1134

Query: 1199 VDRLELTRTYSRNSSVC-DPSSLHRQGSINSAD 1230
            ..| |  .  || || | | . . || | || .
Sbjct: 1135 LERAESNKIRSRTSSDCTDAAYIVRQSSFNSQE 1167

>hg18||uc001zfm
        |15|NM_002420|Q7Z4N5|Q7Z4N5_HUMAN|TRPM1|NM_002420|NP_002411|transient
        receptor potential cation channel,

          Length = 1603

 Score =  1085 bits (2804), Expect = 0.0
 Identities = 553/817 (67%), Positives = 621/817 (76%), Gaps = 13/817 (1%)

Query:  421 VNSLEQAMMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTKLGPANTLNAVVRDV 480
            ||.|||||.||||||||||||||.|||||. ||||||||||||||.||| |||. .||||
Sbjct:  458 VNALEQAMLDALVLDRVDFVKLLIENGVNMQHFLTIPRLEELYNTRLGPPNTLHLLVRDV 517

Query:  481 KKGNLPPDYQITLIDIGLVLECFMGGAYRSNYTRKAFRNLYNNLYGLKRPKALKLLGMED 540
            || |||||| |.|||||||||  |||||| ||||| || |||||.| |||||||||||||
Sbjct:  518 KKSNLPPDYHISLIDIGLVLEYLMGGAYRCNYTRKNFRTLYNNLFGPKRPKALKLLGMED 577

Query:  541 DXXXXXXXXXXXXXXXXXXXXXXXXXXXCRFKFPFHELMLWAVLMKRQKMALFLWQRGEE 600
            |                            ||..||||||.|||||||||||.||||||||
Sbjct:  578 DEPPAKGKKKKKKKKEEEIDIDVDDPAVSRFQYPFHELMVWAVLMKRQKMAVFLWQRGEE 637

Query:  601 AMAKALVACKLYKAMAHECSESELVDDISQDLENNSKEFGQLAYELLDQSYKHDEQVAMK 660
            .||||||||||||||||| |||.|||||||||.||||.||||| ||||||||||||.|||
Sbjct:  638 SMAKALVACKLYKAMAHESSESDLVDDISQDLDNNSKDFGQLALELLDQSYKHDEQIAMK 697

Query:  661 LLTYELVNWSNSTCLKLAVAAKQRDFIAHTCSQMLLTDMWMGRLRIGKNPSLKVXXXXXX 720
            |||||| ||||||||||||||| ||||||||||||||||||||||. ||| |||      
Sbjct:  698 LLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILL 757

Query:  721 XXXXXXXXXXXXXDSSFHAPXXXXXXXXXXDDTKSSKDPNPDATSRRGDEEEGSANVRKI 780
                         | |.             .  . . | | || ||.||||      | |
Sbjct:  758 PPTILFLEFRTYDDFSYQ---TSKENEDGKEKEEENTDANADAGSRKGDEENEHKKQRSI 814

Query:  781 PIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNYIILVKMERWPSMQEWIVISYILTLGTE 840
            ||| .  |||.||  |||| ||||||||.|.||.|||.|. |||.|||||||||..|  |
Sbjct:  815 PIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWPSLQEWIVISYIVSLALE 874

Query:  841 KVRQARILMSEPGKLKQKISVWLEEYWNITDLAAICTFLLGLMLRLQQEPYMGYGRVIYC 900
            |.|.  ||||||||| ||| |||.|||||||| || ||..| .|||| .|||||||||||
Sbjct:  875 KIRE--ILMSEPGKLSQKIKVWLQEYWNITDLVAISTFMIGAILRLQNQPYMGYGRVIYC 932

Query:  901 IDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVVIMLVVLMSFGVARQAILHPDE 960
            .|||||||||||||||||||||||           |||||||||||||||||||||||.|
Sbjct:  933 VDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVVLMSFGVARQAILHPEE 992

Query:  961 EPTWRLARNIFYMPYWMIYGEVFADSID-------PPCGEHLYDEDGKRLPPCIPGAWLT 1013
            .|.|.|||||||||||||||||||| ||       |||||.||||.||||||||||||||
Sbjct:  993 KPSWKLARNIFYMPYWMIYGEVFADQIDLYAMEINPPCGENLYDEEGKRLPPCIPGAWLT 1052

Query: 1014 PAIMACYXXXXXXXXXXXXXXVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRXXXXXXXX 1073
            ||.||||              |||||||||||||||||||||||||||||||        
Sbjct: 1053 PALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPMI 1112

Query: 1074 XXXXXXXXCNRMFRRCAKKKQDGELDEKDRGLKLRLNPEELKILYEFEEQCVEEYFREKX 1133
                      |.  || .||..|. .|.|||||| |. |||| |.|||||||.|.|||| 
Sbjct: 1113 ILSHIYIIIMRLSGRC-RKKREGDQEERDRGLKLFLSDEELKRLHEFEEQCVQEHFREKE 1171

Query: 1134 XXXXXXXXXRIKVTSERVENMFMRLEEVNERENTMKASLQTVDLRLAQLEEIHGRMAVAL 1193
                     ||.||||||||| |||||.||||  || ||||||||||||||.  ||  ||
Sbjct: 1172 DEQQSSSDERIRVTSERVENMSMRLEEINERETFMKTSLQTVDLRLAQLEELSNRMVNAL 1231

Query: 1194 EKLAGVDRLELTRTYSRNSSVCDPSSLHRQGSINSAD 1230
            | |||.|| .| .  || || |. . | || ||||||
Sbjct: 1232 ENLAGIDRSDLIQARSRASSECEATYLLRQSSINSAD 1268

>hg18||uc004aic
        |9|AJ505026|Q9HCF6-10|Q9HCF6-10|TRPM3|NM_001007471|NP_001007472|transie
        nt receptor potential cation channel,

          Length = 1325

 Score =  1050 bits (2715), Expect = 1e-306
 Identities = 520/715 (72%), Positives = 592/715 (82%), Gaps = 5/715 (0%)

Query:   4 KVWIERNFLKRECIHIFP-TKDPTRCACGQLTTQHVAIPPGANSVE---ETIQLVQIDTP 59
           | |||| | ||||.|| | |||| || ||.|  ||| . |  . ..      .| . |  
Sbjct:  62 KSWIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQ 121

Query:  60 KDKWSIIKHTRTYPTDAFGVIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLELPT 119
            .|||| |||.  |||||| |||||||  |||||.|||.||||| ||||| |.|||||| 
Sbjct: 122 SEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPK 181

Query: 120 LLISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKDHSSK 179
           ||||||||||||.|||||||||||||||||.||||||||||||||||||||||||||.||
Sbjct: 182 LLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASK 241

Query: 180 SRGKVCAIGIAPWGILENKEDLIGKDVTRSYQSMANPLSKLAVLNSSHSHFILTDNGTCG 239
           ||||.| ||||||||.||.|||||.|| | ||.|.||.||| |||| |||||| |||| |
Sbjct: 242 SRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTG 301

Query: 240 KYGSEVKLRRLLEKHISLQKINTRLGQGVPLVCLIVEGGPNVISIALESLRDEPPIPVVV 299
           |||.|||||| |||||||||||||.|||||.| |||||||||||| || ||| ||.||||
Sbjct: 302 KYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVV 361

Query: 300 CDGSGRASDIISFAHKFSEDGGLVNDDVREQLLVTIQKTFNYSKSQSQQILLMVMECMKK 359
           ||||||||||..| ||.||.|||.|. .|.|||||||||| |...|.| . ...||||||
Sbjct: 362 CDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKK 421

Query: 360 RELITVFRMGSEGQQDIEMAILTALLKGTNXXXXXXXXXXXXWNRVDIARNHIFVYGHNL 419
           .|||||||||||| |||..||||||||| |            ||||||||. ||.||   
Sbjct: 422 KELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQW 481

Query: 420 PVNSLEQAMMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTKLGPANTLNAVVRD 479
           || ||||||.||||||||||||||.||||..| |||| ||||||||. ||.|||  .|||
Sbjct: 482 PVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRD 541

Query: 480 VKKGNLPPDYQITLIDIGLVLECFMGGAYRSNYTRKAFRNLYNNLYGLKRPKALKLLGME 539
           ||||||||||.|.|||||||.|  |||||| ||||| || ||.||.| ||||||||||||
Sbjct: 542 VKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGME 601

Query: 540 DDXXXXXXXXXXXXXXXXXXXXXXXXXXXCRFKFPFHELMLWAVLMKRQKMALFLWQRGE 599
           ||                             | |||||||.||||||||||||| || ||
Sbjct: 602 DDIPLRRGRKTTKKREEEVDIDLDDPEIN-HFPFPFHELMVWAVLMKRQKMALFFWQHGE 660

Query: 600 EAMAKALVACKLYKAMAHECSESELVDDISQDLENNSKEFGQLAYELLDQSYKHDEQVAM 659
           |||||||||||| |||||| ||...||||||.| .||..||||| |||||||| |||.||
Sbjct: 661 EAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAM 720

Query: 660 KLLTYELVNWSNSTCLKLAVAAKQRDFIAHTCSQMLLTDMWMGRLRIGKNPSLKV 714
           ||||||| ||||.|||.|||||| ||||||||||||||||||||||. ||  |||
Sbjct: 721 KLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKV 775

>hg18||uc004aid
        |9|NM_001007471|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_001007471|NP_001007472|trans
        ient receptor potential cation channel,

          Length = 1707

 Score =  1050 bits (2715), Expect = 1e-306
 Identities = 520/715 (72%), Positives = 592/715 (82%), Gaps = 5/715 (0%)

Query:   4 KVWIERNFLKRECIHIFP-TKDPTRCACGQLTTQHVAIPPGANSVE---ETIQLVQIDTP 59
           | |||| | ||||.|| | |||| || ||.|  ||| . |  . ..      .| . |  
Sbjct:  62 KSWIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQ 121

Query:  60 KDKWSIIKHTRTYPTDAFGVIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLELPT 119
            .|||| |||.  |||||| |||||||  |||||.|||.||||| ||||| |.|||||| 
Sbjct: 122 SEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPK 181

Query: 120 LLISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKDHSSK 179
           ||||||||||||.|||||||||||||||||.||||||||||||||||||||||||||.||
Sbjct: 182 LLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASK 241

Query: 180 SRGKVCAIGIAPWGILENKEDLIGKDVTRSYQSMANPLSKLAVLNSSHSHFILTDNGTCG 239
           ||||.| ||||||||.||.|||||.|| | ||.|.||.||| |||| |||||| |||| |
Sbjct: 242 SRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTG 301

Query: 240 KYGSEVKLRRLLEKHISLQKINTRLGQGVPLVCLIVEGGPNVISIALESLRDEPPIPVVV 299
           |||.|||||| |||||||||||||.|||||.| |||||||||||| || ||| ||.||||
Sbjct: 302 KYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVV 361

Query: 300 CDGSGRASDIISFAHKFSEDGGLVNDDVREQLLVTIQKTFNYSKSQSQQILLMVMECMKK 359
           ||||||||||..| ||.||.|||.|. .|.|||||||||| |...|.| . ...||||||
Sbjct: 362 CDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKK 421

Query: 360 RELITVFRMGSEGQQDIEMAILTALLKGTNXXXXXXXXXXXXWNRVDIARNHIFVYGHNL 419
           .|||||||||||| |||..||||||||| |            ||||||||. ||.||   
Sbjct: 422 KELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQW 481

Query: 420 PVNSLEQAMMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTKLGPANTLNAVVRD 479
           || ||||||.||||||||||||||.||||..| |||| ||||||||. ||.|||  .|||
Sbjct: 482 PVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRD 541

Query: 480 VKKGNLPPDYQITLIDIGLVLECFMGGAYRSNYTRKAFRNLYNNLYGLKRPKALKLLGME 539
           ||||||||||.|.|||||||.|  |||||| ||||| || ||.||.| ||||||||||||
Sbjct: 542 VKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGME 601

Query: 540 DDXXXXXXXXXXXXXXXXXXXXXXXXXXXCRFKFPFHELMLWAVLMKRQKMALFLWQRGE 599
           ||                             | |||||||.||||||||||||| || ||
Sbjct: 602 DDIPLRRGRKTTKKREEEVDIDLDDPEIN-HFPFPFHELMVWAVLMKRQKMALFFWQHGE 660

Query: 600 EAMAKALVACKLYKAMAHECSESELVDDISQDLENNSKEFGQLAYELLDQSYKHDEQVAM 659
           |||||||||||| |||||| ||...||||||.| .||..||||| |||||||| |||.||
Sbjct: 661 EAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAM 720

Query: 660 KLLTYELVNWSNSTCLKLAVAAKQRDFIAHTCSQMLLTDMWMGRLRIGKNPSLKV 714
           ||||||| ||||.|||.|||||| ||||||||||||||||||||||. ||  |||
Sbjct: 721 KLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKV 775

>hg18||uc004aia
        |9|NM_020952|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_020952|NP_066003|transient
        receptor potential cation channel,

          Length = 1554

 Score =  952 bits (2460), Expect = 5e-277
 Identities = 469/623 (75%), Positives = 531/623 (85%), Gaps = 1/623 (0%)

Query:  92 MYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVT 151
           ||.|||.||||| ||||| |.|||||| ||||||||||||.|||||||||||||||||.|
Sbjct:   1 MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT 60

Query: 152 TGAWIFTGGVNTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQ 211
           |||||||||||||||||||||||||.||||||.| ||||||||.||.|||||.|| | ||
Sbjct:  61 TGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQ 120

Query: 212 SMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTRLGQGVPLV 271
           .|.||.||| |||| |||||| |||| ||||.|||||| |||||||||||||.|||||.|
Sbjct: 121 TMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVV 180

Query: 272 CLIVEGGPNVISIALESLRDEPPIPVVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQL 331
            |||||||||||| || ||| ||.||||||||||||||..| ||.||.|||.|. .|.||
Sbjct: 181 ALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQL 240

Query: 332 LVTIQKTFNYSKSQSQQILLMVMECMKKRELITVFRMGSEGQQDIEMAILTALLKGTNXX 391
           |||||||| |...|.| . ...||||||.|||||||||||| |||..||||||||| |  
Sbjct: 241 LVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANAS 300

Query: 392 XXXXXXXXXXWNRVDIARNHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIH 451
                     ||||||||. ||.||   || ||||||.||||||||||||||.||||..|
Sbjct: 301 APDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMH 360

Query: 452 HFLTIPRLEELYNTKLGPANTLNAVVRDVKKGNLPPDYQITLIDIGLVLECFMGGAYRSN 511
            |||| ||||||||. ||.|||  .|||||||||||||.|.|||||||.|  |||||| |
Sbjct: 361 RFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCN 420

Query: 512 YTRKAFRNLYNNLYGLKRPKALKLLGMEDDXXXXXXXXXXXXXXXXXXXXXXXXXXXCRF 571
           |||| || ||.||.| ||||||||||||||                             |
Sbjct: 421 YTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEIN-HF 479

Query: 572 KFPFHELMLWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDISQD 631
            |||||||.||||||||||||| || |||||||||||||| |||||| ||...||||||.
Sbjct: 480 PFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQE 539

Query: 632 LENNSKEFGQLAYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAHTC 691
           | .||..||||| |||||||| |||.||||||||| ||||.|||.|||||| ||||||||
Sbjct: 540 LNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTC 599

Query: 692 SQMLLTDMWMGRLRIGKNPSLKV 714
           ||||||||||||||. ||  |||
Sbjct: 600 SQMLLTDMWMGRLRMRKNSGLKV 622

>hg18||uc004ahu
        |9|AF536750|Q9HCF6-6|Q9HCF6-6|TRPM3|NM_024971|NP_079247|transient
        receptor potential cation channel,

          Length = 1549

 Score =  923 bits (2383), Expect = 4e-268
 Identities = 455/606 (75%), Positives = 515/606 (84%), Gaps = 1/606 (0%)

Query: 109 MVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRH 168
           | |.|||||| ||||||||||||.|||||||||||||||||.||||||||||||||||||
Sbjct:   1 MTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRH 60

Query: 169 VGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQSMANPLSKLAVLNSSHS 228
           ||||||||.||||||.| ||||||||.||.|||||.|| | ||.|.||.||| |||| ||
Sbjct:  61 VGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHS 120

Query: 229 HFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTRLGQGVPLVCLIVEGGPNVISIALES 288
           |||| |||| ||||.|||||| |||||||||||||.|||||.| |||||||||||| || 
Sbjct: 121 HFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEY 180

Query: 289 LRDEPPIPVVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQLLVTIQKTFNYSKSQSQQ 348
           ||| ||.||||||||||||||..| ||.||.|||.|. .|.|||||||||| |...|.| 
Sbjct: 181 LRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQH 240

Query: 349 ILLMVMECMKKRELITVFRMGSEGQQDIEMAILTALLKGTNXXXXXXXXXXXXWNRVDIA 408
           . ...||||||.|||||||||||| |||..||||||||| |            |||||||
Sbjct: 241 LFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIA 300

Query: 409 RNHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTKLG 468
           |. ||.||   || ||||||.||||||||||||||.||||..| |||| ||||||||. |
Sbjct: 301 RSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHG 360

Query: 469 PANTLNAVVRDVKKGNLPPDYQITLIDIGLVLECFMGGAYRSNYTRKAFRNLYNNLYGLK 528
           |.|||  .|||||||||||||.|.|||||||.|  |||||| ||||| || ||.||.| |
Sbjct: 361 PSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPK 420

Query: 529 RPKALKLLGMEDDXXXXXXXXXXXXXXXXXXXXXXXXXXXCRFKFPFHELMLWAVLMKRQ 588
           |||||||||||||                             | |||||||.||||||||
Sbjct: 421 RPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEIN-HFPFPFHELMVWAVLMKRQ 479

Query: 589 KMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDISQDLENNSKEFGQLAYELLD 648
           ||||| || |||||||||||||| |||||| ||...||||||.| .||..||||| ||||
Sbjct: 480 KMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLD 539

Query: 649 QSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAHTCSQMLLTDMWMGRLRIGK 708
           |||| |||.||||||||| ||||.|||.|||||| ||||||||||||||||||||||. |
Sbjct: 540 QSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRK 599

Query: 709 NPSLKV 714
           |  |||
Sbjct: 600 NSGLKV 605

>hg18||uc004ahz
        |9|NM_206945|Q9HCF6-5|Q9HCF6-5|TRPM3|NM_206945|NP_996828|transient
        receptor potential cation channel,

          Length = 1556

 Score =  847 bits (2187), Expect = 2e-245
 Identities = 431/625 (68%), Positives = 493/625 (78%), Gaps = 3/625 (0%)

Query:  92 MYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVT 151
           ||.|||.||||| ||||| |.|||||| ||||||||||||.|||||||||||||||||.|
Sbjct:   1 MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT 60

Query: 152 TGAWIFTGGVNTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQ 211
           |||||||||||||||||||||||||.||||||.| ||||||||.||.|||||.|| | ||
Sbjct:  61 TGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQ 120

Query: 212 SMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTRLGQGVPLV 271
           .|.||.||| |||| |||||| |||| ||||.|||||| |||||||||||||.|||||.|
Sbjct: 121 TMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVV 180

Query: 272 CLIVEGGPNVISIALESLRDEPPIPVVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQL 331
            |||||||||||| || ||| ||.||||||||||||||..| ||.||.|||.|. .|.||
Sbjct: 181 ALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQL 240

Query: 332 LVTIQKTFNYSKSQSQQILLMVMECMKKRELITVFRMGSEGQQDIEMAILTALLKGTNXX 391
           |||||||| |...|.| . ...||||||.|||||||||||| |||..||||||||| |  
Sbjct: 241 LVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANAS 300

Query: 392 XXXXXXXXXXWNRVDIARNHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIH 451
                     ||||||||. ||.||   || ||||||.||||||||||||||.||||..|
Sbjct: 301 APDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMH 360

Query: 452 HFLTIPRLEELYNTKLGPANTLNAVVRDVKKGNLPPDYQITLIDIGLVLECFMGGAYRSN 511
            |||| ||||||||. ||.|||  .||||||    | .        |  .  .       
Sbjct: 361 RFLTISRLEELYNTRHGPSNTLYHLVRDVKKREY-PGFGWIYFKGNLPPDYRISLIDIGL 419

Query: 512 YTRKAFRNLYNNLYGLKRPKAL--KLLGMEDDXXXXXXXXXXXXXXXXXXXXXXXXXXXC 569
                    |   |  || . |   | | . |                            
Sbjct: 420 VIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEIN 479

Query: 570 RFKFPFHELMLWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDIS 629
            | |||||||.||||||||||||| || |||||||||||||| |||||| ||...|||||
Sbjct: 480 HFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDIS 539

Query: 630 QDLENNSKEFGQLAYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAH 689
           |.| .||..||||| |||||||| |||.||||||||| ||||.|||.|||||| ||||||
Sbjct: 540 QELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAH 599

Query: 690 TCSQMLLTDMWMGRLRIGKNPSLKV 714
           ||||||||||||||||. ||  |||
Sbjct: 600 TCSQMLLTDMWMGRLRMRKNSGLKV 624

>hg18||uc004ahw
        |9|NM_206946|Q9HCF6|TRPM3_HUMAN|TRPM3|NM_206946|NP_996829|transient
        receptor potential cation channel,

          Length = 1579

 Score =  648 bits (1671), Expect = 1e-185
 Identities = 324/459 (70%), Positives = 373/459 (81%), Gaps = 1/459 (0%)

Query: 256 SLQKINTRLGQGVPLVCLIVEGGPNVISIALESLRDEPPIPVVVCDGSGRASDIISFAHK 315
           | |  .  .|||||.| |||||||||||| || ||| ||.||||||||||||||..| ||
Sbjct: 190 SCQLDSVGIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHK 249

Query: 316 FSEDGGLVNDDVREQLLVTIQKTFNYSKSQSQQILLMVMECMKKRELITVFRMGSEGQQD 375
           .||.|||.|. .|.|||||||||| |...|.| . ...||||||.|||||||||||| ||
Sbjct: 250 YSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQD 309

Query: 376 IEMAILTALLKGTNXXXXXXXXXXXXWNRVDIARNHIFVYGHNLPVNSLEQAMMDALVLD 435
           |..||||||||| |            ||||||||. ||.||   || ||||||.||||||
Sbjct: 310 IDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLD 369

Query: 436 RVDFVKLLLENGVNIHHFLTIPRLEELYNTKLGPANTLNAVVRDVKKGNLPPDYQITLID 495
           ||||||||.||||..| |||| ||||||||. ||.|||  .|||||||||||||.|.|||
Sbjct: 370 RVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLID 429

Query: 496 IGLVLECFMGGAYRSNYTRKAFRNLYNNLYGLKRPKALKLLGMEDDXXXXXXXXXXXXXX 555
           ||||.|  |||||| ||||| || ||.||.| ||||||||||||||              
Sbjct: 430 IGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKRE 489

Query: 556 XXXXXXXXXXXXXCRFKFPFHELMLWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAM 615
                          | |||||||.||||||||||||| || |||||||||||||| |||
Sbjct: 490 EEVDIDLDDPEIN-HFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAM 548

Query: 616 AHECSESELVDDISQDLENNSKEFGQLAYELLDQSYKHDEQVAMKLLTYELVNWSNSTCL 675
           ||| ||...||||||.| .||..||||| |||||||| |||.||||||||| ||||.|||
Sbjct: 549 AHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCL 608

Query: 676 KLAVAAKQRDFIAHTCSQMLLTDMWMGRLRIGKNPSLKV 714
           .|||||| ||||||||||||||||||||||. ||  |||
Sbjct: 609 QLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKV 647

>hg18||uc001zfm
        |15|NM_002420|Q7Z4N5|Q7Z4N5_HUMAN|TRPM1|NM_002420|NP_002411|transient
        receptor potential cation channel,

          Length = 1603

 Score =  632 bits (1630), Expect = 8e-181
 Identities = 303/403 (75%), Positives = 352/403 (87%), Gaps = 1/403 (0%)

Query:  23 KDPTRCACGQLTTQHVAIPPGANSVEETIQLVQIDTPKDKWSIIKHTRTYPTDAFGVIEF 82
           ||  || ||| | ||.   | |   .   .  |..|  .|||. |||..||||..||.||
Sbjct:   2 KDSNRCCCGQFTNQHIPPLPSATPSKNEEESKQVETQPEKWSVAKHTQSYPTDSYGVLEF 61

Query:  83 QGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFG 142
           ||||. |||||||||||||||.|||||||||||||| ||||||||||||..|||||||||
Sbjct:  62 QGGGYSNKAMYIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQNFEMQPKLKQVFG 121

Query: 143 KGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGILENKEDLI 202
           |||||||.|||||||||||.|||| |||||||||||||||.|||||||||||.||||||.
Sbjct: 122 KGLIKAAMTTGAWIFTGGVSTGVISHVGDALKDHSSKSRGRVCAIGIAPWGIVENKEDLV 181

Query: 203 GKDVTRSYQSMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLRRLLEKHISLQKINT 262
           |||||| ||.|.||||||.|||.||.|||| |||| ||||.|||||||||||||||||||
Sbjct: 182 GKDVTRVYQTMSNPLSKLSVLNNSHTHFILADNGTLGKYGAEVKLRRLLEKHISLQKINT 241

Query: 263 RLGQGVPLVCLIVEGGPNVISIALESLRDEPPIPVVVCDGSGRASDIISFAHKFSEDGGL 322
           ||||||||| |.|||||||.|| || |..|||||||.||||||||||.|||||. |.||.
Sbjct: 242 RLGQGVPLVGLVVEGGPNVVSIVLEYLQEEPPIPVVICDGSGRASDILSFAHKYCEEGGI 301

Query: 323 VNDDVREQLLVTIQKTFNYSKSQSQQILLMVMECMKKRELITVFRMGSEGQQDIEMAILT 382
           .|. .||||||||||||||.|.|| |.  ..||||||.||.|||||||||||||||||||
Sbjct: 302 INESLREQLLVTIQKTFNYNKAQSHQLFAIIMECMKKKELVTVFRMGSEGQQDIEMAILT 361

Query: 383 ALLKGTNXXXXXXXXXXXXWNRVDIARNHIFVYG-HNLPVNSL 424
           |||||||            ||||||||. |||.| |  |. ||
Sbjct: 362 ALLKGTNVSAPDQLSLALAWNRVDIARSQIFVFGPHWPPLGSL 404

>hg18||uc004ahx
        |9|NM_024971|Q9HCF6-3|Q9HCF6-3|TRPM3|NM_024971|NP_079247|transient
        receptor potential cation channel,

          Length = 1566

 Score =  629 bits (1620), Expect = 1e-179
 Identities = 303/395 (76%), Positives = 348/395 (88%)

Query:  92 MYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVT 151
           ||.|||.||||| ||||| |.|||||| ||||||||||||.|||||||||||||||||.|
Sbjct:   1 MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT 60

Query: 152 TGAWIFTGGVNTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQ 211
           |||||||||||||||||||||||||.||||||.| ||||||||.||.|||||.|| | ||
Sbjct:  61 TGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQ 120

Query: 212 SMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTRLGQGVPLV 271
           .|.||.||| |||| |||||| |||| ||||.|||||| |||||||||||||.|||||.|
Sbjct: 121 TMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVV 180

Query: 272 CLIVEGGPNVISIALESLRDEPPIPVVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQL 331
            |||||||||||| || ||| ||.||||||||||||||..| ||.||.|||.|. .|.||
Sbjct: 181 ALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQL 240

Query: 332 LVTIQKTFNYSKSQSQQILLMVMECMKKRELITVFRMGSEGQQDIEMAILTALLKGTNXX 391
           |||||||| |...|.| . ...||||||.|||||||||||| |||..||||||||| |  
Sbjct: 241 LVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANAS 300

Query: 392 XXXXXXXXXXWNRVDIARNHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIH 451
                     ||||||||. ||.||   || ||||||.||||||||||||||.||||..|
Sbjct: 301 APDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMH 360

Query: 452 HFLTIPRLEELYNTKLGPANTLNAVVRDVKKGNLP 486
            |||| ||||||||. ||.|||  .||||||   |
Sbjct: 361 RFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYP 395

>hg18||uc001zys
        |15|NM_017672|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|NP_060142|transient
        receptor potential cation channel,

          Length = 1864

 Score =  621 bits (1599), Expect = 3e-177
 Identities = 299/505 (59%), Positives = 386/505 (76%), Gaps = 2/505 (0%)

Query:  27 RCACGQLTTQHVAIPPGANSVEETIQL-VQIDTPKDKWSIIKHTRTYPTDAFGVIEFQGG 85
           || ||.|  ||             ..|    .   ..||. |||   ||||.||| ||||
Sbjct:  41 RCFCGRLVKQHACFTASLAMKYSDVKLGDHFNQAIEEWSVEKHTEQSPTDAYGVINFQGG 100

Query:  86 GFINKAMYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGL 145
               .| |.|.||||||. .| |..|.||.||| |.||||||.| |.| |..||. ||||
Sbjct: 101 SHSYRAKYVRLSYDTKPEVILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGL 160

Query: 146 IKAAVTTGAWIFTGGVNTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKD 205
           ||||||||||| |||||||| .|||||||.|.|.|  |.| |||||||..||. ||.|.|
Sbjct: 161 IKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTIGIAPWGVIENRNDLVGRD 220

Query: 206 VTRSYQSMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTRLG 265
           |   ||.. |||||| |||. |||||| |.|| ||||.||.||| ||| |. |.|. |.|
Sbjct: 221 VVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIG 280

Query: 266 QGVPLVCLIVEGGPNVISIALESLRDEPPIPVVVCDGSGRASDIISFAHKFSEDGGLVND 325
           ||||.| || |||||||   || |.. ||.|||||.|.|||.|.... || .|.|| . |
Sbjct: 281 QGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPD 340

Query: 326 DVREQLLVTIQKTFNYSKSQSQQILLMVMECMKKRELITVFRMGSEGQQDIEMAILTALL 385
                .. ||.||||. ....  .   .|||||..|||||| .||.  |||..|||||||
Sbjct: 341 AAEPDIISTIKKTFNFGQNEALHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALL 400

Query: 386 KGTNXXXXXXXXXXXXWNRVDIARNHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLE 445
           ||||            |.|||||.||.||||    | ||||||.||||.||| |||||.|
Sbjct: 401 KGTNASAFDQLILTLAWDRVDIAKNHVFVYGQQWLVGSLEQAMLDALVMDRVAFVKLLIE 460

Query: 446 NGVNIHHFLTIPRLEELYNTKLGPAN-TLNAVVRDVKKGNLPPDYQITLIDIGLVLECFM 504
           |||..| |||||||||||||| || |  |  .|||||.||||| |.|||||||||.|  |
Sbjct: 461 NGVSMHKFLTIPRLEELYNTKQGPTNPMLFHLVRDVKQGNLPPGYKITLIDIGLVIEYLM 520

Query: 505 GGAYRSNYTRKAFRNLYNNLYGLKR 529
           || ||  |||| || .||.| |  |
Sbjct: 521 GGTYRCTYTRKRFRLIYNSLGGNNR 545

>hg18||uc001zyt
        |15|AY032950|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|NP_060142|transient
        receptor potential cation channel,

          Length = 1865

 Score =  621 bits (1599), Expect = 3e-177
 Identities = 299/505 (59%), Positives = 386/505 (76%), Gaps = 2/505 (0%)

Query:  27 RCACGQLTTQHVAIPPGANSVEETIQL-VQIDTPKDKWSIIKHTRTYPTDAFGVIEFQGG 85
           || ||.|  ||             ..|    .   ..||. |||   ||||.||| ||||
Sbjct:  41 RCFCGRLVKQHACFTASLAMKYSDVKLGDHFNQAIEEWSVEKHTEQSPTDAYGVINFQGG 100

Query:  86 GFINKAMYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGL 145
               .| |.|.||||||. .| |..|.||.||| |.||||||.| |.| |..||. ||||
Sbjct: 101 SHSYRAKYVRLSYDTKPEVILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGL 160

Query: 146 IKAAVTTGAWIFTGGVNTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKD 205
           ||||||||||| |||||||| .|||||||.|.|.|  |.| |||||||..||. ||.|.|
Sbjct: 161 IKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTIGIAPWGVIENRNDLVGRD 220

Query: 206 VTRSYQSMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTRLG 265
           |   ||.. |||||| |||. |||||| |.|| ||||.||.||| ||| |. |.|. |.|
Sbjct: 221 VVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIG 280

Query: 266 QGVPLVCLIVEGGPNVISIALESLRDEPPIPVVVCDGSGRASDIISFAHKFSEDGGLVND 325
           ||||.| || |||||||   || |.. ||.|||||.|.|||.|.... || .|.|| . |
Sbjct: 281 QGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPD 340

Query: 326 DVREQLLVTIQKTFNYSKSQSQQILLMVMECMKKRELITVFRMGSEGQQDIEMAILTALL 385
                .. ||.||||. ....  .   .|||||..|||||| .||.  |||..|||||||
Sbjct: 341 AAEPDIISTIKKTFNFGQNEALHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALL 400

Query: 386 KGTNXXXXXXXXXXXXWNRVDIARNHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLE 445
           ||||            |.|||||.||.||||    | ||||||.||||.||| |||||.|
Sbjct: 401 KGTNASAFDQLILTLAWDRVDIAKNHVFVYGQQWLVGSLEQAMLDALVMDRVAFVKLLIE 460

Query: 446 NGVNIHHFLTIPRLEELYNTKLGPAN-TLNAVVRDVKKGNLPPDYQITLIDIGLVLECFM 504
           |||..| |||||||||||||| || |  |  .|||||.||||| |.|||||||||.|  |
Sbjct: 461 NGVSMHKFLTIPRLEELYNTKQGPTNPMLFHLVRDVKQGNLPPGYKITLIDIGLVIEYLM 520

Query: 505 GGAYRSNYTRKAFRNLYNNLYGLKR 529
           || ||  |||| || .||.| |  |
Sbjct: 521 GGTYRCTYTRKRFRLIYNSLGGNNR 545

>hg18||uc004ahv
        |9|AB099665|Q9HCF6-8|Q9HCF6-8|TRPM3|NM_206944|NP_996827|transient
        receptor potential cation channel,

          Length = 1509

 Score =  580 bits (1495), Expect = 4e-165
 Identities = 290/474 (61%), Positives = 351/474 (74%), Gaps = 7/474 (1%)

Query:  760 NPDATSRRGDEEEGSANVRKIPIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNYIILVKM 819
            |   .||. ||||  .  | ||.|.. .|||.||  |||| |..|.|||||.|||.||||
Sbjct:  638 NNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKM 697

Query:  820 ERWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLKQKISVWLEEYWNITDLAAICTFL 879
            ||||| ||||||||| ||| ||.|.  ||||||||| ||. |||.||||.||| ||  | 
Sbjct:  698 ERWPSTQEWIVISYIFTLGIEKMRE--ILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFS 755

Query:  880 LGLMLRLQQEPYMGYGRVIYCIDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVV 939
            .|..|||| .|.   ||||||..||.||||.||||||||||||||           |||.
Sbjct:  756 VGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVI 815

Query:  940 IMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDPPCGEHLYDED 999
            ||||||||||||||||| |.|||.|.||.||||||||||||||||| ||||||..   ||
Sbjct:  816 IMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETRED 875

Query: 1000 GK--RLPPCIPGAWLTPAIMACYXXXXXXXXXXXXXXVFNNTFFEVKSISNQVWKFQRYQ 1057
            ||  .||||  |||. |||||||              |||||||||||||||||||||||
Sbjct:  876 GKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQ 935

Query: 1058 LIMTFHDRXXXXXXXXXXXXXXXXCNRMFRRCAKKKQDGELDEKDRGLKLRLNPEELKIL 1117
            ||||||.|                   .   |  .| . . ||.| |||| .  .||| .
Sbjct:  936 LIMTFHERPVLPPPLIIFSHMTMIFQHLC--CRWRKHESDPDERDYGLKLFITDDELKKV 993

Query: 1118 YEFEEQCVEEYFREKXXXXXXXXXXRIKVTSERVENMFMRLEEVNERENTMKASLQTVDL 1177
            ..|||||.|||||||          ||.||||||||| ||||||||||..|||||||||.
Sbjct:  994 HDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDI 1053

Query: 1178 RLAQLEEIHGRMAVALEKLAGVDRLELTRTYSRNSSVC-DPSSLHRQGSINSAD 1230
            ||||||.. |||| |||.| |..| |  .  || || | | . . || | || .
Sbjct: 1054 RLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQE 1107

>hg18||uc004ahw
        |9|NM_206946|Q9HCF6|TRPM3_HUMAN|TRPM3|NM_206946|NP_996829|transient
        receptor potential cation channel,

          Length = 1579

 Score =  580 bits (1495), Expect = 4e-165
 Identities = 290/474 (61%), Positives = 351/474 (74%), Gaps = 7/474 (1%)

Query:  760 NPDATSRRGDEEEGSANVRKIPIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNYIILVKM 819
            |   .||. ||||  .  | ||.|.. .|||.||  |||| |..|.|||||.|||.||||
Sbjct:  708 NNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKM 767

Query:  820 ERWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLKQKISVWLEEYWNITDLAAICTFL 879
            ||||| ||||||||| ||| ||.|.  ||||||||| ||. |||.||||.||| ||  | 
Sbjct:  768 ERWPSTQEWIVISYIFTLGIEKMRE--ILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFS 825

Query:  880 LGLMLRLQQEPYMGYGRVIYCIDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVV 939
            .|..|||| .|.   ||||||..||.||||.||||||||||||||           |||.
Sbjct:  826 VGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVI 885

Query:  940 IMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDPPCGEHLYDED 999
            ||||||||||||||||| |.|||.|.||.||||||||||||||||| ||||||..   ||
Sbjct:  886 IMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETRED 945

Query: 1000 GK--RLPPCIPGAWLTPAIMACYXXXXXXXXXXXXXXVFNNTFFEVKSISNQVWKFQRYQ 1057
            ||  .||||  |||. |||||||              |||||||||||||||||||||||
Sbjct:  946 GKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQ 1005

Query: 1058 LIMTFHDRXXXXXXXXXXXXXXXXCNRMFRRCAKKKQDGELDEKDRGLKLRLNPEELKIL 1117
            ||||||.|                   .   |  .| . . ||.| |||| .  .||| .
Sbjct: 1006 LIMTFHERPVLPPPLIIFSHMTMIFQHLC--CRWRKHESDPDERDYGLKLFITDDELKKV 1063

Query: 1118 YEFEEQCVEEYFREKXXXXXXXXXXRIKVTSERVENMFMRLEEVNERENTMKASLQTVDL 1177
            ..|||||.|||||||          ||.||||||||| ||||||||||..|||||||||.
Sbjct: 1064 HDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDI 1123

Query: 1178 RLAQLEEIHGRMAVALEKLAGVDRLELTRTYSRNSSVC-DPSSLHRQGSINSAD 1230
            ||||||.. |||| |||.| |..| |  .  || || | | . . || | || .
Sbjct: 1124 RLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQE 1177

>hg18||uc004ahx
        |9|NM_024971|Q9HCF6-3|Q9HCF6-3|TRPM3|NM_024971|NP_079247|transient
        receptor potential cation channel,

          Length = 1566

 Score =  580 bits (1495), Expect = 4e-165
 Identities = 290/474 (61%), Positives = 351/474 (74%), Gaps = 7/474 (1%)

Query:  760 NPDATSRRGDEEEGSANVRKIPIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNYIILVKM 819
            |   .||. ||||  .  | ||.|.. .|||.||  |||| |..|.|||||.|||.||||
Sbjct:  695 NNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKM 754

Query:  820 ERWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLKQKISVWLEEYWNITDLAAICTFL 879
            ||||| ||||||||| ||| ||.|.  ||||||||| ||. |||.||||.||| ||  | 
Sbjct:  755 ERWPSTQEWIVISYIFTLGIEKMRE--ILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFS 812

Query:  880 LGLMLRLQQEPYMGYGRVIYCIDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVV 939
            .|..|||| .|.   ||||||..||.||||.||||||||||||||           |||.
Sbjct:  813 VGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVI 872

Query:  940 IMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDPPCGEHLYDED 999
            ||||||||||||||||| |.|||.|.||.||||||||||||||||| ||||||..   ||
Sbjct:  873 IMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETRED 932

Query: 1000 GK--RLPPCIPGAWLTPAIMACYXXXXXXXXXXXXXXVFNNTFFEVKSISNQVWKFQRYQ 1057
            ||  .||||  |||. |||||||              |||||||||||||||||||||||
Sbjct:  933 GKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQ 992

Query: 1058 LIMTFHDRXXXXXXXXXXXXXXXXCNRMFRRCAKKKQDGELDEKDRGLKLRLNPEELKIL 1117
            ||||||.|                   .   |  .| . . ||.| |||| .  .||| .
Sbjct:  993 LIMTFHERPVLPPPLIIFSHMTMIFQHLC--CRWRKHESDPDERDYGLKLFITDDELKKV 1050

Query: 1118 YEFEEQCVEEYFREKXXXXXXXXXXRIKVTSERVENMFMRLEEVNERENTMKASLQTVDL 1177
            ..|||||.|||||||          ||.||||||||| ||||||||||..|||||||||.
Sbjct: 1051 HDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDI 1110

Query: 1178 RLAQLEEIHGRMAVALEKLAGVDRLELTRTYSRNSSVC-DPSSLHRQGSINSAD 1230
            ||||||.. |||| |||.| |..| |  .  || || | | . . || | || .
Sbjct: 1111 RLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQE 1164

>hg18||uc004ahz
        |9|NM_206945|Q9HCF6-5|Q9HCF6-5|TRPM3|NM_206945|NP_996828|transient
        receptor potential cation channel,

          Length = 1556

 Score =  580 bits (1495), Expect = 4e-165
 Identities = 290/474 (61%), Positives = 351/474 (74%), Gaps = 7/474 (1%)

Query:  760 NPDATSRRGDEEEGSANVRKIPIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNYIILVKM 819
            |   .||. ||||  .  | ||.|.. .|||.||  |||| |..|.|||||.|||.||||
Sbjct:  685 NNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKM 744

Query:  820 ERWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLKQKISVWLEEYWNITDLAAICTFL 879
            ||||| ||||||||| ||| ||.|.  ||||||||| ||. |||.||||.||| ||  | 
Sbjct:  745 ERWPSTQEWIVISYIFTLGIEKMRE--ILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFS 802

Query:  880 LGLMLRLQQEPYMGYGRVIYCIDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVV 939
            .|..|||| .|.   ||||||..||.||||.||||||||||||||           |||.
Sbjct:  803 VGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVI 862

Query:  940 IMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDPPCGEHLYDED 999
            ||||||||||||||||| |.|||.|.||.||||||||||||||||| ||||||..   ||
Sbjct:  863 IMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETRED 922

Query: 1000 GK--RLPPCIPGAWLTPAIMACYXXXXXXXXXXXXXXVFNNTFFEVKSISNQVWKFQRYQ 1057
            ||  .||||  |||. |||||||              |||||||||||||||||||||||
Sbjct:  923 GKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQ 982

Query: 1058 LIMTFHDRXXXXXXXXXXXXXXXXCNRMFRRCAKKKQDGELDEKDRGLKLRLNPEELKIL 1117
            ||||||.|                   .   |  .| . . ||.| |||| .  .||| .
Sbjct:  983 LIMTFHERPVLPPPLIIFSHMTMIFQHLC--CRWRKHESDPDERDYGLKLFITDDELKKV 1040

Query: 1118 YEFEEQCVEEYFREKXXXXXXXXXXRIKVTSERVENMFMRLEEVNERENTMKASLQTVDL 1177
            ..|||||.|||||||          ||.||||||||| ||||||||||..|||||||||.
Sbjct: 1041 HDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDI 1100

Query: 1178 RLAQLEEIHGRMAVALEKLAGVDRLELTRTYSRNSSVC-DPSSLHRQGSINSAD 1230
            ||||||.. |||| |||.| |..| |  .  || || | | . . || | || .
Sbjct: 1101 RLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQE 1154

>hg18||uc004aia
        |9|NM_020952|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_020952|NP_066003|transient
        receptor potential cation channel,

          Length = 1554

 Score =  580 bits (1495), Expect = 4e-165
 Identities = 290/474 (61%), Positives = 351/474 (74%), Gaps = 7/474 (1%)

Query:  760 NPDATSRRGDEEEGSANVRKIPIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNYIILVKM 819
            |   .||. ||||  .  | ||.|.. .|||.||  |||| |..|.|||||.|||.||||
Sbjct:  683 NNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKM 742

Query:  820 ERWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLKQKISVWLEEYWNITDLAAICTFL 879
            ||||| ||||||||| ||| ||.|.  ||||||||| ||. |||.||||.||| ||  | 
Sbjct:  743 ERWPSTQEWIVISYIFTLGIEKMRE--ILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFS 800

Query:  880 LGLMLRLQQEPYMGYGRVIYCIDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVV 939
            .|..|||| .|.   ||||||..||.||||.||||||||||||||           |||.
Sbjct:  801 VGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVI 860

Query:  940 IMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDPPCGEHLYDED 999
            ||||||||||||||||| |.|||.|.||.||||||||||||||||| ||||||..   ||
Sbjct:  861 IMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETRED 920

Query: 1000 GK--RLPPCIPGAWLTPAIMACYXXXXXXXXXXXXXXVFNNTFFEVKSISNQVWKFQRYQ 1057
            ||  .||||  |||. |||||||              |||||||||||||||||||||||
Sbjct:  921 GKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQ 980

Query: 1058 LIMTFHDRXXXXXXXXXXXXXXXXCNRMFRRCAKKKQDGELDEKDRGLKLRLNPEELKIL 1117
            ||||||.|                   .   |  .| . . ||.| |||| .  .||| .
Sbjct:  981 LIMTFHERPVLPPPLIIFSHMTMIFQHLC--CRWRKHESDPDERDYGLKLFITDDELKKV 1038

Query: 1118 YEFEEQCVEEYFREKXXXXXXXXXXRIKVTSERVENMFMRLEEVNERENTMKASLQTVDL 1177
            ..|||||.|||||||          ||.||||||||| ||||||||||..|||||||||.
Sbjct: 1039 HDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDI 1098

Query: 1178 RLAQLEEIHGRMAVALEKLAGVDRLELTRTYSRNSSVC-DPSSLHRQGSINSAD 1230
            ||||||.. |||| |||.| |..| |  .  || || | | . . || | || .
Sbjct: 1099 RLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQE 1152

>hg18||uc004aic
        |9|AJ505026|Q9HCF6-10|Q9HCF6-10|TRPM3|NM_001007471|NP_001007472|transie
        nt receptor potential cation channel,

          Length = 1325

 Score =  580 bits (1495), Expect = 4e-165
 Identities = 290/474 (61%), Positives = 351/474 (74%), Gaps = 7/474 (1%)

Query:  760 NPDATSRRGDEEEGSANVRKIPIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNYIILVKM 819
            |   .||. ||||  .  | ||.|.. .|||.||  |||| |..|.|||||.|||.||||
Sbjct:  836 NNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKM 895

Query:  820 ERWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLKQKISVWLEEYWNITDLAAICTFL 879
            ||||| ||||||||| ||| ||.|.  ||||||||| ||. |||.||||.||| ||  | 
Sbjct:  896 ERWPSTQEWIVISYIFTLGIEKMRE--ILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFS 953

Query:  880 LGLMLRLQQEPYMGYGRVIYCIDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVV 939
            .|..|||| .|.   ||||||..||.||||.||||||||||||||           |||.
Sbjct:  954 VGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVI 1013

Query:  940 IMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDPPCGEHLYDED 999
            ||||||||||||||||| |.|||.|.||.||||||||||||||||| ||||||..   ||
Sbjct: 1014 IMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETRED 1073

Query: 1000 GK--RLPPCIPGAWLTPAIMACYXXXXXXXXXXXXXXVFNNTFFEVKSISNQVWKFQRYQ 1057
            ||  .||||  |||. |||||||              |||||||||||||||||||||||
Sbjct: 1074 GKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQ 1133

Query: 1058 LIMTFHDRXXXXXXXXXXXXXXXXCNRMFRRCAKKKQDGELDEKDRGLKLRLNPEELKIL 1117
            ||||||.|                   .   |  .| . . ||.| |||| .  .||| .
Sbjct: 1134 LIMTFHERPVLPPPLIIFSHMTMIFQHLC--CRWRKHESDPDERDYGLKLFITDDELKKV 1191

Query: 1118 YEFEEQCVEEYFREKXXXXXXXXXXRIKVTSERVENMFMRLEEVNERENTMKASLQTVDL 1177
            ..|||||.|||||||          ||.||||||||| ||||||||||..|||||||||.
Sbjct: 1192 HDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDI 1251

Query: 1178 RLAQLEEIHGRMAVALEKLAGVDRLELTRTYSRNSSVC-DPSSLHRQGSINSAD 1230
            ||||||.. |||| |||.| |..| |  .  || || | | . . || | || .
Sbjct: 1252 RLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQE 1305

>hg18||uc004aid
        |9|NM_001007471|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_001007471|NP_001007472|trans
        ient receptor potential cation channel,

          Length = 1707

 Score =  580 bits (1495), Expect = 4e-165
 Identities = 290/474 (61%), Positives = 351/474 (74%), Gaps = 7/474 (1%)

Query:  760 NPDATSRRGDEEEGSANVRKIPIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNYIILVKM 819
            |   .||. ||||  .  | ||.|.. .|||.||  |||| |..|.|||||.|||.||||
Sbjct:  836 NNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKM 895

Query:  820 ERWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLKQKISVWLEEYWNITDLAAICTFL 879
            ||||| ||||||||| ||| ||.|.  ||||||||| ||. |||.||||.||| ||  | 
Sbjct:  896 ERWPSTQEWIVISYIFTLGIEKMRE--ILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFS 953

Query:  880 LGLMLRLQQEPYMGYGRVIYCIDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVV 939
            .|..|||| .|.   ||||||..||.||||.||||||||||||||           |||.
Sbjct:  954 VGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVI 1013

Query:  940 IMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDPPCGEHLYDED 999
            ||||||||||||||||| |.|||.|.||.||||||||||||||||| ||||||..   ||
Sbjct: 1014 IMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETRED 1073

Query: 1000 GK--RLPPCIPGAWLTPAIMACYXXXXXXXXXXXXXXVFNNTFFEVKSISNQVWKFQRYQ 1057
            ||  .||||  |||. |||||||              |||||||||||||||||||||||
Sbjct: 1074 GKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQ 1133

Query: 1058 LIMTFHDRXXXXXXXXXXXXXXXXCNRMFRRCAKKKQDGELDEKDRGLKLRLNPEELKIL 1117
            ||||||.|                   .   |  .| . . ||.| |||| .  .||| .
Sbjct: 1134 LIMTFHERPVLPPPLIIFSHMTMIFQHLC--CRWRKHESDPDERDYGLKLFITDDELKKV 1191

Query: 1118 YEFEEQCVEEYFREKXXXXXXXXXXRIKVTSERVENMFMRLEEVNERENTMKASLQTVDL 1177
            ..|||||.|||||||          ||.||||||||| ||||||||||..|||||||||.
Sbjct: 1192 HDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDI 1251

Query: 1178 RLAQLEEIHGRMAVALEKLAGVDRLELTRTYSRNSSVC-DPSSLHRQGSINSAD 1230
            ||||||.. |||| |||.| |..| |  .  || || | | . . || | || .
Sbjct: 1252 RLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQE 1305

>hg18||uc004ajk
        |9|AY333284|Q9BX84-3|Q9BX84-3|TRPM6|NM_017662|NP_060132|transient
        receptor potential cation channel,

          Length = 2017

 Score =  574 bits (1477), Expect = 4e-163
 Identities = 296/530 (55%), Positives = 376/530 (70%), Gaps = 23/530 (4%)

Query:  11 FLKRECIHIFP-TKDPTRCA-------------CGQLTTQHVAIPPGANSVEETIQLVQI 56
           | ||||  | | .|.| ||              ||.|   |  |         ||   . 
Sbjct:  16 FDKRECSTIIPSSKNPHRCTPVCQVCQNLIRCYCGRLIGDHAGI-----DYSWTISAAK- 69

Query:  57 DTPKDKWSIIKHTRTYPTDAFGVIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLE 116
               ..||. |||   ||| || | || |   . | ||| ||||| |.|||||.|.|..|
Sbjct:  70 GKESEQWSVEKHTTKSPTDTFGTINFQDGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKME 129

Query: 117 LPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKDH 176
           || |.||||||.||| .  | |..| .||.||| |||||| | |.|||| .||||||| |
Sbjct: 130 LPKLVISVHGGIQNFTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSH 189

Query: 177 SSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQSMANPLSKLAVLNSSHSHFILTDNG 236
           || |  |.  .|| |||..||. |||||||   ||.. ||||||  ||| ||||||.|.|
Sbjct: 190 SSHSLRKIWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKLTTLNSMHSHFILSDDG 249

Query: 237 TCGKYGSEVKLRRLLEKHISLQKINTRLGQGVPLVCLIVEGGPNVISIALESLRDEPPIP 296
           | ||||.|.|||| |||..|||||. |  ||||.| |.||||||||    |...|.   |
Sbjct: 250 TVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVILSVWETVKDKD--P 307

Query: 297 VVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQLLVTIQKTFNYSKSQSQQILLMVMEC 356
           ||||.|.|||.|...| ||   | |..   |.|...  || |||.|  ||. .  ..|||
Sbjct: 308 VVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICMIQNTFNFSLKQSKHLFQILMEC 367

Query: 357 MKKRELITVFRMGSEGQQDIEMAILTALLKGTNXXXXXXXXXXXXWNRVDIARNHIFVYG 416
           |  |. ||.|   || |||...|||||||||||            |.|||||. || .| 
Sbjct: 368 MVHRDCITIFDADSEEQQDLDLAILTALLKGTNLSASEQLNLAMAWDRVDIAKKHILIYE 427

Query: 417 HNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTKLGPANT-LNA 475
            .   ..||||| ||||.|||||||||.| |||.| |||||||||||||| || || |. 
Sbjct: 428 QHWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELYNTKQGPTNTLLHH 487

Query: 476 VVRDVKKGNLPPDYQITLIDIGLVLECFMGGAYRSNYTRKAFRNLYNNLY 525
           .|.|||.  |   |.|||||||||.|  .| ||||||||| || ||||||
Sbjct: 488 LVQDVKQHTLLSGYRITLIDIGLVVEYLIGRAYRSNYTRKHFRALYNNLY 537

>hg18||uc004ajl
        |9|NM_017662|Q9BX84|TRPM6_HUMAN|TRPM6|NM_017662|NP_060132|transient
        receptor potential cation channel,

          Length = 2022

 Score =  574 bits (1477), Expect = 4e-163
 Identities = 296/530 (55%), Positives = 376/530 (70%), Gaps = 23/530 (4%)

Query:  11 FLKRECIHIFP-TKDPTRCA-------------CGQLTTQHVAIPPGANSVEETIQLVQI 56
           | ||||  | | .|.| ||              ||.|   |  |         ||   . 
Sbjct:  21 FDKRECSTIIPSSKNPHRCTPVCQVCQNLIRCYCGRLIGDHAGI-----DYSWTISAAK- 74

Query:  57 DTPKDKWSIIKHTRTYPTDAFGVIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLE 116
               ..||. |||   ||| || | || |   . | ||| ||||| |.|||||.|.|..|
Sbjct:  75 GKESEQWSVEKHTTKSPTDTFGTINFQDGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKME 134

Query: 117 LPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKDH 176
           || |.||||||.||| .  | |..| .||.||| |||||| | |.|||| .||||||| |
Sbjct: 135 LPKLVISVHGGIQNFTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSH 194

Query: 177 SSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQSMANPLSKLAVLNSSHSHFILTDNG 236
           || |  |.  .|| |||..||. |||||||   ||.. ||||||  ||| ||||||.|.|
Sbjct: 195 SSHSLRKIWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKLTTLNSMHSHFILSDDG 254

Query: 237 TCGKYGSEVKLRRLLEKHISLQKINTRLGQGVPLVCLIVEGGPNVISIALESLRDEPPIP 296
           | ||||.|.|||| |||..|||||. |  ||||.| |.||||||||    |...|.   |
Sbjct: 255 TVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVILSVWETVKDKD--P 312

Query: 297 VVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQLLVTIQKTFNYSKSQSQQILLMVMEC 356
           ||||.|.|||.|...| ||   | |..   |.|...  || |||.|  ||. .  ..|||
Sbjct: 313 VVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICMIQNTFNFSLKQSKHLFQILMEC 372

Query: 357 MKKRELITVFRMGSEGQQDIEMAILTALLKGTNXXXXXXXXXXXXWNRVDIARNHIFVYG 416
           |  |. ||.|   || |||...|||||||||||            |.|||||. || .| 
Sbjct: 373 MVHRDCITIFDADSEEQQDLDLAILTALLKGTNLSASEQLNLAMAWDRVDIAKKHILIYE 432

Query: 417 HNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTKLGPANT-LNA 475
            .   ..||||| ||||.|||||||||.| |||.| |||||||||||||| || || |. 
Sbjct: 433 QHWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELYNTKQGPTNTLLHH 492

Query: 476 VVRDVKKGNLPPDYQITLIDIGLVLECFMGGAYRSNYTRKAFRNLYNNLY 525
           .|.|||.  |   |.|||||||||.|  .| ||||||||| || ||||||
Sbjct: 493 LVQDVKQHTLLSGYRITLIDIGLVVEYLIGRAYRSNYTRKHFRALYNNLY 542

>hg18||uc004ahv
        |9|AB099665|Q9HCF6-8|Q9HCF6-8|TRPM3|NM_206944|NP_996827|transient
        receptor potential cation channel,

          Length = 1509

 Score =  549 bits (1412), Expect = 2e-155
 Identities = 263/339 (77%), Positives = 301/339 (88%)

Query: 109 MVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRH 168
           | |.|||||| ||||||||||||.|||||||||||||||||.||||||||||||||||||
Sbjct:   1 MTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRH 60

Query: 169 VGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQSMANPLSKLAVLNSSHS 228
           ||||||||.||||||.| ||||||||.||.|||||.|| | ||.|.||.||| |||| ||
Sbjct:  61 VGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHS 120

Query: 229 HFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTRLGQGVPLVCLIVEGGPNVISIALES 288
           |||| |||| ||||.|||||| |||||||||||||.|||||.| |||||||||||| || 
Sbjct: 121 HFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEY 180

Query: 289 LRDEPPIPVVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQLLVTIQKTFNYSKSQSQQ 348
           ||| ||.||||||||||||||..| ||.||.|||.|. .|.|||||||||| |...|.| 
Sbjct: 181 LRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQH 240

Query: 349 ILLMVMECMKKRELITVFRMGSEGQQDIEMAILTALLKGTNXXXXXXXXXXXXWNRVDIA 408
           . ...||||||.|||||||||||| |||..||||||||| |            |||||||
Sbjct: 241 LFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIA 300

Query: 409 RNHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLENG 447
           |. ||.||   || ||||||.||||||||||||||.|||
Sbjct: 301 RSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENG 339

>hg18||uc001zys
        |15|NM_017672|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|NP_060142|transient
        receptor potential cation channel,

          Length = 1864

 Score =  536 bits (1380), Expect = 8e-152
 Identities = 288/662 (43%), Positives = 400/662 (60%), Gaps = 38/662 (5%)

Query:  570 RFKFPFHELMLWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDIS 629
            || .| .||..|| ||||| || |||| |||.|||||||||.|..||.|  .|.|||| |
Sbjct:  617 RFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTS 676

Query:  630 QDLENNSKEFGQLAYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAH 689
            ..|.  | .||||| |||.||.. || .||||||||| ||||||||||||... | |.||
Sbjct:  677 EELKQYSNDFGQLAVELLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAH 736

Query:  690 TCSQMLLTDMWMGRLRIGKNPSLKVXXXXXXXXXXXXXXXXXXXDSSFHAPXXXXXXXXX 749
            ||.||||.||||||| . ||   ||                   . | | |         
Sbjct:  737 TCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILLLEYKTKAEMS-HIPQSQDAHQMT 795

Query:  750 XDDTKSS-------------KDPNPDATSRRGDEEEGSANVRKIPIGKRFFEFYDAPFTK 796
             ||....             |.     ..   .| |     .|.|| ..|. || ||  |
Sbjct:  796 MDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFYHAPIVK 855

Query:  797 FWFNTISYLGYLMLYNYIILVKMERWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLK 856
            |||||..|||.|||| ...||.||. ||.||||||.|| |   ||||.  | ||| ||. 
Sbjct:  856 FWFNTLAYLGFLMLYTFVVLVQMEQLPSVQEWIVIAYIFTYAIEKVRE--IFMSEAGKVN 913

Query:  857 QKISVWLEEYWNITDLAAICTFLLGLMLRLQQE-----PYMGY----GRVIYCIDIIFWY 907
            ||| ||  .|.||.|  || .| .|  ||   .      |  .    ||.|||..|||||
Sbjct:  914 QKIKVWFSDYFNISDTIAIISFFIGFGLRFGAKWNFANAYDNHVFVAGRLIYCLNIIFWY 973

Query:  908 IRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVVIMLVVLMSFGVARQAILHPDEEPTWRLA 967
            .|.||   ||.  ||||           | |||| .||.|||| |.|||.| | |.| ||
Sbjct:  974 VRLLDFLAVNQQAGPYVMMIGKMVANMFYIVVIMALVLLSFGVPRKAILYPHEAPSWTLA 1033

Query:  968 RNIFYMPYWMIYGEVFADSIDPPCGEHLYDEDGKRLPPCIPGAWLTPAIMACYXXXXXXX 1027
            ..| . |||||.|||.|  ||    . .  .       | || |||| . | |       
Sbjct: 1034 KDIVFHPYWMIFGEVYAYEIDVCANDSVIPQ------ICGPGTWLTPFLQAVYLFVQYII 1087

Query: 1028 XXXXXXXVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRXXXXXXXXXXXXXXXXCNRMFR 1087
                    ||| . .||.||| |||.|||  || .|..                   .  
Sbjct: 1088 MVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIMAYHEKPVLPPPLIILSHIVSLFCCI-- 1145

Query: 1088 RCAKKKQDGELDEKDRGLKLRLNPEELKILYEFEEQCVEEYFREKXXXXXXXXXXRIKVT 1147
             | ..|.|   |    | || |  |. | |..||||||| || ||          ||.||
Sbjct: 1146 -CKRRKKDKTSD----GPKLFLTEEDQKKLHDFEEQCVEMYFNEKDDKFHSGSEERIRVT 1200

Query: 1148 SERVENMFMRLEEVNERENTMKASLQTVDLRLAQLEEIHGRMAVALEKLAGVDRLELTRT 1207
             |||| | ....|| .| | .| |||..| ..  |...       |. |      | .. 
Sbjct: 1201 FERVEQMCIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTLTAQKASEASKV 1260

Query: 1208 YS 1209
            ..
Sbjct: 1261 HN 1262

>hg18||uc001zyt
        |15|AY032950|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|NP_060142|transient
        receptor potential cation channel,

          Length = 1865

 Score =  536 bits (1380), Expect = 8e-152
 Identities = 288/662 (43%), Positives = 400/662 (60%), Gaps = 38/662 (5%)

Query:  570 RFKFPFHELMLWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDIS 629
            || .| .||..|| ||||| || |||| |||.|||||||||.|..||.|  .|.|||| |
Sbjct:  617 RFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTS 676

Query:  630 QDLENNSKEFGQLAYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAH 689
            ..|.  | .||||| |||.||.. || .||||||||| ||||||||||||... | |.||
Sbjct:  677 EELKQYSNDFGQLAVELLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAH 736

Query:  690 TCSQMLLTDMWMGRLRIGKNPSLKVXXXXXXXXXXXXXXXXXXXDSSFHAPXXXXXXXXX 749
            ||.||||.||||||| . ||   ||                   . | | |         
Sbjct:  737 TCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILLLEYKTKAEMS-HIPQSQDAHQMT 795

Query:  750 XDDTKSS-------------KDPNPDATSRRGDEEEGSANVRKIPIGKRFFEFYDAPFTK 796
             ||....             |.     ..   .| |     .|.|| ..|. || ||  |
Sbjct:  796 MDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFYHAPIVK 855

Query:  797 FWFNTISYLGYLMLYNYIILVKMERWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLK 856
            |||||..|||.|||| ...||.||. ||.||||||.|| |   ||||.  | ||| ||. 
Sbjct:  856 FWFNTLAYLGFLMLYTFVVLVQMEQLPSVQEWIVIAYIFTYAIEKVRE--IFMSEAGKVN 913

Query:  857 QKISVWLEEYWNITDLAAICTFLLGLMLRLQQE-----PYMGY----GRVIYCIDIIFWY 907
            ||| ||  .|.||.|  || .| .|  ||   .      |  .    ||.|||..|||||
Sbjct:  914 QKIKVWFSDYFNISDTIAIISFFIGFGLRFGAKWNFANAYDNHVFVAGRLIYCLNIIFWY 973

Query:  908 IRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVVIMLVVLMSFGVARQAILHPDEEPTWRLA 967
            .|.||   ||.  ||||           | |||| .||.|||| |.|||.| | |.| ||
Sbjct:  974 VRLLDFLAVNQQAGPYVMMIGKMVANMFYIVVIMALVLLSFGVPRKAILYPHEAPSWTLA 1033

Query:  968 RNIFYMPYWMIYGEVFADSIDPPCGEHLYDEDGKRLPPCIPGAWLTPAIMACYXXXXXXX 1027
            ..| . |||||.|||.|  ||    . .  .       | || |||| . | |       
Sbjct: 1034 KDIVFHPYWMIFGEVYAYEIDVCANDSVIPQ------ICGPGTWLTPFLQAVYLFVQYII 1087

Query: 1028 XXXXXXXVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRXXXXXXXXXXXXXXXXCNRMFR 1087
                    ||| . .||.||| |||.|||  || .|..                   .  
Sbjct: 1088 MVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIMAYHEKPVLPPPLIILSHIVSLFCCI-- 1145

Query: 1088 RCAKKKQDGELDEKDRGLKLRLNPEELKILYEFEEQCVEEYFREKXXXXXXXXXXRIKVT 1147
             | ..|.|   |    | || |  |. | |..||||||| || ||          ||.||
Sbjct: 1146 -CKRRKKDKTSD----GPKLFLTEEDQKKLHDFEEQCVEMYFNEKDDKFHSGSEERIRVT 1200

Query: 1148 SERVENMFMRLEEVNERENTMKASLQTVDLRLAQLEEIHGRMAVALEKLAGVDRLELTRT 1207
             |||| | ....|| .| | .| |||..| ..  |...       |. |      | .. 
Sbjct: 1201 FERVEQMCIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTLTAQKASEASKV 1260

Query: 1208 YS 1209
            ..
Sbjct: 1261 HN 1262

>hg18||uc004aie |9|BC094699|Q504Y1|Q504Y1_HUMAN|TRPM3|NA|NA|TRPM3 protein

          Length = 323

 Score =  463 bits (1189), Expect = 1e-129
 Identities = 217/272 (79%), Positives = 252/272 (92%)

Query:  92 MYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVT 151
           ||.|||.||||| ||||| |.|||||| ||||||||||||.|||||||||||||||||.|
Sbjct:   1 MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT 60

Query: 152 TGAWIFTGGVNTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQ 211
           |||||||||||||||||||||||||.||||||.| ||||||||.||.|||||.|| | ||
Sbjct:  61 TGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQ 120

Query: 212 SMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTRLGQGVPLV 271
           .|.||.||| |||| |||||| |||| ||||.|||||| |||||||||||||.|||||.|
Sbjct: 121 TMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVV 180

Query: 272 CLIVEGGPNVISIALESLRDEPPIPVVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQL 331
            |||||||||||| || ||| ||.||||||||||||||..| ||.||.|||.|. .|.||
Sbjct: 181 ALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQL 240

Query: 332 LVTIQKTFNYSKSQSQQILLMVMECMKKRELI 363
           |||||||| |...|.| . ...||||||.||.
Sbjct: 241 LVTIQKTFTYTRTQAQHLFIILMECMKKKELV 272

>hg18||uc004aig
        |9|NM_206948|Q5T8N8|Q5T8N8_HUMAN|TRPM3|NM_206948|NP_996831|transient
        receptor potential cation channel,

          Length = 230

 Score =  406 bits (1043), Expect = 9e-113
 Identities = 193/230 (83%), Positives = 214/230 (93%)

Query:  92 MYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVT 151
           ||.|||.||||| ||||| |.|||||| ||||||||||||.|||||||||||||||||.|
Sbjct:   1 MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT 60

Query: 152 TGAWIFTGGVNTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQ 211
           |||||||||||||||||||||||||.||||||.| ||||||||.||.|||||.|| | ||
Sbjct:  61 TGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQ 120

Query: 212 SMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTRLGQGVPLV 271
           .|.||.||| |||| |||||| |||| ||||.|||||| |||||||||||||.|||||.|
Sbjct: 121 TMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVV 180

Query: 272 CLIVEGGPNVISIALESLRDEPPIPVVVCDGSGRASDIISFAHKFSEDGG 321
            |||||||||||| || ||| ||.||||||||||||||..| ||.||.||
Sbjct: 181 ALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG 230

>hg18||uc004aii |9|AL136545|Q5T2G1|Q5T2G1_HUMAN|TRPM3|NA|NA|Transient receptor
        potential cation channel, subfamily M, member 3

          Length = 328

 Score =  404 bits (1038), Expect = 4e-112
 Identities = 196/261 (75%), Positives = 220/261 (84%), Gaps = 4/261 (1%)

Query:   6 WIERNFLKRECIHIFP-TKDPTRCACGQLTTQHVAIPPGANSVE---ETIQLVQIDTPKD 61
           |||| | ||||.|| | |||| || ||.|  ||| . |  . ..      .| . |   .
Sbjct:  66 WIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSE 125

Query:  62 KWSIIKHTRTYPTDAFGVIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLELPTLL 121
           |||| |||.  |||||| |||||||  |||||.|||.||||| ||||| |.|||||| ||
Sbjct: 126 KWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLL 185

Query: 122 ISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKDHSSKSR 181
           ||||||||||.|||||||||||||||||.||||||||||||||||||||||||||.||||
Sbjct: 186 ISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSR 245

Query: 182 GKVCAIGIAPWGILENKEDLIGKDVTRSYQSMANPLSKLAVLNSSHSHFILTDNGTCGKY 241
           ||.| ||||||||.||.|||||.|| | ||.|.||.||| |||| |||||| |||| |||
Sbjct: 246 GKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKY 305

Query: 242 GSEVKLRRLLEKHISLQKINT 262
           |.|||||| ||||||||||||
Sbjct: 306 GAEVKLRRQLEKHISLQKINT 326

>hg18||uc001lwm
        |11|NM_014555|Q9NZQ8|Q9NZQ8_HUMAN|TRPM5|NM_014555|NP_055370|transient
        receptor potential cation channel,

          Length = 1165

 Score =  370 bits (949), Expect = 7e-102
 Identities = 300/1142 (26%), Positives = 502/1142 (43%), Gaps = 114/1142 (9%)

Query:   78 GVIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKL 137
            | . | | |   .  ..||     |  |  |.. .| |  | |..|. |  | | ..  |
Sbjct:   26 GEVNFGGSG-KKRGKFVRVPSGVAPSVLFDLLLAEWHLPAPNLVVSLVGEEQPFAMKSWL 84

Query:  138 KQVFGKGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKDH---SSKSRGKVCAIGIAPWG- 193
            . |  |||.||| .||||| |  .  |. |||| |..||   |. .. .| |.|.|  | 
Sbjct:   85 RDVLRKGLVKAAQSTGAWILTSALRVGLARHVGQAVRDHSLASTSTKVRVVAVGMASLGR 144

Query:  194 -----ILENKEDLIGKDVTRSYQSMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLR 248
                 |||  ..               ||     |.|. ||||| . |  ||     .||
Sbjct:  145 VLHRRILEEAQEDFPVHYPEDDGGSQGPLCS---LDSNLSHFILVEPGPPGKGDGLTELR 201

Query:  249 RLLEKHISLQKINTRLGQG------VPLVCLIVEGGPNVISIALESLRDEPPIPVVVCDG 302
              |||||| |    | | |      .|..||.| | || .     ..    |  ..|  |
Sbjct:  202 LRLEKHISEQ----RAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV--G 255

Query:  303 SGRASDIISFAHKFSEDGGLVNDDVREQLLVTIQKTFNYSKSQSQQILLMVMECMKKREL 362
            ||  .|...          |.   | |.       . ..|     .   ..      . |
Sbjct:  256 SGGIADVLA---ALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDIVRWTKLLQNITSHQHL 312

Query:  363 ITVFRMGSEGQQDIEMAILTALLKGTNXXX------XXXXXXXXXWNRVDIARNHIFVYG 416
            .||.    || ....  || ||.|                     |.|||||.. ||   
Sbjct:  313 LTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLDELKLAVAWDRVDIAKSEIFNGD 372

Query:  417 HNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTKLGPANTLNAV 476
                   ||. |.|||| .. .||.| ..|| ..  |||  ||.||| .    .   . .
Sbjct:  373 VEWKSCDLEEVMVDALVSNKPEFVRLFVDNGADVADFLTYGRLQELYRSVSRKSLLFDLL 432

Query:  477 VRDVKKGNL----------------PPDYQITLIDIGLVLECFMGGAYRSNYTRKAFRNL 520
             |  ..  |                || .  .| ..  ||. |.  | |  |      . 
Sbjct:  433 QRKQEEARLTLAGLGTQQAREPPAGPPAF--SLHEVSRVLKDFLQDACRGFYQDGRPGDR 490

Query:  521 YNNLYG-LKRPKALK-LLGMEDDXXXXXXXXXXXXXXXXXXXXXXXXXXXCRFKFPFHEL 578
                 |  |||   | || .                               . . |. .|
Sbjct:  491 RRAEKGPAKRPTGQKWLLDLNQ-----------------------------KSENPWRDL 521

Query:  579 MLWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDISQDLENNSKE 638
             |||||  | .|| . |  |.| .| || |||. | |.|  .|.|              .
Sbjct:  522 FLWAVLQNRHEMATYFWAMGQEGVAAALAACKILKEMSHLETEAEAA------RATREAK 575

Query:  639 FGQLAYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAHTCSQMLLTD 698
            . .|| .|  . | . |  |  ||      || .||| ||  |  . | ||   |  || 
Sbjct:  576 YERLALDLFSECYSNSEARAFALLVRRNRCWSKTTCLHLATEADAKAFFAHDGVQAFLTR 635

Query:  699 MWMGRLRIGKNPSLKVXXXXXXXXXXXXXXXXXXXDSSFHAPXXXXXXXXXXDDTKSSKD 758
            .| | .  |  | |..                   ..               |   . | 
Sbjct:  636 IWWGDMAAG-TPILRLLGAFLCPALVYTNLITFSEEAPLR---TGLEDLQDLDSLDTEKS 691

Query:  759 PNPDATSR-----RGDEEEGSANVRKIPIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNY 813
            |     ||          .|    | . .  |. .|. || | |  | . |  .| |. |
Sbjct:  692 PLYGLQSRVEELVEAPRAQGDRGPRAVFLLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTY 751

Query:  814 IILVKME---RWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLKQKISVWLEEYWNIT 870
            ..||      . ||  |  .  .. ||  |..||      |   | .| .... . ||  
Sbjct:  752 VLLVDFRPPPQGPSGPEVTLYFWVFTLVLEEIRQG-FFTDEDTHLVKKFTLYVGDNWNKC 810

Query:  871 DLAAICTFLLGLMLRLQQEPYMGYGRVIYCIDIIFWYIRVLDIFGVNKYLGPYVXXXXXX 930
            |. ||  |..|.  |.    .   || .  .| . . .|.. || ..| ||| .      
Sbjct:  811 DMVAIFLFIVGVTCRMLPSAFEA-GRTVLAMDFMVFTLRLIHIFAIHKQLGPKIIVVERM 869

Query:  931 XXXXXYFVVIMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDPP 990
                 .|.  . | |...||  ||.||| .     . | . | ||  |.|..  | ||  
Sbjct:  870 MKDVFFFLFFLSVWLVAYGVTTQALLHPHDGRLEWIFRRVLYRPYLQIFGQIPLDEIDEA 929

Query:  991 ---CGEHLYDEDGKRLPPCIPGAWLTPAIMACYXXXXXXXXXXXXXXVFNNTFFEVKSIS 1047
               |  |    .     | .   ||   ..  .              .|. ||  |.  .
Sbjct:  930 RVNCSTHPLLLEDSPSCPSLYANWLVILLLVTFLLVTNVLLMNLLIAMFSYTFQVVQGNA 989

Query: 1048 NQVWKFQRYQLIMTFHDRXXXXXXXXXXXXXXXXCNRMFRRCAKKKQDGELDEKDRGLKL 1107
            .  |||||| ||. .|.|                  |.|.. |. |.    .  .| |  
Sbjct:  990 DMFWKFQRYNLIVEYHERPALAPPFILLSHLSLTLRRVFKKEAEHKR----EHLERDLP- 1044

Query: 1108 RLNPEELKILYEFEEQCVEEYFREKXXXXXXXXXXRIKVTSERVENMFMRLEEVNERENT 1167
              .| . |..  .|    | .  .            .. |. ||. .   |  . |.|  
Sbjct: 1045 --DPLDQKVV-TWETVQKENFLSKMEKRRRDSEGEVLRKTAHRVDFIAKYLGGLREQEKR 1101

Query: 1168 MK 1169
            .|
Sbjct: 1102 IK 1103

>hg18||uc001zyu |15|BC051024|NA|NA|TRPM7|NM_017672|NP_060142|transient receptor
        potential cation channel,

          Length = 556

 Score =  362 bits (927), Expect = 3e-099
 Identities = 185/377 (49%), Positives = 250/377 (66%), Gaps = 25/377 (6%)

Query: 570 RFKFPFHELMLWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDIS 629
           || .| .||..|| ||||| || |||| |||.|||||||||.|..||.|  .|.|||| |
Sbjct: 175 RFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTS 234

Query: 630 QDLENNSKEFGQLAYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAH 689
           ..|.  | .||||| |||.||.. || .||||||||| ||||||||||||... | |.||
Sbjct: 235 EELKQYSNDFGQLAVELLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAH 294

Query: 690 TCSQMLLTDMWMGRLRIGKNPSLKVXXXXXXXXXXXXXXXXXXXDSSFHAPXXXXXXXXX 749
           ||.||||.||||||| . ||   ||                   . | | |         
Sbjct: 295 TCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILLLEYKTKAEMS-HIPQSQDAHQMT 353

Query: 750 XDDTKSS-------------KDPNPDATSRRGDEEEGSANVRKIPIGKRFFEFYDAPFTK 796
            ||....             |.     ..   .| |     .|.|| ..|. || ||  |
Sbjct: 354 MDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFYHAPIVK 413

Query: 797 FWFNTISYLGYLMLYNYIILVKMERWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLK 856
           |||||..|||.|||| ...||.||. ||.||||||.|| |   ||||.  | ||| ||. 
Sbjct: 414 FWFNTLAYLGFLMLYTFVVLVQMEQLPSVQEWIVIAYIFTYAIEKVRE--IFMSEAGKVN 471

Query: 857 QKISVWLEEYWNITDLAAICTFLLGLMLRLQQE-----PYMGY----GRVIYCIDIIFWY 907
           ||| ||  .|.||.|  || .| .|  ||   .      |  .    ||.|||..|||||
Sbjct: 472 QKIKVWFSDYFNISDTIAIISFFIGFGLRFGAKWNFANAYDNHVFVAGRLIYCLNIIFWY 531

Query: 908 IRVLDIFGVNKYLGPYV 924
           .|.||   ||.  ||||
Sbjct: 532 VRLLDFLAVNQQAGPYV 548

>hg18||uc004ahu
        |9|AF536750|Q9HCF6-6|Q9HCF6-6|TRPM3|NM_024971|NP_079247|transient
        receptor potential cation channel,

          Length = 1549

 Score =  340 bits (870), Expect = 1e-092
 Identities = 160/247 (64%), Positives = 195/247 (78%), Gaps = 5/247 (2%)

Query:  760 NPDATSRRGDEEEGSANVRKIPIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNYIILVKM 819
            |   .||. ||||  .  | ||.|.. .|||.||  |||| |..|.|||||.|||.||||
Sbjct:  666 NNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKM 725

Query:  820 ERWPSMQEWIVISYILTLGTEKVRQARILMSEPGKLKQKISVWLEEYWNITDLAAICTFL 879
            ||||| ||||||||| ||| ||.|.  ||||||||| ||. |||.||||.||| ||  | 
Sbjct:  726 ERWPSTQEWIVISYIFTLGIEKMRE--ILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFS 783

Query:  880 LGLMLRLQQEPYMGYGRVIYCIDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVV 939
            .|..|||| .|.   ||||||..||.||||.||||||||||||||           |||.
Sbjct:  784 VGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVI 843

Query:  940 IMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDPPCGEHLYDED 999
            ||||||||||||||||| |.|||.|.||.||||||||||||||||| ||    . .||  
Sbjct:  844 IMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQID---RKQVYDSH 900

Query: 1000 GKRLPPC 1006
              .  ||
Sbjct:  901 TPKSAPC 907

>hg18||uc002zet
        |21|AB166745|O94759|TRPM2_HUMAN|TRPM2|NM_003307|NP_003298|transient
        receptor potential cation channel,

          Length = 1503

 Score =  334 bits (854), Expect = 8e-091
 Identities = 228/724 (31%), Positives = 363/724 (50%), Gaps = 59/724 (8%)

Query:   6 WIERNFLKRECIHIFPTK-----DPTRCACGQLTTQHVAIPPGANSVEETIQLVQIDTPK 60
           ||  |  |.||..   .          | ||    ||.      .. . |          
Sbjct:  62 WIPENIKKKECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGT---------- 111

Query:  61 DKWSIIKHTRTYPTDAFGVIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLELPTL 120
            .|   || .  |||||| | | |     |  |.||| ||    . ||| . | |..| |
Sbjct: 112 -QWDPKKHVQEMPTDAFGDIVFTGLSQKVK-KYVRVSQDTPSSVIYHLMTQHWGLDVPNL 169

Query: 121 LISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKD---HS 177
           |||| || .||...|.|| .| .||.| | |||||| ||| .|||.. ||.|..|    |
Sbjct: 170 LISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSS 229

Query: 178 SKSRGKVCAIGIAPWGILENKEDLIGK--DVTRSYQSMANPLSKLAVLNSSHSHFILTDN 235
           |   |..  ||.| || .  .| ||         |    .    |  |.|.|||||| |.
Sbjct: 230 SYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDD 289

Query: 236 GTCGKYGSEVKLRRLLEKHISLQ-KINTRLGQGVPLVCLIVEGGPNVISIALESLRDEPP 294
           || |.|| |. ||  ||| || | |    .   .|.||...||||  .     .  .   
Sbjct: 290 GTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTN--G 347

Query: 295 IPVVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQLLVTIQKTF-NYSKSQSQQILLMV 353
            | || .|||| .|.|.          .    ....| |  |. |  ...|.  .    .
Sbjct: 348 TPCVVVEGSGRVADVIAQVANLPV-SDITISLIQQKLSVFFQEMFETFTESRIVEWTKKI 406

Query: 354 MECMKKRELITVFRMGSEGQQDIEMAILTALLKGTNXXX-------XXXXXXXXXWNRVD 406
            . ...|.|.|||| | .||||...||| |||| .                    |||||
Sbjct: 407 QDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVD 466

Query: 407 IARNHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTK 466
           |||. ||.       . |   |  ||. .. .|||| ||||| .  |.|   |  ||   
Sbjct: 467 IARSEIFMDEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYE-N 525

Query: 467 LGPANTLNAVVRDVKKGNLPPDYQITLIDIGLVLECFMGGAYR---SNYTRKAF-RNLYN 522
           | |.   .. .. |   .  |.          .    .    |    ..|.  . |  .|
Sbjct: 526 LDPSCLFHSKLQKVLVED--PERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHN 583

Query: 523 NLYGLKRPKALKLLGMEDDXXXXXXXXXXXXXXXXXXXXXXXXXXXCRFKFPFHELMLWA 582
           .   |  |     | ..                                  |  .|..||
Sbjct: 584 DRLRLLLPVPHVKLNVQGVSLRSLYKRSSGHVTFTMD--------------PIRDLLIWA 629

Query: 583 VLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDISQDLENNSKEFGQL 642
           ..  |...|  .| . .. .| ||   |. |    | |. |   | |...   ..|.   
Sbjct: 630 IVQNRRELAGIIWAQSQDCIAAALACSKILK----ELSKEEEDTDSSEEMLALAEEYEHR 685

Query: 643 AYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAHTCSQMLLTDMWMG 702
           |  .  . |. ||. | ||||     |  .|||.||. ||   |..|   |  || .| |
Sbjct: 686 AIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWG 745

Query: 703 RLRI 706
           .| .
Sbjct: 746 QLSV 749

>hg18||uc002zeu
        |21|AB001535|O94759|TRPM2_HUMAN|TRPM2|NM_003307|NP_003298|transient
        receptor potential cation channel,

          Length = 1503

 Score =  334 bits (854), Expect = 8e-091
 Identities = 228/724 (31%), Positives = 363/724 (50%), Gaps = 59/724 (8%)

Query:   6 WIERNFLKRECIHIFPTK-----DPTRCACGQLTTQHVAIPPGANSVEETIQLVQIDTPK 60
           ||  |  |.||..   .          | ||    ||.      .. . |          
Sbjct:  62 WIPENIKKKECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGT---------- 111

Query:  61 DKWSIIKHTRTYPTDAFGVIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLELPTL 120
            .|   || .  |||||| | | |     |  |.||| ||    . ||| . | |..| |
Sbjct: 112 -QWDPKKHVQEMPTDAFGDIVFTGLSQKVK-KYVRVSQDTPSSVIYHLMTQHWGLDVPNL 169

Query: 121 LISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKD---HS 177
           |||| || .||...|.|| .| .||.| | |||||| ||| .|||.. ||.|..|    |
Sbjct: 170 LISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSS 229

Query: 178 SKSRGKVCAIGIAPWGILENKEDLIGK--DVTRSYQSMANPLSKLAVLNSSHSHFILTDN 235
           |   |..  ||.| || .  .| ||         |    .    |  |.|.|||||| |.
Sbjct: 230 SYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDD 289

Query: 236 GTCGKYGSEVKLRRLLEKHISLQ-KINTRLGQGVPLVCLIVEGGPNVISIALESLRDEPP 294
           || |.|| |. ||  ||| || | |    .   .|.||...||||  .     .  .   
Sbjct: 290 GTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTN--G 347

Query: 295 IPVVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQLLVTIQKTF-NYSKSQSQQILLMV 353
            | || .|||| .|.|.          .    ....| |  |. |  ...|.  .    .
Sbjct: 348 TPCVVVEGSGRVADVIAQVANLPV-SDITISLIQQKLSVFFQEMFETFTESRIVEWTKKI 406

Query: 354 MECMKKRELITVFRMGSEGQQDIEMAILTALLKGTNXXX-------XXXXXXXXXWNRVD 406
            . ...|.|.|||| | .||||...||| |||| .                    |||||
Sbjct: 407 QDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVD 466

Query: 407 IARNHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTK 466
           |||. ||.       . |   |  ||. .. .|||| ||||| .  |.|   |  ||   
Sbjct: 467 IARSEIFMDEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYE-N 525

Query: 467 LGPANTLNAVVRDVKKGNLPPDYQITLIDIGLVLECFMGGAYR---SNYTRKAF-RNLYN 522
           | |.   .. .. |   .  |.          .    .    |    ..|.  . |  .|
Sbjct: 526 LDPSCLFHSKLQKVLVED--PERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHN 583

Query: 523 NLYGLKRPKALKLLGMEDDXXXXXXXXXXXXXXXXXXXXXXXXXXXCRFKFPFHELMLWA 582
           .   |  |     | ..                                  |  .|..||
Sbjct: 584 DRLRLLLPVPHVKLNVQGVSLRSLYKRSSGHVTFTMD--------------PIRDLLIWA 629

Query: 583 VLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDISQDLENNSKEFGQL 642
           ..  |...|  .| . .. .| ||   |. |    | |. |   | |...   ..|.   
Sbjct: 630 IVQNRRELAGIIWAQSQDCIAAALACSKILK----ELSKEEEDTDSSEEMLALAEEYEHR 685

Query: 643 AYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAHTCSQMLLTDMWMG 702
           |  .  . |. ||. | ||||     |  .|||.||. ||   |..|   |  || .| |
Sbjct: 686 AIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWG 745

Query: 703 RLRI 706
           .| .
Sbjct: 746 QLSV 749

>hg18||uc002zev
        |21|NM_001001188|O94759-3|O94759-3|TRPM2|NM_001001188|NP_001001188|tran
        sient receptor potential cation channel,

          Length = 846

 Score =  334 bits (854), Expect = 8e-091
 Identities = 228/724 (31%), Positives = 363/724 (50%), Gaps = 59/724 (8%)

Query:   6 WIERNFLKRECIHIFPTK-----DPTRCACGQLTTQHVAIPPGANSVEETIQLVQIDTPK 60
           ||  |  |.||..   .          | ||    ||.      .. . |          
Sbjct:  62 WIPENIKKKECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGT---------- 111

Query:  61 DKWSIIKHTRTYPTDAFGVIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLELPTL 120
            .|   || .  |||||| | | |     |  |.||| ||    . ||| . | |..| |
Sbjct: 112 -QWDPKKHVQEMPTDAFGDIVFTGLSQKVK-KYVRVSQDTPSSVIYHLMTQHWGLDVPNL 169

Query: 121 LISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKD---HS 177
           |||| || .||...|.|| .| .||.| | |||||| ||| .|||.. ||.|..|    |
Sbjct: 170 LISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSS 229

Query: 178 SKSRGKVCAIGIAPWGILENKEDLIGK--DVTRSYQSMANPLSKLAVLNSSHSHFILTDN 235
           |   |..  ||.| || .  .| ||         |    .    |  |.|.|||||| |.
Sbjct: 230 SYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDD 289

Query: 236 GTCGKYGSEVKLRRLLEKHISLQ-KINTRLGQGVPLVCLIVEGGPNVISIALESLRDEPP 294
           || |.|| |. ||  ||| || | |    .   .|.||...||||  .     .  .   
Sbjct: 290 GTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTN--G 347

Query: 295 IPVVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQLLVTIQKTF-NYSKSQSQQILLMV 353
            | || .|||| .|.|.          .    ....| |  |. |  ...|.  .    .
Sbjct: 348 TPCVVVEGSGRVADVIAQVANLPV-SDITISLIQQKLSVFFQEMFETFTESRIVEWTKKI 406

Query: 354 MECMKKRELITVFRMGSEGQQDIEMAILTALLKGTNXXX-------XXXXXXXXXWNRVD 406
            . ...|.|.|||| | .||||...||| |||| .                    |||||
Sbjct: 407 QDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVD 466

Query: 407 IARNHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTK 466
           |||. ||.       . |   |  ||. .. .|||| ||||| .  |.|   |  ||   
Sbjct: 467 IARSEIFMDEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYE-N 525

Query: 467 LGPANTLNAVVRDVKKGNLPPDYQITLIDIGLVLECFMGGAYR---SNYTRKAF-RNLYN 522
           | |.   .. .. |   .  |.          .    .    |    ..|.  . |  .|
Sbjct: 526 LDPSCLFHSKLQKVLVED--PERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHN 583

Query: 523 NLYGLKRPKALKLLGMEDDXXXXXXXXXXXXXXXXXXXXXXXXXXXCRFKFPFHELMLWA 582
           .   |  |     | ..                                  |  .|..||
Sbjct: 584 DRLRLLLPVPHVKLNVQGVSLRSLYKRSSGHVTFTMD--------------PIRDLLIWA 629

Query: 583 VLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDISQDLENNSKEFGQL 642
           ..  |...|  .| . .. .| ||   |. |    | |. |   | |...   ..|.   
Sbjct: 630 IVQNRRELAGIIWAQSQDCIAAALACSKILK----ELSKEEEDTDSSEEMLALAEEYEHR 685

Query: 643 AYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAHTCSQMLLTDMWMG 702
           |  .  . |. ||. | ||||     |  .|||.||. ||   |..|   |  || .| |
Sbjct: 686 AIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWG 745

Query: 703 RLRI 706
           .| .
Sbjct: 746 QLSV 749

>hg18||uc002zew
        |21|NM_003307|O94759|TRPM2_HUMAN|TRPM2|NM_003307|NP_003298|transient
        receptor potential cation channel,

          Length = 1503

 Score =  334 bits (854), Expect = 8e-091
 Identities = 228/724 (31%), Positives = 363/724 (50%), Gaps = 59/724 (8%)

Query:   6 WIERNFLKRECIHIFPTK-----DPTRCACGQLTTQHVAIPPGANSVEETIQLVQIDTPK 60
           ||  |  |.||..   .          | ||    ||.      .. . |          
Sbjct:  62 WIPENIKKKECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGT---------- 111

Query:  61 DKWSIIKHTRTYPTDAFGVIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLELPTL 120
            .|   || .  |||||| | | |     |  |.||| ||    . ||| . | |..| |
Sbjct: 112 -QWDPKKHVQEMPTDAFGDIVFTGLSQKVK-KYVRVSQDTPSSVIYHLMTQHWGLDVPNL 169

Query: 121 LISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKD---HS 177
           |||| || .||...|.|| .| .||.| | |||||| ||| .|||.. ||.|..|    |
Sbjct: 170 LISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSS 229

Query: 178 SKSRGKVCAIGIAPWGILENKEDLIGK--DVTRSYQSMANPLSKLAVLNSSHSHFILTDN 235
           |   |..  ||.| || .  .| ||         |    .    |  |.|.|||||| |.
Sbjct: 230 SYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDD 289

Query: 236 GTCGKYGSEVKLRRLLEKHISLQ-KINTRLGQGVPLVCLIVEGGPNVISIALESLRDEPP 294
           || |.|| |. ||  ||| || | |    .   .|.||...||||  .     .  .   
Sbjct: 290 GTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTN--G 347

Query: 295 IPVVVCDGSGRASDIISFAHKFSEDGGLVNDDVREQLLVTIQKTF-NYSKSQSQQILLMV 353
            | || .|||| .|.|.          .    ....| |  |. |  ...|.  .    .
Sbjct: 348 TPCVVVEGSGRVADVIAQVANLPV-SDITISLIQQKLSVFFQEMFETFTESRIVEWTKKI 406

Query: 354 MECMKKRELITVFRMGSEGQQDIEMAILTALLKGTNXXX-------XXXXXXXXXWNRVD 406
            . ...|.|.|||| | .||||...||| |||| .                    |||||
Sbjct: 407 QDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVD 466

Query: 407 IARNHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTK 466
           |||. ||.       . |   |  ||. .. .|||| ||||| .  |.|   |  ||   
Sbjct: 467 IARSEIFMDEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYE-N 525

Query: 467 LGPANTLNAVVRDVKKGNLPPDYQITLIDIGLVLECFMGGAYR---SNYTRKAF-RNLYN 522
           | |.   .. .. |   .  |.          .    .    |    ..|.  . |  .|
Sbjct: 526 LDPSCLFHSKLQKVLVED--PERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHN 583

Query: 523 NLYGLKRPKALKLLGMEDDXXXXXXXXXXXXXXXXXXXXXXXXXXXCRFKFPFHELMLWA 582
           .   |  |     | ..                                  |  .|..||
Sbjct: 584 DRLRLLLPVPHVKLNVQGVSLRSLYKRSSGHVTFTMD--------------PIRDLLIWA 629

Query: 583 VLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDISQDLENNSKEFGQL 642
           ..  |...|  .| . .. .| ||   |. |    | |. |   | |...   ..|.   
Sbjct: 630 IVQNRRELAGIIWAQSQDCIAAALACSKILK----ELSKEEEDTDSSEEMLALAEEYEHR 685

Query: 643 AYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAHTCSQMLLTDMWMG 702
           |  .  . |. ||. | ||||     |  .|||.||. ||   |..|   |  || .| |
Sbjct: 686 AIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWG 745

Query: 703 RLRI 706
           .| .
Sbjct: 746 QLSV 749

>hg18||uc004ahx
        |9|NM_024971|Q9HCF6-3|Q9HCF6-3|TRPM3|NM_024971|NP_079247|transient
        receptor potential cation channel,

          Length = 1566

 Score =  332 bits (849), Expect = 3e-090
 Identities = 168/233 (72%), Positives = 185/233 (79%), Gaps = 1/233 (0%)

Query: 482 KGNLPPDYQITLIDIGLVLECFMGGAYRSNYTRKAFRNLYNNLYGLKRPKALKLLGMEDD 541
           ||||||||.|.|||||||.|  |||||| ||||| || ||.||.| ||||||||||||||
Sbjct: 403 KGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDD 462

Query: 542 XXXXXXXXXXXXXXXXXXXXXXXXXXXCRFKFPFHELMLWAVLMKRQKMALFLWQRGEEA 601
                                        | |||||||.||||||||||||| || ||||
Sbjct: 463 IPLRRGRKTTKKREEEVDIDLDDPEIN-HFPFPFHELMVWAVLMKRQKMALFFWQHGEEA 521

Query: 602 MAKALVACKLYKAMAHECSESELVDDISQDLENNSKEFGQLAYELLDQSYKHDEQVAMKL 661
           |||||||||| |||||| ||...||||||.| .||..||||| |||||||| |||.||||
Sbjct: 522 MAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKL 581

Query: 662 LTYELVNWSNSTCLKLAVAAKQRDFIAHTCSQMLLTDMWMGRLRIGKNPSLKV 714
           ||||| ||||.|||.|||||| ||||||||||||||||||||||. ||  |||
Sbjct: 582 LTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKV 634

>hg18||uc004ahw
        |9|NM_206946|Q9HCF6|TRPM3_HUMAN|TRPM3|NM_206946|NP_996829|transient
        receptor potential cation channel,

          Length = 1579

 Score =  309 bits (791), Expect = 2e-083
 Identities = 147/172 (85%), Positives = 161/172 (93%)

Query:  92 MYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVT 151
           ||.|||.||||| ||||| |.|||||| ||||||||||||.|||||||||||||||||.|
Sbjct:   1 MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT 60

Query: 152 TGAWIFTGGVNTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQ 211
           |||||||||||||||||||||||||.||||||.| ||||||||.||.|||||.|| | ||
Sbjct:  61 TGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQ 120

Query: 212 SMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTR 263
           .|.||.||| |||| |||||| |||| ||||.|||||| |||||||||||||
Sbjct: 121 TMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTR 172

>hg18||uc004ahy
        |9|NM_206947|Q9HCF6-7|Q9HCF6-7|TRPM3|NM_206947|NP_996830|transient
        receptor potential cation channel,

          Length = 1569

 Score =  309 bits (791), Expect = 2e-083
 Identities = 147/172 (85%), Positives = 161/172 (93%)

Query:  92 MYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVT 151
           ||.|||.||||| ||||| |.|||||| ||||||||||||.|||||||||||||||||.|
Sbjct:   1 MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT 60

Query: 152 TGAWIFTGGVNTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQ 211
           |||||||||||||||||||||||||.||||||.| ||||||||.||.|||||.|| | ||
Sbjct:  61 TGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQ 120

Query: 212 SMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTR 263
           .|.||.||| |||| |||||| |||| ||||.|||||| |||||||||||||
Sbjct: 121 TMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTR 172

>hg18||uc004aif
        |9|NM_001007470|Q5T8N2|Q5T8N2_HUMAN|TRPM3|NM_001007470|NP_001007471|tra
        nsient receptor potential cation channel,

          Length = 255

 Score =  309 bits (791), Expect = 2e-083
 Identities = 147/172 (85%), Positives = 161/172 (93%)

Query:  92 MYIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVT 151
           ||.|||.||||| ||||| |.|||||| ||||||||||||.|||||||||||||||||.|
Sbjct:   1 MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMT 60

Query: 152 TGAWIFTGGVNTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQ 211
           |||||||||||||||||||||||||.||||||.| ||||||||.||.|||||.|| | ||
Sbjct:  61 TGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQ 120

Query: 212 SMANPLSKLAVLNSSHSHFILTDNGTCGKYGSEVKLRRLLEKHISLQKINTR 263
           .|.||.||| |||| |||||| |||| ||||.|||||| |||||||||||||
Sbjct: 121 TMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTR 172

>hg18||uc004ajn |9|AK057748|Q96LV9|Q96LV9_HUMAN|TRPM6|NA|NA|CDNA FLJ25019 fis,
        clone CBL01642 (Transient receptor potential cation channel, subfamily
        M, member 6)

          Length = 303

 Score =  284 bits (726), Expect = 5e-076
 Identities = 146/267 (54%), Positives = 182/267 (68%), Gaps = 20/267 (7%)

Query:  11 FLKRECIHIFP-TKDPTRCA-------------CGQLTTQHVAIPPGANSVEETIQLVQI 56
           | ||||  | | .|.| ||              ||.|   |  |         ||   . 
Sbjct:  21 FDKRECSTIIPSSKNPHRCTPVCQVCQNLIRCYCGRLIGDHAGI-----DYSWTISAAK- 74

Query:  57 DTPKDKWSIIKHTRTYPTDAFGVIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLE 116
               ..||. |||   ||| || | || |   . | ||| ||||| |.|||||.|.|..|
Sbjct:  75 GKESEQWSVEKHTTKSPTDTFGTINFQDGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKME 134

Query: 117 LPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKDH 176
           || |.||||||.||| .  | |..| .||.||| |||||| | |.|||| .||||||| |
Sbjct: 135 LPKLVISVHGGIQNFTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSH 194

Query: 177 SSKSRGKVCAIGIAPWGILENKEDLIGKDVTRSYQSMANPLSKLAVLNSSHSHFILTDNG 236
           || |  |.  .|| |||..||. |||||||   ||.. ||||||  ||| ||||||.|.|
Sbjct: 195 SSHSLRKIWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKLTTLNSMHSHFILSDDG 254

Query: 237 TCGKYGSEVKLRRLLEKHISLQKINTR 263
           | ||||.|.|||| |||..|||||. |
Sbjct: 255 TVGKYGNEMKLRRNLEKYLSLQKIHCR 281

>hg18||uc004ahu
        |9|AF536750|Q9HCF6-6|Q9HCF6-6|TRPM3|NM_024971|NP_079247|transient
        receptor potential cation channel,

          Length = 1549

 Score =  247 bits (628), Expect = 1e-064
 Identities = 133/244 (54%), Positives = 162/244 (66%), Gaps = 5/244 (2%)

Query:  990 PCGEHLYDEDGK--RLPPCIPGAWLTPAIMACYXXXXXXXXXXXXXXVFNNTFFEVKSIS 1047
            |||..   ||||  .||||  |||. |||||||              |||||||||||||
Sbjct:  906 PCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSIS 965

Query: 1048 NQVWKFQRYQLIMTFHDRXXXXXXXXXXXXXXXXCNRMFRRCAKKKQDGELDEKDRGLKL 1107
            ||||||||||||||||.|                   .   |  .| . . ||.| ||||
Sbjct:  966 NQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLC--CRWRKHESDPDERDYGLKL 1023

Query: 1108 RLNPEELKILYEFEEQCVEEYFREKXXXXXXXXXXRIKVTSERVENMFMRLEEVNERENT 1167
             .  .||| ...|||||.|||||||          ||.||||||||| ||||||||||..
Sbjct: 1024 FITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHS 1083

Query: 1168 MKASLQTVDLRLAQLEEIHGRMAVALEKLAGVDRLELTRTYSRNSSVC-DPSSLHRQGSI 1226
            |||||||||.||||||.. |||| |||.| |..| |  .  || || | | . . || | 
Sbjct: 1084 MKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSF 1143

Query: 1227 NSAD 1230
            || .
Sbjct: 1144 NSQE 1147

>hg18||uc004ahv
        |9|AB099665|Q9HCF6-8|Q9HCF6-8|TRPM3|NM_206944|NP_996827|transient
        receptor potential cation channel,

          Length = 1509

 Score =  247 bits (628), Expect = 1e-064
 Identities = 119/144 (82%), Positives = 131/144 (90%)

Query: 571 FKFPFHELMLWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDISQ 630
           | |||||||.||||||||||||| || |||||||||||||| |||||| ||...||||||
Sbjct: 434 FPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQ 493

Query: 631 DLENNSKEFGQLAYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAHT 690
           .| .||..||||| |||||||| |||.||||||||| ||||.|||.|||||| |||||||
Sbjct: 494 ELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHT 553

Query: 691 CSQMLLTDMWMGRLRIGKNPSLKV 714
           |||||||||||||||. ||  |||
Sbjct: 554 CSQMLLTDMWMGRLRMRKNSGLKV 577

>hg18||uc002pmw
        |19|NM_017636|Q8TD43|TRPM4_HUMAN|TRPM4|NM_017636|NP_060106|transient
        receptor potential cation channel,

          Length = 1214

 Score =  242 bits (616), Expect = 3e-063
 Identities = 186/635 (29%), Positives = 311/635 (48%), Gaps = 68/635 (10%)

Query:   6 WIERNFLKREC-IHIFPTKDP--TRCACGQLTTQHVAIPPGANSVEETIQLVQIDTPKDK 62
           || . | |. |   |  . ||  | | ||.  | | |.     ..|.      .      
Sbjct:  10 WIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAV-----AMEDAFGAAVVTV---- 60

Query:  63 WSIIKHTRTYPTDAFGVIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWQLELPTLLI 122
           |    ||   ||||.| ..| | |    . ..|.|  | |  .  |. . |    | |..
Sbjct:  61 WDSDAHTTEKPTDAYGELDFTGAG-RKHSNFLRLSDRTDPAAVYSLVTRTWGFRAPNLVV 119

Query: 123 SVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVNTGVIRHVGDALKDHSSKSRG 182
           || ||     ||  |. .  .||..|| .||||| |||..||. |||| |..||   | |
Sbjct: 120 SVLGGSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQMASTG 179

Query: 183 --KVCAIGIAPWGILENKEDLIGK--DVTRSYQSMANPLSKLAV-LNSSHSHFILTDNGT 237
             || |.|.||||.. |.. ||         |.   .|   .   |. ..| | | |.||
Sbjct: 180 GTKVVAMGVAPWGVVRNRDTLINPKGSFPARYRWRGDPEDGVQFPLDYNYSAFFLVDDGT 239

Query: 238 CGKYGSEVKLRRLLEKHISLQKINT-RLGQGVPLVCLIVEGGPNVISIALESLRDEPPIP 296
            |  | | . |  || .|| ||      |  .|.. |...|   ...  .|.   .  .|
Sbjct: 240 HGCLGGENRFRLRLESYISQQKTGVGGTGIDIPVLLLLIDGDEKMLT-RIEN-ATQAQLP 297

Query: 297 VVVCDGSGRASDIISFAHKFS---EDGGLVNDDVREQLLVTIQKTFNYSKSQSQQILLMV 353
            ..  ||| |.| ..   . .     ||    . |...     . | . |   . .   |
Sbjct: 298 CLLVAGSGGAADCLAETLEDTLAPGSGGARQGEARDRI-----RRF-FPKGDLEVLQAQV 351

Query: 354 MECMKKRELITVFRMGSEGQQDIEMAILTALLKGTNXXXXXX----XXXXXXWNRVDIAR 409
              | ..||.||.    .| .. |  .| ||.|                   |||||||.
Sbjct: 352 ERIMTRKELLTVY-SSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDIAQ 410

Query: 410 NHIFVYGHNLPVNSLEQAMMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTKLGP 469
           . .|          || ..||||. || .||.||. .|... ||||  || .||.    |
Sbjct: 411 SELFRGDIQWRSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPMRLAQLYSA--AP 468

Query: 470 ANTLNAVVRDV---KKGNLPPDY-----QITLIDIGLVLECFMGGAYRSNYTRKAFRNLY 521
           .|.|   . |      |   |       ..   |.| ||   .|      |        .
Sbjct: 469 SNSLIRNLLDQASHSAGTKAPALKGGAAELRPPDVGHVLRMLLGKMCAPRYPS---GGAW 525

Query: 522 NNLYGLKRPKALKLLGMEDDXXXXXXXXXXXXXXXXXXXXXXXXXXXCRFKFPFHELMLW 581
           .   |    ... ||  .                                . |. .|.||
Sbjct: 526 DPHPGQGFGESMYLLSDKATSPLSLDAGLG--------------------QAPWSDLLLW 565

Query: 582 AVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMA 616
           |.|. | .||.. |. |  |.. || || | . ||
Sbjct: 566 ALLLNRAQMAMYFWEMGSNAVSSALGACLLLRVMA 600

>hg18||uc004ajk
        |9|AY333284|Q9BX84-3|Q9BX84-3|TRPM6|NM_017662|NP_060132|transient
        receptor potential cation channel,

          Length = 2017

 Score =  238 bits (606), Expect = 4e-062
 Identities = 115/233 (49%), Positives = 151/233 (64%), Gaps = 3/233 (1%)

Query:  780 IPIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNYIILVKMERWPSMQEWIVISYILTLGT 839
            .|  .. .||| ||  |||| |..|| .|||. | .||.|.  ||.|||.|  || |   
Sbjct:  820 LPWTRKVYEFYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQPQPSVQEWLVSIYIFTNAI 879

Query:  840 EKVRQARILMSEPGKLKQKISVWLEEYWNITDLAAICTFLLGLMLRLQQEPYMGYGRVIY 899
            | ||.  | .|||||  ||. ||. ||||.|.  ||  |  | .||    |.   ||.||
Sbjct:  880 EVVRE--ICISEPGKFTQKVKVWISEYWNLTETVAIGLFSAGFVLRWGDPPFHTAGRLIY 937

Query:  900 CIDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVVIMLVVLMSFGVARQAILHPD 959
            |||||||. |.|| | ||.. ||||           | |.|| .||.||||||.||| | 
Sbjct:  938 CIDIIFWFSRLLDFFAVNQHAGPYVTMIAKMTANMFYIVIIMAIVLLSFGVARKAILSPK 997

Query:  960 EEPTWRLARNIFYMPYWMIYGEVFADSIDPPCGEHLYDEDGKRLPPCIPGAWL 1012
            | |.| |||.| . |||||||||.|  ||  |        |  | | .   .|
Sbjct:  998 EPPSWSLARDIVFEPYWMIYGEVYAGEID-VCSSQPSCPPGSFLTPFLQAVYL 1049

>hg18||uc004ajl
        |9|NM_017662|Q9BX84|TRPM6_HUMAN|TRPM6|NM_017662|NP_060132|transient
        receptor potential cation channel,

          Length = 2022

 Score =  238 bits (606), Expect = 4e-062
 Identities = 115/233 (49%), Positives = 151/233 (64%), Gaps = 3/233 (1%)

Query:  780 IPIGKRFFEFYDAPFTKFWFNTISYLGYLMLYNYIILVKMERWPSMQEWIVISYILTLGT 839
            .|  .. .||| ||  |||| |..|| .|||. | .||.|.  ||.|||.|  || |   
Sbjct:  825 LPWTRKVYEFYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQPQPSVQEWLVSIYIFTNAI 884

Query:  840 EKVRQARILMSEPGKLKQKISVWLEEYWNITDLAAICTFLLGLMLRLQQEPYMGYGRVIY 899
            | ||.  | .|||||  ||. ||. ||||.|.  ||  |  | .||    |.   ||.||
Sbjct:  885 EVVRE--ICISEPGKFTQKVKVWISEYWNLTETVAIGLFSAGFVLRWGDPPFHTAGRLIY 942

Query:  900 CIDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXXYFVVIMLVVLMSFGVARQAILHPD 959
            |||||||. |.|| | ||.. ||||           | |.|| .||.||||||.||| | 
Sbjct:  943 CIDIIFWFSRLLDFFAVNQHAGPYVTMIAKMTANMFYIVIIMAIVLLSFGVARKAILSPK 1002

Query:  960 EEPTWRLARNIFYMPYWMIYGEVFADSIDPPCGEHLYDEDGKRLPPCIPGAWL 1012
            | |.| |||.| . |||||||||.|  ||  |        |  | | .   .|
Sbjct: 1003 EPPSWSLARDIVFEPYWMIYGEVYAGEID-VCSSQPSCPPGSFLTPFLQAVYL 1054

>hg18||uc004ajk
        |9|AY333284|Q9BX84-3|Q9BX84-3|TRPM6|NM_017662|NP_060132|transient
        receptor potential cation channel,

          Length = 2017

 Score =  203 bits (516), Expect = 1e-051
 Identities = 92/144 (63%), Positives = 122/144 (84%)

Query: 571 FKFPFHELMLWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDISQ 630
           | .|...|..|||||||||||.| || ||||  ||..|| ||.|||||  || .||| |.
Sbjct: 599 FLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDASE 658

Query: 631 DLENNSKEFGQLAYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAHT 690
           .|.| ||.||||| .||....| .|..|| |||||| ||||||||||||.   | |..||
Sbjct: 659 ELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHT 718

Query: 691 CSQMLLTDMWMGRLRIGKNPSLKV 714
           |.||||||||||||.. ||  ||.
Sbjct: 719 CTQMLLTDMWMGRLKMRKNSWLKI 742

>hg18||uc004ajl
        |9|NM_017662|Q9BX84|TRPM6_HUMAN|TRPM6|NM_017662|NP_060132|transient
        receptor potential cation channel,

          Length = 2022

 Score =  203 bits (516), Expect = 1e-051
 Identities = 92/144 (63%), Positives = 122/144 (84%)

Query: 571 FKFPFHELMLWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDISQ 630
           | .|...|..|||||||||||.| || ||||  ||..|| ||.|||||  || .||| |.
Sbjct: 604 FLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDASE 663

Query: 631 DLENNSKEFGQLAYELLDQSYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAHT 690
           .|.| ||.||||| .||....| .|..|| |||||| ||||||||||||.   | |..||
Sbjct: 664 ELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHT 723

Query: 691 CSQMLLTDMWMGRLRIGKNPSLKV 714
           |.||||||||||||.. ||  ||.
Sbjct: 724 CTQMLLTDMWMGRLKMRKNSWLKI 747

>hg18||uc004ajm |9|CR618713|NA|NA|CHAK2|NA|NA|Homo sapiens channel kinase 2
        (CHAK2) mRNA, complete cds

          Length = 350

 Score =  174 bits (441), Expect = 6e-043
 Identities = 80/125 (64%), Positives = 104/125 (83%)

Query: 590 MALFLWQRGEEAMAKALVACKLYKAMAHECSESELVDDISQDLENNSKEFGQLAYELLDQ 649
           ||.| || ||||  ||..|| ||.|||||  || .||| |..|.| ||.||||| .||..
Sbjct:   1 MAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDASEELKNYSKQFGQLALDLLEK 60

Query: 650 SYKHDEQVAMKLLTYELVNWSNSTCLKLAVAAKQRDFIAHTCSQMLLTDMWMGRLRIGKN 709
           ..| .|..|| |||||| ||||||||||||.   | |..|||.||||||||||||.. ||
Sbjct:  61 AFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKN 120

Query: 710 PSLKV 714
             ||.
Sbjct: 121 SWLKI 125

>hg18||uc004ajm |9|CR618713|NA|NA|CHAK2|NA|NA|Homo sapiens channel kinase 2
        (CHAK2) mRNA, complete cds

          Length = 350

 Score =  171 bits (433), Expect = 5e-042
 Identities = 83/173 (47%), Positives = 109/173 (63%), Gaps = 2/173 (1%)

Query: 818 KMERWPSMQEWIVISYI--LTLGTEKVRQARILMSEPGKLKQKISVWLEEYWNITDLAAI 875
           .|   |  |..  . |       . |   . | .|||||  ||. ||. ||||.|.  ||
Sbjct: 145 EMSHVPQSQDFQFMWYYSDQNASSSKESASVICISEPGKFTQKVKVWISEYWNLTETVAI 204

Query: 876 CTFLLGLMLRLQQEPYMGYGRVIYCIDIIFWYIRVLDIFGVNKYLGPYVXXXXXXXXXXX 935
             |  | .||    |.   ||.|||||||||. |.|| | ||.. ||||           
Sbjct: 205 GLFSAGFVLRWGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKMTANMF 264

Query: 936 YFVVIMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSID 988
           | |.|| .||.||||||.||| | | |.| |||.| . |||||||||.|  ||
Sbjct: 265 YIVIIMAIVLLSFGVARKAILSPKEPPSWSLARDIVFEPYWMIYGEVYAGEID 317

>hg18||uc001zyu |15|BC051024|NA|NA|TRPM7|NM_017672|NP_060142|transient receptor
        potential cation channel,

          Length = 556

 Score =  144 bits (361), Expect = 1e-033
 Identities = 73/103 (70%), Positives = 84/103 (81%), Gaps = 1/103 (0%)

Query: 428 MMDALVLDRVDFVKLLLENGVNIHHFLTIPRLEELYNTKLGPAN-TLNAVVRDVKKGNLP 486
           |.||||.||| |||||.||||..| |||||||||||||| || |  |  .|||||.||||
Sbjct:   1 MLDALVMDRVAFVKLLIENGVSMHKFLTIPRLEELYNTKQGPTNPMLFHLVRDVKQGNLP 60

Query: 487 PDYQITLIDIGLVLECFMGGAYRSNYTRKAFRNLYNNLYGLKR 529
           | |.|||||||||.|  ||| ||  |||| || .||.| |  |
Sbjct:  61 PGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSLGGNNR 103

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,540,127
Number of Sequences: 45480
Number of Extensions: 192540127
Number of Successful Extensions: 11130575
Number of sequences better than 0.0: 0
BLASTP 7.6.0